F419835
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 354 | 157 | 354 | 376 |
Family's Representative Sequence
| Representative Sequence | 3300038443|Ga0395901_0216471|Ga0395901_0216471_218_1594 |
| Length | 426 |
| Sequence | MSNLLRGAFVIGRRDFSATVLSKTFLFFLLGPLFPLLFGVVFGGIGASVANSREKPAVAVVASEEDYVPIDAARNRLAAAIDEDHVVRLVRVDPEPNADAQRVHLLASHDPPVQAVLMGLPDHPQLTGPVRNDGTVAGQLRWILAGVDSKTQAEPPLAVAHTETSSASTSRDQALTGQAAQTVPIESLFIGKLFAMLAASILGIVVWTSAGAAIVASLKAGGLASLPAPAVGWPTFLALTAIYFAMNYLLFGAVXXTIGAQAATVREVQTLSMPVTFGQVLIFGFAATAVTAPSSKLALAAGVFPLSSPLTMVARAAQQPGLGQHALALGWQILWVAIILKIGASLFRKTVLKSGPRTRWRAARACPVSHSCIAMNGKGPWLTRAIPACAQSARLGPFGSHIALTGIGSALQIRSTLLRSVRPGMK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 34 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 45 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 46 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 47 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 51 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 52 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 54 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 55 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 126 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 127 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 128 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 129 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 130 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 131 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 132 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 133 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 134 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 135 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 136 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 137 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 138 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 139 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 140 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 141 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 142 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 143 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 144 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 145 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 146 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 147 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 148 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 149 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 150 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 151 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 152 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 153 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 154 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 157 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.28 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 99.44 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10005120 | 3300001979 | Bacteria | 5566 |
| 2 | JGI24740J21852_10009623 | 3300001979 | Bacteria | 3773 |
| 3 | JGI24739J22299_10000659 | 3300001989 | Bacteria | 12414 |
| 4 | JGI24737J22298_10000051 | 3300001990 | Bacteria | 34099 |
| 5 | JGI24737J22298_10017367 | 3300001990 | Bacteria | 2319 |
| 6 | JGI24738J21930_10000189 | 3300002075 | Bacteria | 16094 |
| 7 | rootH1_10286338 | 3300003323 | Bacteria | 1604 |
| 8 | Ga0070658_10092199 | 3300005327 | Bacteria | 2498 |
| 9 | Ga0070658_10164989 | 3300005327 | Bacteria | 1859 |
| 10 | Ga0070676_10000346 | 3300005328 | Bacteria | 21215 |
| 11 | Ga0070683_100055232 | 3300005329 | Bacteria | 3685 |
| 12 | Ga0070683_100121116 | 3300005329 | Bacteria | 2472 |
| 13 | Ga0070690_100057468 | 3300005330 | Bacteria | 2497 |
| 14 | Ga0070670_100006004 | 3300005331 | Bacteria | 10267 |
| 15 | Ga0070670_100178904 | 3300005331 | Bacteria | 1841 |
| 16 | Ga0068869_100000742 | 3300005334 | Bacteria | 18554 |
| 17 | Ga0070666_10016172 | 3300005335 | Bacteria | 4769 |
| 18 | Ga0070666_10032484 | 3300005335 | Bacteria | 3448 |
| 19 | Ga0070680_100171983 | 3300005336 | Bacteria | 1823 |
| 20 | Ga0068868_100011860 | 3300005338 | Bacteria | 6355 |
| 21 | Ga0070660_100000843 | 3300005339 | Bacteria | 20403 |
| 22 | Ga0070661_100010124 | 3300005344 | Bacteria | 6548 |
| 23 | Ga0070661_100026575 | 3300005344 | Bacteria | 4163 |
| 24 | Ga0070661_100058399 | 3300005344 | Bacteria | 2827 |
| 25 | Ga0070668_100007338 | 3300005347 | Bacteria | 8176 |
| 26 | Ga0070668_100019739 | 3300005347 | Bacteria | 5075 |
| 27 | Ga0070668_100026063 | 3300005347 | Bacteria | 4433 |
| 28 | Ga0070669_100000752 | 3300005353 | Bacteria | 23599 |
| 29 | Ga0070669_100034044 | 3300005353 | Bacteria | 3688 |
| 30 | Ga0070675_100074669 | 3300005354 | Bacteria | 2817 |
| 31 | Ga0070671_100007775 | 3300005355 | Bacteria | 8564 |
| 32 | Ga0070671_100070247 | 3300005355 | Bacteria | 2921 |
| 33 | Ga0070674_100008524 | 3300005356 | Bacteria | 6111 |
| 34 | Ga0070674_100009790 | 3300005356 | Bacteria | 5763 |
| 35 | Ga0070673_100000145 | 3300005364 | Bacteria | 33646 |
| 36 | Ga0070659_100000982 | 3300005366 | Bacteria | 20978 |
| 37 | Ga0070659_100019123 | 3300005366 | Bacteria | 5182 |
| 38 | Ga0070659_100028009 | 3300005366 | Bacteria | 4346 |
| 39 | Ga0070659_100054480 | 3300005366 | Bacteria | 3150 |
| 40 | Ga0070659_100098140 | 3300005366 | Bacteria | 2355 |
| 41 | Ga0070667_100000787 | 3300005367 | Bacteria | 29756 |
| 42 | Ga0070667_100007477 | 3300005367 | Bacteria | 9066 |
| 43 | Ga0070667_100024755 | 3300005367 | Bacteria | 4987 |
| 44 | Ga0070667_100041589 | 3300005367 | Bacteria | 3856 |
| 45 | Ga0070667_100068114 | 3300005367 | Bacteria | 3028 |
| 46 | Ga0070667_100158642 | 3300005367 | Bacteria | 1991 |
| 47 | Ga0070667_100179800 | 3300005367 | Bacteria | 1870 |
| 48 | Ga0070714_100005008 | 3300005435 | Bacteria | 10072 |
| 49 | Ga0070714_100224850 | 3300005435 | Bacteria | 1727 |
| 50 | Ga0070713_100150088 | 3300005436 | Unclassified | 2072 |
| 51 | Ga0070663_100001867 | 3300005455 | Bacteria | 11752 |
| 52 | Ga0070663_100035586 | 3300005455 | Bacteria | 3455 |
| 53 | Ga0070663_100054430 | 3300005455 | Bacteria | 2860 |
| 54 | Ga0070663_100064118 | 3300005455 | Bacteria | 2655 |
| 55 | Ga0070663_100102310 | 3300005455 | Bacteria | 2140 |
| 56 | Ga0070662_100000586 | 3300005457 | Bacteria | 22135 |
| 57 | Ga0070681_10222435 | 3300005458 | Bacteria | 1803 |
| 58 | Ga0068867_100001195 | 3300005459 | Bacteria | 17808 |
| 59 | Ga0068867_100012558 | 3300005459 | Bacteria | 5989 |
| 60 | Ga0070679_100068865 | 3300005530 | Bacteria | 3530 |
| 61 | Ga0070679_100234866 | 3300005530 | Bacteria | 1793 |
| 62 | Ga0070684_100280291 | 3300005535 | Bacteria | 1527 |
| 63 | Ga0068853_100000470 | 3300005539 | Bacteria | 27505 |
| 64 | Ga0068853_100009706 | 3300005539 | Bacteria | 7762 |
| 65 | Ga0068853_100091244 | 3300005539 | Bacteria | 2679 |
| 66 | Ga0070672_100002839 | 3300005543 | Bacteria | 11106 |
| 67 | Ga0070672_100170099 | 3300005543 | Bacteria | 1812 |
| 68 | Ga0070672_100185058 | 3300005543 | Bacteria | 1737 |
| 69 | Ga0070665_100004457 | 3300005548 | Bacteria | 14713 |
| 70 | Ga0070665_100006112 | 3300005548 | Bacteria | 12313 |
| 71 | Ga0070665_100069672 | 3300005548 | Bacteria | 3525 |
| 72 | Ga0070665_100134592 | 3300005548 | Bacteria | 2473 |
| 73 | Ga0068855_100005215 | 3300005563 | Bacteria | 15851 |
| 74 | Ga0068855_100046324 | 3300005563 | Bacteria | 5141 |
| 75 | Ga0070664_100027011 | 3300005564 | Bacteria | 4768 |
| 76 | Ga0070664_100076899 | 3300005564 | Bacteria | 2869 |
| 77 | Ga0068857_100001148 | 3300005577 | Bacteria | 20637 |
| 78 | Ga0068857_100131875 | 3300005577 | Bacteria | 2254 |
| 79 | Ga0068854_100000061 | 3300005578 | Bacteria | 78663 |
| 80 | Ga0068854_100004256 | 3300005578 | Bacteria | 9013 |
| 81 | Ga0068854_100014552 | 3300005578 | Bacteria | 5190 |
| 82 | Ga0068854_100037465 | 3300005578 | Bacteria | 3404 |
| 83 | Ga0068854_100172745 | 3300005578 | Bacteria | 1683 |
| 84 | Ga0068856_100005795 | 3300005614 | Bacteria | 12175 |
| 85 | Ga0068856_100130219 | 3300005614 | Bacteria | 2520 |
| 86 | Ga0068856_100262673 | 3300005614 | Bacteria | 1742 |
| 87 | Ga0068856_100289862 | 3300005614 | Bacteria | 1654 |
| 88 | Ga0068856_100388227 | 3300005614 | Bacteria | 1416 |
| 89 | Ga0068852_100000288 | 3300005616 | Bacteria | 33771 |
| 90 | Ga0068852_100000751 | 3300005616 | Bacteria | 21304 |
| 91 | Ga0068852_100001393 | 3300005616 | Bacteria | 16266 |
| 92 | Ga0068852_100006051 | 3300005616 | Bacteria | 8715 |
| 93 | Ga0068852_100028132 | 3300005616 | Bacteria | 4595 |
| 94 | Ga0068852_100167056 | 3300005616 | Bacteria | 2059 |
| 95 | Ga0068859_100000324 | 3300005617 | Bacteria | 47483 |
| 96 | Ga0068859_100000778 | 3300005617 | Bacteria | 32222 |
| 97 | Ga0068864_100000291 | 3300005618 | Bacteria | 44522 |
| 98 | Ga0068864_100000795 | 3300005618 | Bacteria | 26479 |
| 99 | Ga0068866_10006297 | 3300005718 | Bacteria | 4942 |
| 100 | Ga0068861_100052822 | 3300005719 | Bacteria | 3090 |
| 101 | Ga0068851_10002886 | 3300005834 | Bacteria | 7593 |
| 102 | Ga0068851_10014434 | 3300005834 | Bacteria | 3750 |
| 103 | Ga0068863_100001605 | 3300005841 | Bacteria | 22350 |
| 104 | Ga0068863_100002255 | 3300005841 | Bacteria | 19144 |
| 105 | Ga0068863_100033904 | 3300005841 | Bacteria | 4864 |
| 106 | Ga0068858_100002203 | 3300005842 | Bacteria | 19730 |
| 107 | Ga0068858_100005886 | 3300005842 | Bacteria | 11970 |
| 108 | Ga0068860_100001686 | 3300005843 | Bacteria | 23599 |
| 109 | Ga0068860_100001774 | 3300005843 | Bacteria | 22958 |
| 110 | Ga0068860_100060088 | 3300005843 | Bacteria | 3613 |
| 111 | Ga0068860_100197562 | 3300005843 | Bacteria | 1948 |
| 112 | Ga0068862_100003906 | 3300005844 | Bacteria | 12668 |
| 113 | Ga0068862_100008684 | 3300005844 | Bacteria | 8406 |
| 114 | Ga0068862_100042404 | 3300005844 | Bacteria | 3876 |
| 115 | Ga0081539_10040870 | 3300005985 | Bacteria | 2718 |
| 116 | Ga0070717_10030093 | 3300006028 | Bacteria | 4361 |
| 117 | Ga0068871_100177892 | 3300006358 | Bacteria | 1827 |
| 118 | Ga0068865_100007421 | 3300006881 | Bacteria | 6747 |
| 119 | Ga0097620_100000324 | 3300006931 | Bacteria | 47483 |
| 120 | Ga0097620_100000778 | 3300006931 | Bacteria | 32222 |
| 121 | Ga0105250_10007638 | 3300009092 | Bacteria | 4635 |
| 122 | Ga0105240_10056373 | 3300009093 | Bacteria | 4918 |
| 123 | Ga0105245_10000326 | 3300009098 | Bacteria | 44899 |
| 124 | Ga0105243_10073739 | 3300009148 | Bacteria | 2766 |
| 125 | Ga0105241_10172323 | 3300009174 | Bacteria | 1788 |
| 126 | Ga0105248_10000123 | 3300009177 | Bacteria | 89301 |
| 127 | Ga0105248_10000159 | 3300009177 | Bacteria | 78504 |
| 128 | Ga0105248_10009193 | 3300009177 | Bacteria | 10873 |
| 129 | Ga0105248_10023758 | 3300009177 | Bacteria | 6812 |
| 130 | Ga0105237_10255511 | 3300009545 | Bacteria | 1754 |
| 131 | Ga0105237_10426039 | 3300009545 | Bacteria | 1332 |
| 132 | Ga0105239_10020658 | 3300010375 | Bacteria | 7265 |
| 133 | Ga0105239_10368052 | 3300010375 | Bacteria | 1624 |
| 134 | Ga0105246_10019698 | 3300011119 | Bacteria | 4317 |
| 135 | Ga0157373_10002590 | 3300013100 | Bacteria | 13733 |
| 136 | Ga0157373_10120344 | 3300013100 | Bacteria | 1845 |
| 137 | Ga0157371_10001589 | 3300013102 | Bacteria | 23310 |
| 138 | Ga0157371_10002546 | 3300013102 | Bacteria | 17309 |
| 139 | Ga0157371_10029261 | 3300013102 | Bacteria | 3986 |
| 140 | Ga0157371_10051837 | 3300013102 | Bacteria | 2915 |
| 141 | Ga0157371_10056490 | 3300013102 | Bacteria | 2785 |
| 142 | Ga0157371_10069825 | 3300013102 | Bacteria | 2487 |
| 143 | Ga0157370_10030536 | 3300013104 | Bacteria | 5279 |
| 144 | Ga0157370_10330180 | 3300013104 | Bacteria | 1406 |
| 145 | Ga0157369_10000823 | 3300013105 | Bacteria | 39591 |
| 146 | Ga0157369_10005643 | 3300013105 | Bacteria | 14541 |
| 147 | Ga0157369_10123636 | 3300013105 | Bacteria | 2744 |
| 148 | Ga0157369_10129433 | 3300013105 | Bacteria | 2675 |
| 149 | Ga0157374_10002301 | 3300013296 | Bacteria | 16089 |
| 150 | Ga0157378_10002474 | 3300013297 | Bacteria | 16436 |
| 151 | Ga0163162_10014860 | 3300013306 | Bacteria | 7603 |
| 152 | Ga0157372_10088593 | 3300013307 | Bacteria | 3514 |
| 153 | Ga0157372_10180276 | 3300013307 | Bacteria | 2445 |
| 154 | Ga0157375_10020866 | 3300013308 | Bacteria | 5996 |
| 155 | Ga0157375_10030674 | 3300013308 | Bacteria | 5073 |
| 156 | Ga0157375_10185031 | 3300013308 | Bacteria | 2236 |
| 157 | Ga0163163_10000265 | 3300014325 | Bacteria | 52453 |
| 158 | Ga0157379_10002236 | 3300014968 | Bacteria | 16110 |
| 159 | Ga0207697_10000664 | 3300025315 | Bacteria | 19543 |
| 160 | Ga0207656_10002512 | 3300025321 | Bacteria | 6192 |
| 161 | Ga0207656_10002673 | 3300025321 | Bacteria | 6041 |
| 162 | Ga0207688_10000730 | 3300025901 | Bacteria | 16298 |
| 163 | Ga0207680_10013220 | 3300025903 | Bacteria | 4233 |
| 164 | Ga0207647_10002581 | 3300025904 | Bacteria | 13711 |
| 165 | Ga0207647_10042920 | 3300025904 | Bacteria | 2833 |
| 166 | Ga0207647_10135203 | 3300025904 | Bacteria | 1447 |
| 167 | Ga0207645_10000418 | 3300025907 | Bacteria | 35293 |
| 168 | Ga0207645_10015378 | 3300025907 | Bacteria | 5086 |
| 169 | Ga0207643_10058941 | 3300025908 | Bacteria | 2190 |
| 170 | Ga0207705_10000753 | 3300025909 | Bacteria | 26696 |
| 171 | Ga0207705_10000955 | 3300025909 | Bacteria | 23634 |
| 172 | Ga0207705_10028245 | 3300025909 | Bacteria | 3999 |
| 173 | Ga0207705_10039780 | 3300025909 | Bacteria | 3370 |
| 174 | Ga0207654_10133836 | 3300025911 | Bacteria | 1572 |
| 175 | Ga0207695_10001271 | 3300025913 | Bacteria | 42892 |
| 176 | Ga0207695_10006302 | 3300025913 | Bacteria | 15443 |
| 177 | Ga0207660_10164543 | 3300025917 | Bacteria | 1714 |
| 178 | Ga0207657_10002400 | 3300025919 | Bacteria | 20254 |
| 179 | Ga0207657_10004723 | 3300025919 | Bacteria | 14377 |
| 180 | Ga0207657_10007311 | 3300025919 | Bacteria | 11327 |
| 181 | Ga0207657_10007978 | 3300025919 | Bacteria | 10792 |
| 182 | Ga0207649_10000176 | 3300025920 | Bacteria | 52479 |
| 183 | Ga0207649_10015973 | 3300025920 | Bacteria | 4225 |
| 184 | Ga0207681_10001054 | 3300025923 | Bacteria | 17872 |
| 185 | Ga0207681_10014078 | 3300025923 | Bacteria | 4960 |
| 186 | Ga0207681_10061706 | 3300025923 | Bacteria | 2578 |
| 187 | Ga0207681_10146943 | 3300025923 | Bacteria | 1762 |
| 188 | Ga0207694_10062350 | 3300025924 | Bacteria | 2903 |
| 189 | Ga0207650_10014311 | 3300025925 | Bacteria | 5513 |
| 190 | Ga0207659_10064364 | 3300025926 | Bacteria | 2653 |
| 191 | Ga0207687_10003615 | 3300025927 | Bacteria | 10415 |
| 192 | Ga0207700_10107863 | 3300025928 | Unclassified | 2235 |
| 193 | Ga0207700_10139607 | 3300025928 | Bacteria | 1989 |
| 194 | Ga0207644_10005155 | 3300025931 | Bacteria | 8535 |
| 195 | Ga0207644_10048417 | 3300025931 | Bacteria | 3039 |
| 196 | Ga0207690_10006190 | 3300025932 | Bacteria | 7088 |
| 197 | Ga0207690_10031571 | 3300025932 | Bacteria | 3391 |
| 198 | Ga0207690_10032936 | 3300025932 | Bacteria | 3329 |
| 199 | Ga0207706_10000171 | 3300025933 | Bacteria | 72122 |
| 200 | Ga0207706_10034047 | 3300025933 | Bacteria | 4533 |
| 201 | Ga0207706_10108873 | 3300025933 | Bacteria | 2438 |
| 202 | Ga0207709_10047802 | 3300025935 | Bacteria | 2603 |
| 203 | Ga0207669_10005747 | 3300025937 | Bacteria | 5598 |
| 204 | Ga0207704_10008679 | 3300025938 | Bacteria | 4873 |
| 205 | Ga0207704_10126843 | 3300025938 | Bacteria | 1759 |
| 206 | Ga0207691_10001864 | 3300025940 | Bacteria | 20610 |
| 207 | Ga0207691_10203373 | 3300025940 | Bacteria | 1723 |
| 208 | Ga0207711_10000100 | 3300025941 | Bacteria | 91024 |
| 209 | Ga0207711_10009134 | 3300025941 | Bacteria | 8280 |
| 210 | Ga0207711_10009429 | 3300025941 | Bacteria | 8147 |
| 211 | Ga0207711_10015381 | 3300025941 | Bacteria | 6350 |
| 212 | Ga0207689_10000092 | 3300025942 | Bacteria | 73254 |
| 213 | Ga0207679_10103116 | 3300025945 | Bacteria | 2235 |
| 214 | Ga0207679_10104134 | 3300025945 | Bacteria | 2226 |
| 215 | Ga0207667_10013772 | 3300025949 | Bacteria | 9242 |
| 216 | Ga0207667_10016701 | 3300025949 | Bacteria | 8283 |
| 217 | Ga0207667_10135934 | 3300025949 | Bacteria | 2531 |
| 218 | Ga0207667_10219469 | 3300025949 | Bacteria | 1948 |
| 219 | Ga0207651_10000521 | 3300025960 | Bacteria | 16209 |
| 220 | Ga0207651_10032476 | 3300025960 | Bacteria | 3353 |
| 221 | Ga0207712_10032226 | 3300025961 | Bacteria | 3536 |
| 222 | Ga0207668_10000080 | 3300025972 | Bacteria | 72198 |
| 223 | Ga0207668_10010968 | 3300025972 | Bacteria | 5493 |
| 224 | Ga0207668_10045583 | 3300025972 | Bacteria | 2991 |
| 225 | Ga0207640_10000295 | 3300025981 | Bacteria | 33245 |
| 226 | Ga0207640_10028717 | 3300025981 | Bacteria | 3405 |
| 227 | Ga0207640_10274150 | 3300025981 | Bacteria | 1321 |
| 228 | Ga0207658_10001697 | 3300025986 | Bacteria | 16729 |
| 229 | Ga0207658_10067648 | 3300025986 | Bacteria | 2692 |
| 230 | Ga0207658_10147835 | 3300025986 | Bacteria | 1910 |
| 231 | Ga0207677_10047130 | 3300026023 | Bacteria | 2892 |
| 232 | Ga0207703_10002403 | 3300026035 | Bacteria | 16272 |
| 233 | Ga0207639_10002585 | 3300026041 | Bacteria | 12151 |
| 234 | Ga0207639_10050451 | 3300026041 | Bacteria | 3160 |
| 235 | Ga0207639_10065869 | 3300026041 | Bacteria | 2813 |
| 236 | Ga0207639_10120212 | 3300026041 | Bacteria | 2157 |
| 237 | Ga0207678_10000198 | 3300026067 | Bacteria | 52573 |
| 238 | Ga0207678_10001415 | 3300026067 | Bacteria | 21990 |
| 239 | Ga0207678_10002551 | 3300026067 | Bacteria | 16595 |
| 240 | Ga0207678_10024551 | 3300026067 | Bacteria | 5265 |
| 241 | Ga0207678_10074590 | 3300026067 | Bacteria | 2907 |
| 242 | Ga0207678_10097854 | 3300026067 | Bacteria | 2507 |
| 243 | Ga0207678_10139030 | 3300026067 | Bacteria | 2072 |
| 244 | Ga0207678_10230744 | 3300026067 | Bacteria | 1585 |
| 245 | Ga0207702_10008268 | 3300026078 | Bacteria | 8791 |
| 246 | Ga0207702_10008747 | 3300026078 | Bacteria | 8536 |
| 247 | Ga0207641_10000221 | 3300026088 | Bacteria | 74390 |
| 248 | Ga0207641_10002549 | 3300026088 | Bacteria | 16763 |
| 249 | Ga0207641_10027083 | 3300026088 | Bacteria | 4733 |
| 250 | Ga0207641_10075248 | 3300026088 | Bacteria | 2916 |
| 251 | Ga0207648_10000317 | 3300026089 | Bacteria | 52853 |
| 252 | Ga0207648_10005328 | 3300026089 | Bacteria | 12967 |
| 253 | Ga0207648_10019358 | 3300026089 | Bacteria | 6144 |
| 254 | Ga0207676_10000378 | 3300026095 | Bacteria | 37895 |
| 255 | Ga0207676_10001355 | 3300026095 | Bacteria | 18216 |
| 256 | Ga0207674_10012074 | 3300026116 | Bacteria | 9675 |
| 257 | Ga0207674_10033675 | 3300026116 | Bacteria | 5362 |
| 258 | Ga0207674_10140812 | 3300026116 | Bacteria | 2371 |
| 259 | Ga0207674_10242524 | 3300026116 | Bacteria | 1749 |
| 260 | Ga0207675_100092591 | 3300026118 | Bacteria | 2843 |
| 261 | Ga0207698_10000125 | 3300026142 | Bacteria | 48032 |
| 262 | Ga0207698_10004848 | 3300026142 | Bacteria | 8241 |
| 263 | Ga0207698_10009150 | 3300026142 | Bacteria | 6297 |
| 264 | Ga0207698_10029432 | 3300026142 | Bacteria | 3934 |
| 265 | Ga0207698_10057657 | 3300026142 | Bacteria | 3006 |
| 266 | Ga0268266_10000433 | 3300028379 | Bacteria | 62887 |
| 267 | Ga0268266_10006457 | 3300028379 | Bacteria | 10737 |
| 268 | Ga0268265_10001441 | 3300028380 | Bacteria | 20055 |
| 269 | Ga0268265_10010998 | 3300028380 | Bacteria | 6113 |
| 270 | Ga0268265_10021625 | 3300028380 | Bacteria | 4509 |
| 271 | Ga0268265_10073863 | 3300028380 | Bacteria | 2665 |
| 272 | Ga0268265_10146134 | 3300028380 | Bacteria | 1987 |
| 273 | Ga0268265_10322166 | 3300028380 | Bacteria | 1400 |
| 274 | Ga0268264_10169695 | 3300028381 | Bacteria | 1972 |
| 275 | Ga0307406_10168284 | 3300031901 | Bacteria | 1583 |
| 276 | Ga0307412_10162064 | 3300031911 | Bacteria | 1663 |
| 277 | Ga0307412_10214928 | 3300031911 | Bacteria | 1470 |
| 278 | Ga0307409_100062846 | 3300031995 | Bacteria | 2908 |
| 279 | Ga0307416_100013849 | 3300032002 | Bacteria | 5497 |
| 280 | Ga0307414_10012920 | 3300032004 | Bacteria | 4957 |
| 281 | Ga0307414_10121035 | 3300032004 | Bacteria | 2012 |
| 282 | Ga0373923_0034859 | 3300035111 | Bacteria | 2045 |
| 283 | Ga0373943_0016072 | 3300035170 | Bacteria | 3408 |
| 284 | Ga0373935_0010669 | 3300035692 | Bacteria | 5517 |
| 285 | Ga0373933_0083037 | 3300035724 | Bacteria | 1967 |
| 286 | Ga0373937_0244628 | 3300036401 | Bacteria | 1690 |
| 287 | Ga0373925_0007643 | 3300037068 | Bacteria | 7874 |
| 288 | Ga0395899_0005689 | 3300037312 | Bacteria | 9678 |
| 289 | Ga0395899_0033513 | 3300037312 | Bacteria | 3857 |
| 290 | Ga0395899_0035798 | 3300037312 | Bacteria | 3726 |
| 291 | Ga0395899_0038441 | 3300037312 | Bacteria | 3584 |
| 292 | Ga0395900_0035752 | 3300037418 | Bacteria | 5118 |
| 293 | Ga0395900_0043543 | 3300037418 | Bacteria | 4626 |
| 294 | Ga0395900_0053831 | 3300037418 | Bacteria | 4142 |
| 295 | Ga0395900_0056442 | 3300037418 | Bacteria | 4042 |
| 296 | Ga0395900_0086497 | 3300037418 | Bacteria | 3221 |
| 297 | Ga0395900_0108525 | 3300037418 | Bacteria | 2851 |
| 298 | Ga0395900_0195706 | 3300037418 | Bacteria | 2048 |
| 299 | Ga0395900_0247272 | 3300037418 | Bacteria | 1786 |
| 300 | Ga0395900_0292617 | 3300037418 | Bacteria | 1617 |
| 301 | Ga0395900_0294835 | 3300037418 | Bacteria | 1609 |
| 302 | Ga0395898_0003841 | 3300037466 | Bacteria | 16653 |
| 303 | Ga0395898_0027954 | 3300037466 | Bacteria | 5656 |
| 304 | Ga0395898_0107741 | 3300037466 | Bacteria | 2672 |
| 305 | Ga0395898_0120325 | 3300037466 | Bacteria | 2515 |
| 306 | Ga0395898_0162927 | 3300037466 | Bacteria | 2133 |
| 307 | Ga0395905_0000974 | 3300037471 | Bacteria | 36725 |
| 308 | Ga0395905_0002062 | 3300037471 | Bacteria | 22902 |
| 309 | Ga0395905_0004757 | 3300037471 | Bacteria | 14031 |
| 310 | Ga0395905_0008521 | 3300037471 | Bacteria | 10110 |
| 311 | Ga0395905_0010733 | 3300037471 | Bacteria | 8882 |
| 312 | Ga0395905_0013490 | 3300037471 | Bacteria | 7829 |
| 313 | Ga0395905_0038274 | 3300037471 | Bacteria | 4500 |
| 314 | Ga0395905_0043405 | 3300037471 | Bacteria | 4218 |
| 315 | Ga0395905_0045226 | 3300037471 | Bacteria | 4129 |
| 316 | Ga0395905_0093660 | 3300037471 | Bacteria | 2817 |
| 317 | Ga0395905_0193672 | 3300037471 | Bacteria | 1906 |
| 318 | Ga0395905_0206160 | 3300037471 | Bacteria | 1842 |
| 319 | Ga0395905_0250931 | 3300037471 | Bacteria | 1653 |
| 320 | Ga0395905_0273795 | 3300037471 | Bacteria | 1574 |
| 321 | Ga0395905_0282641 | 3300037471 | Bacteria | 1545 |
| 322 | Ga0395901_0015236 | 3300038443 | Bacteria | 7823 |
| 323 | Ga0395901_0039088 | 3300038443 | Bacteria | 4909 |
| 324 | Ga0395901_0047091 | 3300038443 | Bacteria | 4478 |
| 325 | Ga0395901_0049121 | 3300038443 | Bacteria | 4382 |
| 326 | Ga0395901_0076920 | 3300038443 | Bacteria | 3482 |
| 327 | Ga0395901_0216471 | 3300038443 | Bacteria | 2003 |
| 328 | Ga0395901_0357956 | 3300038443 | Bacteria | 1505 |
| 329 | Ga0439438_022957 | 3300041405 | Bacteria | 1725 |
| 330 | Ga0439448_0006381 | 3300042005 | Bacteria | 3390 |
| 331 | Ga0450889_000005 | 3300042144 | Bacteria | 19354 |
| 332 | Ga0439458_0000012 | 3300042157 | Bacteria | 27891 |
| 333 | Ga0439464_0003424 | 3300042439 | Bacteria | 3999 |
| 334 | Ga0466966_0000004 | 3300044684 | Bacteria | 223594 |
| 335 | Ga0466966_0125445 | 3300044684 | Bacteria | 1575 |
| 336 | Ga0466961_0015272 | 3300044693 | Bacteria | 4931 |
| 337 | Ga0466961_0049536 | 3300044693 | Bacteria | 2684 |
| 338 | Ga0466963_0001967 | 3300044694 | Bacteria | 11280 |
| 339 | Ga0466963_0075839 | 3300044694 | Bacteria | 2270 |
| 340 | Ga0466971_0048749 | 3300044719 | Bacteria | 1904 |
| 341 | Ga0466970_0015736 | 3300044765 | Bacteria | 3894 |
| 342 | Ga0466970_0035002 | 3300044765 | Bacteria | 2660 |
| 343 | Ga0466970_0153050 | 3300044765 | Bacteria | 1274 |
| 344 | Ga0466957_0004237 | 3300044842 | Bacteria | 7953 |
| 345 | Ga0466957_0092533 | 3300044842 | Bacteria | 1896 |
| 346 | Ga0466959_0124353 | 3300045049 | Bacteria | 1831 |
| 347 | Ga0466958_0001495 | 3300045836 | Bacteria | 11169 |
| 348 | Ga0495668_0003737 | 3300046616 | Bacteria | 11181 |
| 349 | Ga0495669_0018051 | 3300046684 | Bacteria | 3031 |
| 350 | Ga0495669_0022569 | 3300046684 | Bacteria | 2734 |
| 351 | Ga0495669_0050308 | 3300046684 | Bacteria | 1868 |
| 352 | Ga0500658_0000173 | 3300053134 | Bacteria | 30720 |
| 353 | Ga0466962_0004605 | 3300061719 | Bacteria | 6617 |
| 354 | Ga0466962_0021612 | 3300061719 | Bacteria | 3088 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013308 | Ga0157375_10185031 | Ga0157375_101850312 | 318 |
| 2 | 3300005985 | Ga0081539_10040870 | Ga0081539_100408702 | 321 |
| 3 | 3300005367 | Ga0070667_100068114 | Ga0070667_1000681143 | 325 |
| 4 | 3300005367 | Ga0070667_100158642 | Ga0070667_1001586422 | 326 |
| 5 | 3300009177 | Ga0105248_10009193 | Ga0105248_100091933 | 326 |
| 6 | 3300025941 | Ga0207711_10015381 | Ga0207711_100153812 | 326 |
| 7 | 3300046684 | Ga0495669_0050308 | Ga0495669_0050308_338_1555 | 331 |
| 8 | 3300005535 | Ga0070684_100280291 | Ga0070684_1002802912 | 332 |
| 9 | 3300005614 | Ga0068856_100130219 | Ga0068856_1001302193 | 336 |
| 10 | 3300009545 | Ga0105237_10426039 | Ga0105237_104260391 | 336 |
| 11 | 3300013102 | Ga0157371_10056490 | Ga0157371_100564902 | 336 |
| 12 | 3300013104 | Ga0157370_10330180 | Ga0157370_103301801 | 336 |
| 13 | 3300026078 | Ga0207702_10008747 | Ga0207702_100087475 | 336 |
| 14 | 3300037418 | Ga0395900_0247272 | Ga0395900_0247272_247_1434 | 336 |
| 15 | 3300005327 | Ga0070658_10092199 | Ga0070658_100921993 | 339 |
| 16 | 3300037418 | Ga0395900_0108525 | Ga0395900_0108525_1237_2436 | 340 |
| 17 | 3300005329 | Ga0070683_100055232 | Ga0070683_1000552323 | 342 |
| 18 | 3300005335 | Ga0070666_10016172 | Ga0070666_100161725 | 342 |
| 19 | 3300005367 | Ga0070667_100024755 | Ga0070667_1000247555 | 342 |
| 20 | 3300005436 | Ga0070713_100150088 | Ga0070713_1001500881 | 342 |
| 21 | 3300005548 | Ga0070665_100069672 | Ga0070665_1000696723 | 342 |
| 22 | 3300005578 | Ga0068854_100014552 | Ga0068854_1000145525 | 342 |
| 23 | 3300006028 | Ga0070717_10030093 | Ga0070717_100300932 | 342 |
| 24 | 3300013307 | Ga0157372_10180276 | Ga0157372_101802762 | 342 |
| 25 | 3300025904 | Ga0207647_10135203 | Ga0207647_101352032 | 342 |
| 26 | 3300025928 | Ga0207700_10107863 | Ga0207700_101078633 | 342 |
| 27 | 3300025933 | Ga0207706_10108873 | Ga0207706_101088732 | 342 |
| 28 | 3300026041 | Ga0207639_10065869 | Ga0207639_100658693 | 342 |
| 29 | 3300026067 | Ga0207678_10000198 | Ga0207678_1000019831 | 342 |
| 30 | 3300026116 | Ga0207674_10012074 | Ga0207674_100120749 | 342 |
| 31 | 3300037471 | Ga0395905_0093660 | Ga0395905_0093660_1296_2495 | 342 |
| 32 | 3300005578 | Ga0068854_100004256 | Ga0068854_1000042566 | 344 |
| 33 | 3300025904 | Ga0207647_10042920 | Ga0207647_100429203 | 344 |
| 34 | 3300025913 | Ga0207695_10001271 | Ga0207695_1000127129 | 344 |
| 35 | 3300025981 | Ga0207640_10000295 | Ga0207640_1000029529 | 344 |
| 36 | 3300037471 | Ga0395905_0002062 | Ga0395905_0002062_13344_14537 | 344 |
| 37 | 3300026067 | Ga0207678_10097854 | Ga0207678_100978542 | 345 |
| 38 | 3300037312 | Ga0395899_0038441 | Ga0395899_0038441_1940_3133 | 345 |
| 39 | 3300037418 | Ga0395900_0294835 | Ga0395900_0294835_272_1465 | 345 |
| 40 | 3300044684 | Ga0466966_0125445 | Ga0466966_0125445_307_1506 | 345 |
| 41 | 3300044765 | Ga0466970_0153050 | Ga0466970_0153050_28_1227 | 345 |
| 42 | 3300005366 | Ga0070659_100019123 | Ga0070659_1000191234 | 346 |
| 43 | 3300025932 | Ga0207690_10031571 | Ga0207690_100315713 | 346 |
| 44 | 3300037471 | Ga0395905_0250931 | Ga0395905_0250931_103_1305 | 346 |
| 45 | 3300044694 | Ga0466963_0075839 | Ga0466963_0075839_567_1766 | 346 |
| 46 | 3300037312 | Ga0395899_0005689 | Ga0395899_0005689_3473_4672 | 347 |
| 47 | 3300037418 | Ga0395900_0035752 | Ga0395900_0035752_1328_2527 | 347 |
| 48 | 3300037418 | Ga0395900_0195706 | Ga0395900_0195706_296_1510 | 347 |
| 49 | 3300037466 | Ga0395898_0027954 | Ga0395898_0027954_997_2196 | 347 |
| 50 | 3300037471 | Ga0395905_0013490 | Ga0395905_0013490_4108_5307 | 347 |
| 51 | 3300037471 | Ga0395905_0038274 | Ga0395905_0038274_1467_2699 | 347 |
| 52 | 3300037471 | Ga0395905_0282641 | Ga0395905_0282641_95_1294 | 347 |
| 53 | 3300038443 | Ga0395901_0015236 | Ga0395901_0015236_3300_4532 | 347 |
| 54 | 3300038443 | Ga0395901_0039088 | Ga0395901_0039088_1626_2825 | 347 |
| 55 | 3300038443 | Ga0395901_0076920 | Ga0395901_0076920_1844_3043 | 347 |
| 56 | 3300005347 | Ga0070668_100019739 | Ga0070668_1000197393 | 348 |
| 57 | 3300005366 | Ga0070659_100028009 | Ga0070659_1000280095 | 348 |
| 58 | 3300005455 | Ga0070663_100102310 | Ga0070663_1001023102 | 348 |
| 59 | 3300005843 | Ga0068860_100060088 | Ga0068860_1000600882 | 348 |
| 60 | 3300005844 | Ga0068862_100008684 | Ga0068862_1000086846 | 348 |
| 61 | 3300025909 | Ga0207705_10000955 | Ga0207705_1000095514 | 348 |
| 62 | 3300025919 | Ga0207657_10004723 | Ga0207657_1000472315 | 348 |
| 63 | 3300025920 | Ga0207649_10015973 | Ga0207649_100159732 | 348 |
| 64 | 3300025933 | Ga0207706_10034047 | Ga0207706_100340475 | 348 |
| 65 | 3300028380 | Ga0268265_10010998 | Ga0268265_100109981 | 348 |
| 66 | 3300037418 | Ga0395900_0043543 | Ga0395900_0043543_2087_3316 | 348 |
| 67 | 3300037471 | Ga0395905_0206160 | Ga0395905_0206160_203_1435 | 348 |
| 68 | 3300044693 | Ga0466961_0015272 | Ga0466961_0015272_3489_4682 | 348 |
| 69 | 3300003323 | rootH1_10286338 | rootH1_102863382 | 349 |
| 70 | 3300044693 | Ga0466961_0049536 | Ga0466961_0049536_611_1810 | 349 |
| 71 | 3300044694 | Ga0466963_0001967 | Ga0466963_0001967_3465_4658 | 349 |
| 72 | 3300044719 | Ga0466971_0048749 | Ga0466971_0048749_311_1510 | 349 |
| 73 | 3300044765 | Ga0466970_0015736 | Ga0466970_0015736_2653_3846 | 349 |
| 74 | 3300044765 | Ga0466970_0035002 | Ga0466970_0035002_1248_2447 | 349 |
| 75 | 3300044842 | Ga0466957_0004237 | Ga0466957_0004237_6468_7661 | 349 |
| 76 | 3300044842 | Ga0466957_0092533 | Ga0466957_0092533_564_1763 | 349 |
| 77 | 3300045049 | Ga0466959_0124353 | Ga0466959_0124353_145_1344 | 349 |
| 78 | 3300045836 | Ga0466958_0001495 | Ga0466958_0001495_1927_3120 | 349 |
| 79 | 3300061719 | Ga0466962_0004605 | Ga0466962_0004605_1209_2402 | 349 |
| 80 | 3300061719 | Ga0466962_0021612 | Ga0466962_0021612_1118_2317 | 349 |
| 81 | 3300005353 | Ga0070669_100034044 | Ga0070669_1000340442 | 350 |
| 82 | 3300005355 | Ga0070671_100070247 | Ga0070671_1000702474 | 350 |
| 83 | 3300005367 | Ga0070667_100000787 | Ga0070667_10000078716 | 350 |
| 84 | 3300005367 | Ga0070667_100007477 | Ga0070667_1000074772 | 350 |
| 85 | 3300005455 | Ga0070663_100064118 | Ga0070663_1000641182 | 350 |
| 86 | 3300005543 | Ga0070672_100170099 | Ga0070672_1001700992 | 350 |
| 87 | 3300005617 | Ga0068859_100000324 | Ga0068859_10000032428 | 350 |
| 88 | 3300005618 | Ga0068864_100000291 | Ga0068864_10000029119 | 350 |
| 89 | 3300005841 | Ga0068863_100002255 | Ga0068863_10000225511 | 350 |
| 90 | 3300005842 | Ga0068858_100005886 | Ga0068858_1000058869 | 350 |
| 91 | 3300005843 | Ga0068860_100001774 | Ga0068860_10000177416 | 350 |
| 92 | 3300006931 | Ga0097620_100000324 | Ga0097620_10000032428 | 350 |
| 93 | 3300009092 | Ga0105250_10007638 | Ga0105250_100076381 | 350 |
| 94 | 3300009177 | Ga0105248_10000123 | Ga0105248_1000012351 | 350 |
| 95 | 3300014325 | Ga0163163_10000265 | Ga0163163_100002659 | 350 |
| 96 | 3300014968 | Ga0157379_10002236 | Ga0157379_100022368 | 350 |
| 97 | 3300025923 | Ga0207681_10061706 | Ga0207681_100617063 | 350 |
| 98 | 3300025931 | Ga0207644_10048417 | Ga0207644_100484172 | 350 |
| 99 | 3300025941 | Ga0207711_10000100 | Ga0207711_1000010053 | 350 |
| 100 | 3300025961 | Ga0207712_10032226 | Ga0207712_100322262 | 350 |
| 101 | 3300025986 | Ga0207658_10001697 | Ga0207658_100016977 | 350 |
| 102 | 3300026067 | Ga0207678_10139030 | Ga0207678_101390302 | 350 |
| 103 | 3300026088 | Ga0207641_10000221 | Ga0207641_1000022152 | 350 |
| 104 | 3300026095 | Ga0207676_10000378 | Ga0207676_1000037828 | 350 |
| 105 | 3300028380 | Ga0268265_10146134 | Ga0268265_101461342 | 350 |
| 106 | 3300028381 | Ga0268264_10169695 | Ga0268264_101696951 | 350 |
| 107 | 3300037471 | Ga0395905_0010733 | Ga0395905_0010733_2022_3242 | 350 |
| 108 | 3300044684 | Ga0466966_0000004 | Ga0466966_0000004_18932_20143 | 350 |
| 109 | 3300046616 | Ga0495668_0003737 | Ga0495668_0003737_7157_8359 | 350 |
| 110 | 3300046684 | Ga0495669_0022569 | Ga0495669_0022569_116_1318 | 350 |
| 111 | 3300053134 | Ga0500658_0000173 | Ga0500658_0000173_22945_24147 | 350 |
| 112 | 3300013100 | Ga0157373_10120344 | Ga0157373_101203442 | 352 |
| 113 | 3300013296 | Ga0157374_10002301 | Ga0157374_100023019 | 352 |
| 114 | 3300042005 | Ga0439448_0006381 | Ga0439448_0006381_549_1748 | 352 |
| 115 | 3300042157 | Ga0439458_0000012 | Ga0439458_0000012_14606_15805 | 352 |
| 116 | 3300013102 | Ga0157371_10051837 | Ga0157371_100518372 | 353 |
| 117 | 3300013105 | Ga0157369_10129433 | Ga0157369_101294333 | 353 |
| 118 | 3300037471 | Ga0395905_0000974 | Ga0395905_0000974_10631_11827 | 353 |
| 119 | 3300038443 | Ga0395901_0047091 | Ga0395901_0047091_2000_3196 | 353 |
| 120 | 3300005327 | Ga0070658_10164989 | Ga0070658_101649892 | 354 |
| 121 | 3300005336 | Ga0070680_100171983 | Ga0070680_1001719832 | 354 |
| 122 | 3300005435 | Ga0070714_100005008 | Ga0070714_1000050085 | 354 |
| 123 | 3300005458 | Ga0070681_10222435 | Ga0070681_102224351 | 354 |
| 124 | 3300005530 | Ga0070679_100068865 | Ga0070679_1000688653 | 354 |
| 125 | 3300013104 | Ga0157370_10030536 | Ga0157370_100305363 | 354 |
| 126 | 3300025917 | Ga0207660_10164543 | Ga0207660_101645432 | 354 |
| 127 | 3300025919 | Ga0207657_10007978 | Ga0207657_100079782 | 354 |
| 128 | 3300025928 | Ga0207700_10139607 | Ga0207700_101396072 | 354 |
| 129 | 3300026041 | Ga0207639_10120212 | Ga0207639_101202122 | 354 |
| 130 | 3300001979 | JGI24740J21852_10009623 | JGI24740J21852_100096234 | 355 |
| 131 | 3300005366 | Ga0070659_100054480 | Ga0070659_1000544803 | 355 |
| 132 | 3300005578 | Ga0068854_100037465 | Ga0068854_1000374652 | 355 |
| 133 | 3300005616 | Ga0068852_100028132 | Ga0068852_1000281322 | 355 |
| 134 | 3300025919 | Ga0207657_10007311 | Ga0207657_100073119 | 355 |
| 135 | 3300025920 | Ga0207649_10000176 | Ga0207649_1000017620 | 355 |
| 136 | 3300025932 | Ga0207690_10032936 | Ga0207690_100329363 | 355 |
| 137 | 3300025949 | Ga0207667_10016701 | Ga0207667_100167014 | 355 |
| 138 | 3300025981 | Ga0207640_10028717 | Ga0207640_100287173 | 355 |
| 139 | 3300026067 | Ga0207678_10024551 | Ga0207678_100245512 | 355 |
| 140 | 3300026116 | Ga0207674_10242524 | Ga0207674_102425242 | 355 |
| 141 | 3300026142 | Ga0207698_10029432 | Ga0207698_100294322 | 355 |
| 142 | 3300037418 | Ga0395900_0056442 | Ga0395900_0056442_2660_3859 | 355 |
| 143 | 3300037466 | Ga0395898_0162927 | Ga0395898_0162927_833_2032 | 355 |
| 144 | 3300037471 | Ga0395905_0045226 | Ga0395905_0045226_1938_3137 | 355 |
| 145 | 3300038443 | Ga0395901_0357956 | Ga0395901_0357956_246_1439 | 355 |
| 146 | 3300035170 | Ga0373943_0016072 | Ga0373943_0016072_807_2006 | 357 |
| 147 | 3300035692 | Ga0373935_0010669 | Ga0373935_0010669_2479_3678 | 357 |
| 148 | 3300037068 | Ga0373925_0007643 | Ga0373925_0007643_2410_3609 | 357 |
| 149 | 3300037471 | Ga0395905_0004757 | Ga0395905_0004757_8295_9494 | 357 |
| 150 | 3300037471 | Ga0395905_0273795 | Ga0395905_0273795_160_1359 | 357 |
| 151 | 3300031911 | Ga0307412_10214928 | Ga0307412_102149282 | 358 |
| 152 | 3300031901 | Ga0307406_10168284 | Ga0307406_101682842 | 359 |
| 153 | 3300031911 | Ga0307412_10162064 | Ga0307412_101620642 | 359 |
| 154 | 3300001990 | JGI24737J22298_10017367 | JGI24737J22298_100173672 | 360 |
| 155 | 3300005329 | Ga0070683_100121116 | Ga0070683_1001211161 | 360 |
| 156 | 3300005344 | Ga0070661_100010124 | Ga0070661_1000101242 | 360 |
| 157 | 3300005455 | Ga0070663_100001867 | Ga0070663_1000018676 | 360 |
| 158 | 3300005563 | Ga0068855_100046324 | Ga0068855_1000463244 | 360 |
| 159 | 3300005614 | Ga0068856_100005795 | Ga0068856_10000579510 | 360 |
| 160 | 3300005616 | Ga0068852_100000751 | Ga0068852_1000007518 | 360 |
| 161 | 3300009093 | Ga0105240_10056373 | Ga0105240_100563732 | 360 |
| 162 | 3300010375 | Ga0105239_10368052 | Ga0105239_103680522 | 360 |
| 163 | 3300013102 | Ga0157371_10002546 | Ga0157371_1000254612 | 360 |
| 164 | 3300013105 | Ga0157369_10000823 | Ga0157369_1000082314 | 360 |
| 165 | 3300013105 | Ga0157369_10005643 | Ga0157369_1000564312 | 360 |
| 166 | 3300013105 | Ga0157369_10123636 | Ga0157369_101236362 | 360 |
| 167 | 3300013307 | Ga0157372_10088593 | Ga0157372_100885933 | 360 |
| 168 | 3300025909 | Ga0207705_10000753 | Ga0207705_1000075325 | 360 |
| 169 | 3300025913 | Ga0207695_10006302 | Ga0207695_1000630215 | 360 |
| 170 | 3300025949 | Ga0207667_10013772 | Ga0207667_100137727 | 360 |
| 171 | 3300025986 | Ga0207658_10067648 | Ga0207658_100676483 | 360 |
| 172 | 3300026067 | Ga0207678_10002551 | Ga0207678_100025515 | 360 |
| 173 | 3300026078 | Ga0207702_10008268 | Ga0207702_100082685 | 360 |
| 174 | 3300026142 | Ga0207698_10004848 | Ga0207698_100048488 | 360 |
| 175 | 3300037418 | Ga0395900_0292617 | Ga0395900_0292617_115_1302 | 360 |
| 176 | 3300037466 | Ga0395898_0003841 | Ga0395898_0003841_7186_8379 | 360 |
| 177 | 3300005577 | Ga0068857_100131875 | Ga0068857_1001318752 | 361 |
| 178 | 3300005841 | Ga0068863_100033904 | Ga0068863_1000339045 | 361 |
| 179 | 3300013102 | Ga0157371_10069825 | Ga0157371_100698252 | 361 |
| 180 | 3300026088 | Ga0207641_10027083 | Ga0207641_100270835 | 361 |
| 181 | 3300026116 | Ga0207674_10140812 | Ga0207674_101408122 | 361 |
| 182 | 3300032004 | Ga0307414_10012920 | Ga0307414_100129202 | 361 |
| 183 | 3300037312 | Ga0395899_0035798 | Ga0395899_0035798_729_1922 | 363 |
| 184 | 3300037418 | Ga0395900_0053831 | Ga0395900_0053831_617_1810 | 363 |
| 185 | 3300037466 | Ga0395898_0107741 | Ga0395898_0107741_762_1955 | 363 |
| 186 | 3300037471 | Ga0395905_0043405 | Ga0395905_0043405_2147_3340 | 363 |
| 187 | 3300038443 | Ga0395901_0216471 | Ga0395901_0216471_218_1594 | 363 |
| 188 | 3300013102 | Ga0157371_10029261 | Ga0157371_100292612 | 364 |
| 189 | 3300031995 | Ga0307409_100062846 | Ga0307409_1000628463 | 364 |
| 190 | 3300032002 | Ga0307416_100013849 | Ga0307416_1000138494 | 364 |
| 191 | 3300037312 | Ga0395899_0033513 | Ga0395899_0033513_1197_2393 | 364 |
| 192 | 3300037418 | Ga0395900_0086497 | Ga0395900_0086497_944_2140 | 364 |
| 193 | 3300037466 | Ga0395898_0120325 | Ga0395898_0120325_773_1969 | 364 |
| 194 | 3300038443 | Ga0395901_0049121 | Ga0395901_0049121_2477_3673 | 364 |
| 195 | 3300005331 | Ga0070670_100178904 | Ga0070670_1001789042 | 365 |
| 196 | 3300005356 | Ga0070674_100008524 | Ga0070674_1000085246 | 365 |
| 197 | 3300005367 | Ga0070667_100179800 | Ga0070667_1001798002 | 365 |
| 198 | 3300005435 | Ga0070714_100224850 | Ga0070714_1002248501 | 365 |
| 199 | 3300005459 | Ga0068867_100012558 | Ga0068867_1000125583 | 365 |
| 200 | 3300005530 | Ga0070679_100234866 | Ga0070679_1002348662 | 365 |
| 201 | 3300005543 | Ga0070672_100185058 | Ga0070672_1001850582 | 365 |
| 202 | 3300005548 | Ga0070665_100004457 | Ga0070665_1000044574 | 365 |
| 203 | 3300005614 | Ga0068856_100289862 | Ga0068856_1002898622 | 365 |
| 204 | 3300005614 | Ga0068856_100388227 | Ga0068856_1003882272 | 365 |
| 205 | 3300005616 | Ga0068852_100001393 | Ga0068852_1000013936 | 365 |
| 206 | 3300005843 | Ga0068860_100197562 | Ga0068860_1001975622 | 365 |
| 207 | 3300005844 | Ga0068862_100003906 | Ga0068862_1000039066 | 365 |
| 208 | 3300009177 | Ga0105248_10023758 | Ga0105248_100237583 | 365 |
| 209 | 3300013308 | Ga0157375_10020866 | Ga0157375_100208662 | 365 |
| 210 | 3300025907 | Ga0207645_10000418 | Ga0207645_1000041820 | 365 |
| 211 | 3300025908 | Ga0207643_10058941 | Ga0207643_100589412 | 365 |
| 212 | 3300025909 | Ga0207705_10039780 | Ga0207705_100397803 | 365 |
| 213 | 3300025923 | Ga0207681_10014078 | Ga0207681_100140784 | 365 |
| 214 | 3300025923 | Ga0207681_10146943 | Ga0207681_101469432 | 365 |
| 215 | 3300025937 | Ga0207669_10005747 | Ga0207669_100057472 | 365 |
| 216 | 3300025938 | Ga0207704_10126843 | Ga0207704_101268432 | 365 |
| 217 | 3300025940 | Ga0207691_10203373 | Ga0207691_102033732 | 365 |
| 218 | 3300025941 | Ga0207711_10009429 | Ga0207711_100094294 | 365 |
| 219 | 3300025949 | Ga0207667_10219469 | Ga0207667_102194691 | 365 |
| 220 | 3300025960 | Ga0207651_10032476 | Ga0207651_100324763 | 365 |
| 221 | 3300025972 | Ga0207668_10000080 | Ga0207668_1000008058 | 365 |
| 222 | 3300025981 | Ga0207640_10274150 | Ga0207640_102741502 | 365 |
| 223 | 3300025986 | Ga0207658_10147835 | Ga0207658_101478352 | 365 |
| 224 | 3300026067 | Ga0207678_10230744 | Ga0207678_102307442 | 365 |
| 225 | 3300026088 | Ga0207641_10075248 | Ga0207641_100752483 | 365 |
| 226 | 3300026089 | Ga0207648_10019358 | Ga0207648_100193585 | 365 |
| 227 | 3300026142 | Ga0207698_10000125 | Ga0207698_1000012520 | 365 |
| 228 | 3300028379 | Ga0268266_10006457 | Ga0268266_100064579 | 365 |
| 229 | 3300028380 | Ga0268265_10001441 | Ga0268265_1000144111 | 365 |
| 230 | 3300028380 | Ga0268265_10322166 | Ga0268265_103221661 | 365 |
| 231 | 3300032004 | Ga0307414_10121035 | Ga0307414_101210352 | 365 |
| 232 | 3300037471 | Ga0395905_0008521 | Ga0395905_0008521_3310_4506 | 365 |
| 233 | 3300001979 | JGI24740J21852_10005120 | JGI24740J21852_100051205 | 366 |
| 234 | 3300001989 | JGI24739J22299_10000659 | JGI24739J22299_1000065910 | 366 |
| 235 | 3300001990 | JGI24737J22298_10000051 | JGI24737J22298_100000514 | 366 |
| 236 | 3300002075 | JGI24738J21930_10000189 | JGI24738J21930_1000018912 | 366 |
| 237 | 3300005328 | Ga0070676_10000346 | Ga0070676_100003463 | 366 |
| 238 | 3300005330 | Ga0070690_100057468 | Ga0070690_1000574683 | 366 |
| 239 | 3300005331 | Ga0070670_100006004 | Ga0070670_10000600410 | 366 |
| 240 | 3300005334 | Ga0068869_100000742 | Ga0068869_10000074216 | 366 |
| 241 | 3300005335 | Ga0070666_10032484 | Ga0070666_100324842 | 366 |
| 242 | 3300005338 | Ga0068868_100011860 | Ga0068868_1000118603 | 366 |
| 243 | 3300005339 | Ga0070660_100000843 | Ga0070660_1000008435 | 366 |
| 244 | 3300005344 | Ga0070661_100026575 | Ga0070661_1000265752 | 366 |
| 245 | 3300005344 | Ga0070661_100058399 | Ga0070661_1000583992 | 366 |
| 246 | 3300005347 | Ga0070668_100007338 | Ga0070668_1000073386 | 366 |
| 247 | 3300005347 | Ga0070668_100026063 | Ga0070668_1000260633 | 366 |
| 248 | 3300005353 | Ga0070669_100000752 | Ga0070669_10000075212 | 366 |
| 249 | 3300005354 | Ga0070675_100074669 | Ga0070675_1000746692 | 366 |
| 250 | 3300005355 | Ga0070671_100007775 | Ga0070671_1000077753 | 366 |
| 251 | 3300005356 | Ga0070674_100009790 | Ga0070674_1000097902 | 366 |
| 252 | 3300005364 | Ga0070673_100000145 | Ga0070673_10000014521 | 366 |
| 253 | 3300005366 | Ga0070659_100000982 | Ga0070659_10000098215 | 366 |
| 254 | 3300005366 | Ga0070659_100098140 | Ga0070659_1000981401 | 366 |
| 255 | 3300005367 | Ga0070667_100041589 | Ga0070667_1000415893 | 366 |
| 256 | 3300005455 | Ga0070663_100035586 | Ga0070663_1000355862 | 366 |
| 257 | 3300005455 | Ga0070663_100054430 | Ga0070663_1000544303 | 366 |
| 258 | 3300005457 | Ga0070662_100000586 | Ga0070662_1000005869 | 366 |
| 259 | 3300005459 | Ga0068867_100001195 | Ga0068867_1000011954 | 366 |
| 260 | 3300005539 | Ga0068853_100000470 | Ga0068853_10000047014 | 366 |
| 261 | 3300005539 | Ga0068853_100009706 | Ga0068853_1000097063 | 366 |
| 262 | 3300005539 | Ga0068853_100091244 | Ga0068853_1000912442 | 366 |
| 263 | 3300005543 | Ga0070672_100002839 | Ga0070672_1000028392 | 366 |
| 264 | 3300005548 | Ga0070665_100006112 | Ga0070665_1000061126 | 366 |
| 265 | 3300005548 | Ga0070665_100134592 | Ga0070665_1001345923 | 366 |
| 266 | 3300005563 | Ga0068855_100005215 | Ga0068855_1000052152 | 366 |
| 267 | 3300005564 | Ga0070664_100027011 | Ga0070664_1000270115 | 366 |
| 268 | 3300005564 | Ga0070664_100076899 | Ga0070664_1000768992 | 366 |
| 269 | 3300005577 | Ga0068857_100001148 | Ga0068857_10000114820 | 366 |
| 270 | 3300005578 | Ga0068854_100000061 | Ga0068854_1000000615 | 366 |
| 271 | 3300005578 | Ga0068854_100172745 | Ga0068854_1001727452 | 366 |
| 272 | 3300005614 | Ga0068856_100262673 | Ga0068856_1002626732 | 366 |
| 273 | 3300005616 | Ga0068852_100000288 | Ga0068852_10000028821 | 366 |
| 274 | 3300005616 | Ga0068852_100006051 | Ga0068852_1000060513 | 366 |
| 275 | 3300005616 | Ga0068852_100167056 | Ga0068852_1001670562 | 366 |
| 276 | 3300005617 | Ga0068859_100000778 | Ga0068859_10000077811 | 366 |
| 277 | 3300005618 | Ga0068864_100000795 | Ga0068864_10000079520 | 366 |
| 278 | 3300005718 | Ga0068866_10006297 | Ga0068866_100062972 | 366 |
| 279 | 3300005719 | Ga0068861_100052822 | Ga0068861_1000528222 | 366 |
| 280 | 3300005834 | Ga0068851_10002886 | Ga0068851_100028866 | 366 |
| 281 | 3300005834 | Ga0068851_10014434 | Ga0068851_100144342 | 366 |
| 282 | 3300005841 | Ga0068863_100001605 | Ga0068863_10000160517 | 366 |
| 283 | 3300005842 | Ga0068858_100002203 | Ga0068858_10000220317 | 366 |
| 284 | 3300005843 | Ga0068860_100001686 | Ga0068860_10000168622 | 366 |
| 285 | 3300005844 | Ga0068862_100042404 | Ga0068862_1000424043 | 366 |
| 286 | 3300006358 | Ga0068871_100177892 | Ga0068871_1001778922 | 366 |
| 287 | 3300006881 | Ga0068865_100007421 | Ga0068865_1000074215 | 366 |
| 288 | 3300006931 | Ga0097620_100000778 | Ga0097620_10000077825 | 366 |
| 289 | 3300009098 | Ga0105245_10000326 | Ga0105245_1000032639 | 366 |
| 290 | 3300009148 | Ga0105243_10073739 | Ga0105243_100737393 | 366 |
| 291 | 3300009174 | Ga0105241_10172323 | Ga0105241_101723232 | 366 |
| 292 | 3300009177 | Ga0105248_10000159 | Ga0105248_1000015939 | 366 |
| 293 | 3300009545 | Ga0105237_10255511 | Ga0105237_102555112 | 366 |
| 294 | 3300010375 | Ga0105239_10020658 | Ga0105239_100206584 | 366 |
| 295 | 3300011119 | Ga0105246_10019698 | Ga0105246_100196983 | 366 |
| 296 | 3300013100 | Ga0157373_10002590 | Ga0157373_100025906 | 366 |
| 297 | 3300013102 | Ga0157371_10001589 | Ga0157371_100015899 | 366 |
| 298 | 3300013297 | Ga0157378_10002474 | Ga0157378_1000247418 | 366 |
| 299 | 3300013306 | Ga0163162_10014860 | Ga0163162_100148603 | 366 |
| 300 | 3300013308 | Ga0157375_10030674 | Ga0157375_100306745 | 366 |
| 301 | 3300025315 | Ga0207697_10000664 | Ga0207697_1000066416 | 366 |
| 302 | 3300025321 | Ga0207656_10002512 | Ga0207656_100025122 | 366 |
| 303 | 3300025321 | Ga0207656_10002673 | Ga0207656_100026736 | 366 |
| 304 | 3300025901 | Ga0207688_10000730 | Ga0207688_100007304 | 366 |
| 305 | 3300025903 | Ga0207680_10013220 | Ga0207680_100132202 | 366 |
| 306 | 3300025904 | Ga0207647_10002581 | Ga0207647_100025815 | 366 |
| 307 | 3300025907 | Ga0207645_10015378 | Ga0207645_100153784 | 366 |
| 308 | 3300025909 | Ga0207705_10028245 | Ga0207705_100282453 | 366 |
| 309 | 3300025911 | Ga0207654_10133836 | Ga0207654_101338361 | 366 |
| 310 | 3300025919 | Ga0207657_10002400 | Ga0207657_1000240016 | 366 |
| 311 | 3300025923 | Ga0207681_10001054 | Ga0207681_100010546 | 366 |
| 312 | 3300025924 | Ga0207694_10062350 | Ga0207694_100623503 | 366 |
| 313 | 3300025925 | Ga0207650_10014311 | Ga0207650_100143114 | 366 |
| 314 | 3300025926 | Ga0207659_10064364 | Ga0207659_100643643 | 366 |
| 315 | 3300025927 | Ga0207687_10003615 | Ga0207687_1000361510 | 366 |
| 316 | 3300025931 | Ga0207644_10005155 | Ga0207644_100051557 | 366 |
| 317 | 3300025932 | Ga0207690_10006190 | Ga0207690_100061905 | 366 |
| 318 | 3300025933 | Ga0207706_10000171 | Ga0207706_1000017142 | 366 |
| 319 | 3300025935 | Ga0207709_10047802 | Ga0207709_100478022 | 366 |
| 320 | 3300025938 | Ga0207704_10008679 | Ga0207704_100086792 | 366 |
| 321 | 3300025940 | Ga0207691_10001864 | Ga0207691_100018642 | 366 |
| 322 | 3300025941 | Ga0207711_10009134 | Ga0207711_100091342 | 366 |
| 323 | 3300025942 | Ga0207689_10000092 | Ga0207689_1000009220 | 366 |
| 324 | 3300025945 | Ga0207679_10103116 | Ga0207679_101031161 | 366 |
| 325 | 3300025945 | Ga0207679_10104134 | Ga0207679_101041342 | 366 |
| 326 | 3300025949 | Ga0207667_10135934 | Ga0207667_101359342 | 366 |
| 327 | 3300025960 | Ga0207651_10000521 | Ga0207651_100005215 | 366 |
| 328 | 3300025972 | Ga0207668_10010968 | Ga0207668_100109683 | 366 |
| 329 | 3300025972 | Ga0207668_10045583 | Ga0207668_100455832 | 366 |
| 330 | 3300026023 | Ga0207677_10047130 | Ga0207677_100471302 | 366 |
| 331 | 3300026035 | Ga0207703_10002403 | Ga0207703_100024032 | 366 |
| 332 | 3300026041 | Ga0207639_10002585 | Ga0207639_1000258512 | 366 |
| 333 | 3300026041 | Ga0207639_10050451 | Ga0207639_100504513 | 366 |
| 334 | 3300026067 | Ga0207678_10001415 | Ga0207678_100014153 | 366 |
| 335 | 3300026067 | Ga0207678_10074590 | Ga0207678_100745902 | 366 |
| 336 | 3300026088 | Ga0207641_10002549 | Ga0207641_1000254912 | 366 |
| 337 | 3300026089 | Ga0207648_10000317 | Ga0207648_1000031715 | 366 |
| 338 | 3300026089 | Ga0207648_10005328 | Ga0207648_1000532813 | 366 |
| 339 | 3300026095 | Ga0207676_10001355 | Ga0207676_1000135520 | 366 |
| 340 | 3300026116 | Ga0207674_10033675 | Ga0207674_100336753 | 366 |
| 341 | 3300026118 | Ga0207675_100092591 | Ga0207675_1000925913 | 366 |
| 342 | 3300026142 | Ga0207698_10009150 | Ga0207698_100091503 | 366 |
| 343 | 3300026142 | Ga0207698_10057657 | Ga0207698_100576573 | 366 |
| 344 | 3300028379 | Ga0268266_10000433 | Ga0268266_1000043352 | 366 |
| 345 | 3300028380 | Ga0268265_10021625 | Ga0268265_100216253 | 366 |
| 346 | 3300028380 | Ga0268265_10073863 | Ga0268265_100738632 | 366 |
| 347 | 3300035111 | Ga0373923_0034859 | Ga0373923_0034859_222_1421 | 366 |
| 348 | 3300035724 | Ga0373933_0083037 | Ga0373933_0083037_338_1537 | 366 |
| 349 | 3300036401 | Ga0373937_0244628 | Ga0373937_0244628_129_1328 | 366 |
| 350 | 3300037471 | Ga0395905_0193672 | Ga0395905_0193672_670_1863 | 366 |
| 351 | 3300041405 | Ga0439438_022957 | Ga0439438_022957_10_1206 | 366 |
| 352 | 3300042144 | Ga0450889_000005 | Ga0450889_000005_2479_3675 | 366 |
| 353 | 3300042439 | Ga0439464_0003424 | Ga0439464_0003424_367_1557 | 366 |
| 354 | 3300046684 | Ga0495669_0018051 | Ga0495669_0018051_119_1318 | 366 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar