F419835

General Info

Members Datasets Scaffolds Average Seq Length
354 157 354 376

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0216471|Ga0395901_0216471_218_1594
Length 426
Sequence MSNLLRGAFVIGRRDFSATVLSKTFLFFLLGPLFPLLFGVVFGGIGASVANSREKPAVAVVASEEDYVPIDAARNRLAAAIDEDHVVRLVRVDPEPNADAQRVHLLASHDPPVQAVLMGLPDHPQLTGPVRNDGTVAGQLRWILAGVDSKTQAEPPLAVAHTETSSASTSRDQALTGQAAQTVPIESLFIGKLFAMLAASILGIVVWTSAGAAIVASLKAGGLASLPAPAVGWPTFLALTAIYFAMNYLLFGAVXXTIGAQAATVREVQTLSMPVTFGQVLIFGFAATAVTAPSSKLALAAGVFPLSSPLTMVARAAQQPGLGQHALALGWQILWVAIILKIGASLFRKTVLKSGPRTRWRAARACPVSHSCIAMNGKGPWLTRAIPACAQSARLGPFGSHIALTGIGSALQIRSTLLRSVRPGMK

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
130 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
131 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
132 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
142 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
143 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
144 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
145 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
146 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
147 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
148 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
149 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
150 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
151 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
152 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
153 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
154 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
155 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
156 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
157 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 0
Rhizosphere 99.44
Stem 0
Stem Tuber 0
Unclassified 0.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10005120 3300001979 Bacteria 5566
2 JGI24740J21852_10009623 3300001979 Bacteria 3773
3 JGI24739J22299_10000659 3300001989 Bacteria 12414
4 JGI24737J22298_10000051 3300001990 Bacteria 34099
5 JGI24737J22298_10017367 3300001990 Bacteria 2319
6 JGI24738J21930_10000189 3300002075 Bacteria 16094
7 rootH1_10286338 3300003323 Bacteria 1604
8 Ga0070658_10092199 3300005327 Bacteria 2498
9 Ga0070658_10164989 3300005327 Bacteria 1859
10 Ga0070676_10000346 3300005328 Bacteria 21215
11 Ga0070683_100055232 3300005329 Bacteria 3685
12 Ga0070683_100121116 3300005329 Bacteria 2472
13 Ga0070690_100057468 3300005330 Bacteria 2497
14 Ga0070670_100006004 3300005331 Bacteria 10267
15 Ga0070670_100178904 3300005331 Bacteria 1841
16 Ga0068869_100000742 3300005334 Bacteria 18554
17 Ga0070666_10016172 3300005335 Bacteria 4769
18 Ga0070666_10032484 3300005335 Bacteria 3448
19 Ga0070680_100171983 3300005336 Bacteria 1823
20 Ga0068868_100011860 3300005338 Bacteria 6355
21 Ga0070660_100000843 3300005339 Bacteria 20403
22 Ga0070661_100010124 3300005344 Bacteria 6548
23 Ga0070661_100026575 3300005344 Bacteria 4163
24 Ga0070661_100058399 3300005344 Bacteria 2827
25 Ga0070668_100007338 3300005347 Bacteria 8176
26 Ga0070668_100019739 3300005347 Bacteria 5075
27 Ga0070668_100026063 3300005347 Bacteria 4433
28 Ga0070669_100000752 3300005353 Bacteria 23599
29 Ga0070669_100034044 3300005353 Bacteria 3688
30 Ga0070675_100074669 3300005354 Bacteria 2817
31 Ga0070671_100007775 3300005355 Bacteria 8564
32 Ga0070671_100070247 3300005355 Bacteria 2921
33 Ga0070674_100008524 3300005356 Bacteria 6111
34 Ga0070674_100009790 3300005356 Bacteria 5763
35 Ga0070673_100000145 3300005364 Bacteria 33646
36 Ga0070659_100000982 3300005366 Bacteria 20978
37 Ga0070659_100019123 3300005366 Bacteria 5182
38 Ga0070659_100028009 3300005366 Bacteria 4346
39 Ga0070659_100054480 3300005366 Bacteria 3150
40 Ga0070659_100098140 3300005366 Bacteria 2355
41 Ga0070667_100000787 3300005367 Bacteria 29756
42 Ga0070667_100007477 3300005367 Bacteria 9066
43 Ga0070667_100024755 3300005367 Bacteria 4987
44 Ga0070667_100041589 3300005367 Bacteria 3856
45 Ga0070667_100068114 3300005367 Bacteria 3028
46 Ga0070667_100158642 3300005367 Bacteria 1991
47 Ga0070667_100179800 3300005367 Bacteria 1870
48 Ga0070714_100005008 3300005435 Bacteria 10072
49 Ga0070714_100224850 3300005435 Bacteria 1727
50 Ga0070713_100150088 3300005436 Unclassified 2072
51 Ga0070663_100001867 3300005455 Bacteria 11752
52 Ga0070663_100035586 3300005455 Bacteria 3455
53 Ga0070663_100054430 3300005455 Bacteria 2860
54 Ga0070663_100064118 3300005455 Bacteria 2655
55 Ga0070663_100102310 3300005455 Bacteria 2140
56 Ga0070662_100000586 3300005457 Bacteria 22135
57 Ga0070681_10222435 3300005458 Bacteria 1803
58 Ga0068867_100001195 3300005459 Bacteria 17808
59 Ga0068867_100012558 3300005459 Bacteria 5989
60 Ga0070679_100068865 3300005530 Bacteria 3530
61 Ga0070679_100234866 3300005530 Bacteria 1793
62 Ga0070684_100280291 3300005535 Bacteria 1527
63 Ga0068853_100000470 3300005539 Bacteria 27505
64 Ga0068853_100009706 3300005539 Bacteria 7762
65 Ga0068853_100091244 3300005539 Bacteria 2679
66 Ga0070672_100002839 3300005543 Bacteria 11106
67 Ga0070672_100170099 3300005543 Bacteria 1812
68 Ga0070672_100185058 3300005543 Bacteria 1737
69 Ga0070665_100004457 3300005548 Bacteria 14713
70 Ga0070665_100006112 3300005548 Bacteria 12313
71 Ga0070665_100069672 3300005548 Bacteria 3525
72 Ga0070665_100134592 3300005548 Bacteria 2473
73 Ga0068855_100005215 3300005563 Bacteria 15851
74 Ga0068855_100046324 3300005563 Bacteria 5141
75 Ga0070664_100027011 3300005564 Bacteria 4768
76 Ga0070664_100076899 3300005564 Bacteria 2869
77 Ga0068857_100001148 3300005577 Bacteria 20637
78 Ga0068857_100131875 3300005577 Bacteria 2254
79 Ga0068854_100000061 3300005578 Bacteria 78663
80 Ga0068854_100004256 3300005578 Bacteria 9013
81 Ga0068854_100014552 3300005578 Bacteria 5190
82 Ga0068854_100037465 3300005578 Bacteria 3404
83 Ga0068854_100172745 3300005578 Bacteria 1683
84 Ga0068856_100005795 3300005614 Bacteria 12175
85 Ga0068856_100130219 3300005614 Bacteria 2520
86 Ga0068856_100262673 3300005614 Bacteria 1742
87 Ga0068856_100289862 3300005614 Bacteria 1654
88 Ga0068856_100388227 3300005614 Bacteria 1416
89 Ga0068852_100000288 3300005616 Bacteria 33771
90 Ga0068852_100000751 3300005616 Bacteria 21304
91 Ga0068852_100001393 3300005616 Bacteria 16266
92 Ga0068852_100006051 3300005616 Bacteria 8715
93 Ga0068852_100028132 3300005616 Bacteria 4595
94 Ga0068852_100167056 3300005616 Bacteria 2059
95 Ga0068859_100000324 3300005617 Bacteria 47483
96 Ga0068859_100000778 3300005617 Bacteria 32222
97 Ga0068864_100000291 3300005618 Bacteria 44522
98 Ga0068864_100000795 3300005618 Bacteria 26479
99 Ga0068866_10006297 3300005718 Bacteria 4942
100 Ga0068861_100052822 3300005719 Bacteria 3090
101 Ga0068851_10002886 3300005834 Bacteria 7593
102 Ga0068851_10014434 3300005834 Bacteria 3750
103 Ga0068863_100001605 3300005841 Bacteria 22350
104 Ga0068863_100002255 3300005841 Bacteria 19144
105 Ga0068863_100033904 3300005841 Bacteria 4864
106 Ga0068858_100002203 3300005842 Bacteria 19730
107 Ga0068858_100005886 3300005842 Bacteria 11970
108 Ga0068860_100001686 3300005843 Bacteria 23599
109 Ga0068860_100001774 3300005843 Bacteria 22958
110 Ga0068860_100060088 3300005843 Bacteria 3613
111 Ga0068860_100197562 3300005843 Bacteria 1948
112 Ga0068862_100003906 3300005844 Bacteria 12668
113 Ga0068862_100008684 3300005844 Bacteria 8406
114 Ga0068862_100042404 3300005844 Bacteria 3876
115 Ga0081539_10040870 3300005985 Bacteria 2718
116 Ga0070717_10030093 3300006028 Bacteria 4361
117 Ga0068871_100177892 3300006358 Bacteria 1827
118 Ga0068865_100007421 3300006881 Bacteria 6747
119 Ga0097620_100000324 3300006931 Bacteria 47483
120 Ga0097620_100000778 3300006931 Bacteria 32222
121 Ga0105250_10007638 3300009092 Bacteria 4635
122 Ga0105240_10056373 3300009093 Bacteria 4918
123 Ga0105245_10000326 3300009098 Bacteria 44899
124 Ga0105243_10073739 3300009148 Bacteria 2766
125 Ga0105241_10172323 3300009174 Bacteria 1788
126 Ga0105248_10000123 3300009177 Bacteria 89301
127 Ga0105248_10000159 3300009177 Bacteria 78504
128 Ga0105248_10009193 3300009177 Bacteria 10873
129 Ga0105248_10023758 3300009177 Bacteria 6812
130 Ga0105237_10255511 3300009545 Bacteria 1754
131 Ga0105237_10426039 3300009545 Bacteria 1332
132 Ga0105239_10020658 3300010375 Bacteria 7265
133 Ga0105239_10368052 3300010375 Bacteria 1624
134 Ga0105246_10019698 3300011119 Bacteria 4317
135 Ga0157373_10002590 3300013100 Bacteria 13733
136 Ga0157373_10120344 3300013100 Bacteria 1845
137 Ga0157371_10001589 3300013102 Bacteria 23310
138 Ga0157371_10002546 3300013102 Bacteria 17309
139 Ga0157371_10029261 3300013102 Bacteria 3986
140 Ga0157371_10051837 3300013102 Bacteria 2915
141 Ga0157371_10056490 3300013102 Bacteria 2785
142 Ga0157371_10069825 3300013102 Bacteria 2487
143 Ga0157370_10030536 3300013104 Bacteria 5279
144 Ga0157370_10330180 3300013104 Bacteria 1406
145 Ga0157369_10000823 3300013105 Bacteria 39591
146 Ga0157369_10005643 3300013105 Bacteria 14541
147 Ga0157369_10123636 3300013105 Bacteria 2744
148 Ga0157369_10129433 3300013105 Bacteria 2675
149 Ga0157374_10002301 3300013296 Bacteria 16089
150 Ga0157378_10002474 3300013297 Bacteria 16436
151 Ga0163162_10014860 3300013306 Bacteria 7603
152 Ga0157372_10088593 3300013307 Bacteria 3514
153 Ga0157372_10180276 3300013307 Bacteria 2445
154 Ga0157375_10020866 3300013308 Bacteria 5996
155 Ga0157375_10030674 3300013308 Bacteria 5073
156 Ga0157375_10185031 3300013308 Bacteria 2236
157 Ga0163163_10000265 3300014325 Bacteria 52453
158 Ga0157379_10002236 3300014968 Bacteria 16110
159 Ga0207697_10000664 3300025315 Bacteria 19543
160 Ga0207656_10002512 3300025321 Bacteria 6192
161 Ga0207656_10002673 3300025321 Bacteria 6041
162 Ga0207688_10000730 3300025901 Bacteria 16298
163 Ga0207680_10013220 3300025903 Bacteria 4233
164 Ga0207647_10002581 3300025904 Bacteria 13711
165 Ga0207647_10042920 3300025904 Bacteria 2833
166 Ga0207647_10135203 3300025904 Bacteria 1447
167 Ga0207645_10000418 3300025907 Bacteria 35293
168 Ga0207645_10015378 3300025907 Bacteria 5086
169 Ga0207643_10058941 3300025908 Bacteria 2190
170 Ga0207705_10000753 3300025909 Bacteria 26696
171 Ga0207705_10000955 3300025909 Bacteria 23634
172 Ga0207705_10028245 3300025909 Bacteria 3999
173 Ga0207705_10039780 3300025909 Bacteria 3370
174 Ga0207654_10133836 3300025911 Bacteria 1572
175 Ga0207695_10001271 3300025913 Bacteria 42892
176 Ga0207695_10006302 3300025913 Bacteria 15443
177 Ga0207660_10164543 3300025917 Bacteria 1714
178 Ga0207657_10002400 3300025919 Bacteria 20254
179 Ga0207657_10004723 3300025919 Bacteria 14377
180 Ga0207657_10007311 3300025919 Bacteria 11327
181 Ga0207657_10007978 3300025919 Bacteria 10792
182 Ga0207649_10000176 3300025920 Bacteria 52479
183 Ga0207649_10015973 3300025920 Bacteria 4225
184 Ga0207681_10001054 3300025923 Bacteria 17872
185 Ga0207681_10014078 3300025923 Bacteria 4960
186 Ga0207681_10061706 3300025923 Bacteria 2578
187 Ga0207681_10146943 3300025923 Bacteria 1762
188 Ga0207694_10062350 3300025924 Bacteria 2903
189 Ga0207650_10014311 3300025925 Bacteria 5513
190 Ga0207659_10064364 3300025926 Bacteria 2653
191 Ga0207687_10003615 3300025927 Bacteria 10415
192 Ga0207700_10107863 3300025928 Unclassified 2235
193 Ga0207700_10139607 3300025928 Bacteria 1989
194 Ga0207644_10005155 3300025931 Bacteria 8535
195 Ga0207644_10048417 3300025931 Bacteria 3039
196 Ga0207690_10006190 3300025932 Bacteria 7088
197 Ga0207690_10031571 3300025932 Bacteria 3391
198 Ga0207690_10032936 3300025932 Bacteria 3329
199 Ga0207706_10000171 3300025933 Bacteria 72122
200 Ga0207706_10034047 3300025933 Bacteria 4533
201 Ga0207706_10108873 3300025933 Bacteria 2438
202 Ga0207709_10047802 3300025935 Bacteria 2603
203 Ga0207669_10005747 3300025937 Bacteria 5598
204 Ga0207704_10008679 3300025938 Bacteria 4873
205 Ga0207704_10126843 3300025938 Bacteria 1759
206 Ga0207691_10001864 3300025940 Bacteria 20610
207 Ga0207691_10203373 3300025940 Bacteria 1723
208 Ga0207711_10000100 3300025941 Bacteria 91024
209 Ga0207711_10009134 3300025941 Bacteria 8280
210 Ga0207711_10009429 3300025941 Bacteria 8147
211 Ga0207711_10015381 3300025941 Bacteria 6350
212 Ga0207689_10000092 3300025942 Bacteria 73254
213 Ga0207679_10103116 3300025945 Bacteria 2235
214 Ga0207679_10104134 3300025945 Bacteria 2226
215 Ga0207667_10013772 3300025949 Bacteria 9242
216 Ga0207667_10016701 3300025949 Bacteria 8283
217 Ga0207667_10135934 3300025949 Bacteria 2531
218 Ga0207667_10219469 3300025949 Bacteria 1948
219 Ga0207651_10000521 3300025960 Bacteria 16209
220 Ga0207651_10032476 3300025960 Bacteria 3353
221 Ga0207712_10032226 3300025961 Bacteria 3536
222 Ga0207668_10000080 3300025972 Bacteria 72198
223 Ga0207668_10010968 3300025972 Bacteria 5493
224 Ga0207668_10045583 3300025972 Bacteria 2991
225 Ga0207640_10000295 3300025981 Bacteria 33245
226 Ga0207640_10028717 3300025981 Bacteria 3405
227 Ga0207640_10274150 3300025981 Bacteria 1321
228 Ga0207658_10001697 3300025986 Bacteria 16729
229 Ga0207658_10067648 3300025986 Bacteria 2692
230 Ga0207658_10147835 3300025986 Bacteria 1910
231 Ga0207677_10047130 3300026023 Bacteria 2892
232 Ga0207703_10002403 3300026035 Bacteria 16272
233 Ga0207639_10002585 3300026041 Bacteria 12151
234 Ga0207639_10050451 3300026041 Bacteria 3160
235 Ga0207639_10065869 3300026041 Bacteria 2813
236 Ga0207639_10120212 3300026041 Bacteria 2157
237 Ga0207678_10000198 3300026067 Bacteria 52573
238 Ga0207678_10001415 3300026067 Bacteria 21990
239 Ga0207678_10002551 3300026067 Bacteria 16595
240 Ga0207678_10024551 3300026067 Bacteria 5265
241 Ga0207678_10074590 3300026067 Bacteria 2907
242 Ga0207678_10097854 3300026067 Bacteria 2507
243 Ga0207678_10139030 3300026067 Bacteria 2072
244 Ga0207678_10230744 3300026067 Bacteria 1585
245 Ga0207702_10008268 3300026078 Bacteria 8791
246 Ga0207702_10008747 3300026078 Bacteria 8536
247 Ga0207641_10000221 3300026088 Bacteria 74390
248 Ga0207641_10002549 3300026088 Bacteria 16763
249 Ga0207641_10027083 3300026088 Bacteria 4733
250 Ga0207641_10075248 3300026088 Bacteria 2916
251 Ga0207648_10000317 3300026089 Bacteria 52853
252 Ga0207648_10005328 3300026089 Bacteria 12967
253 Ga0207648_10019358 3300026089 Bacteria 6144
254 Ga0207676_10000378 3300026095 Bacteria 37895
255 Ga0207676_10001355 3300026095 Bacteria 18216
256 Ga0207674_10012074 3300026116 Bacteria 9675
257 Ga0207674_10033675 3300026116 Bacteria 5362
258 Ga0207674_10140812 3300026116 Bacteria 2371
259 Ga0207674_10242524 3300026116 Bacteria 1749
260 Ga0207675_100092591 3300026118 Bacteria 2843
261 Ga0207698_10000125 3300026142 Bacteria 48032
262 Ga0207698_10004848 3300026142 Bacteria 8241
263 Ga0207698_10009150 3300026142 Bacteria 6297
264 Ga0207698_10029432 3300026142 Bacteria 3934
265 Ga0207698_10057657 3300026142 Bacteria 3006
266 Ga0268266_10000433 3300028379 Bacteria 62887
267 Ga0268266_10006457 3300028379 Bacteria 10737
268 Ga0268265_10001441 3300028380 Bacteria 20055
269 Ga0268265_10010998 3300028380 Bacteria 6113
270 Ga0268265_10021625 3300028380 Bacteria 4509
271 Ga0268265_10073863 3300028380 Bacteria 2665
272 Ga0268265_10146134 3300028380 Bacteria 1987
273 Ga0268265_10322166 3300028380 Bacteria 1400
274 Ga0268264_10169695 3300028381 Bacteria 1972
275 Ga0307406_10168284 3300031901 Bacteria 1583
276 Ga0307412_10162064 3300031911 Bacteria 1663
277 Ga0307412_10214928 3300031911 Bacteria 1470
278 Ga0307409_100062846 3300031995 Bacteria 2908
279 Ga0307416_100013849 3300032002 Bacteria 5497
280 Ga0307414_10012920 3300032004 Bacteria 4957
281 Ga0307414_10121035 3300032004 Bacteria 2012
282 Ga0373923_0034859 3300035111 Bacteria 2045
283 Ga0373943_0016072 3300035170 Bacteria 3408
284 Ga0373935_0010669 3300035692 Bacteria 5517
285 Ga0373933_0083037 3300035724 Bacteria 1967
286 Ga0373937_0244628 3300036401 Bacteria 1690
287 Ga0373925_0007643 3300037068 Bacteria 7874
288 Ga0395899_0005689 3300037312 Bacteria 9678
289 Ga0395899_0033513 3300037312 Bacteria 3857
290 Ga0395899_0035798 3300037312 Bacteria 3726
291 Ga0395899_0038441 3300037312 Bacteria 3584
292 Ga0395900_0035752 3300037418 Bacteria 5118
293 Ga0395900_0043543 3300037418 Bacteria 4626
294 Ga0395900_0053831 3300037418 Bacteria 4142
295 Ga0395900_0056442 3300037418 Bacteria 4042
296 Ga0395900_0086497 3300037418 Bacteria 3221
297 Ga0395900_0108525 3300037418 Bacteria 2851
298 Ga0395900_0195706 3300037418 Bacteria 2048
299 Ga0395900_0247272 3300037418 Bacteria 1786
300 Ga0395900_0292617 3300037418 Bacteria 1617
301 Ga0395900_0294835 3300037418 Bacteria 1609
302 Ga0395898_0003841 3300037466 Bacteria 16653
303 Ga0395898_0027954 3300037466 Bacteria 5656
304 Ga0395898_0107741 3300037466 Bacteria 2672
305 Ga0395898_0120325 3300037466 Bacteria 2515
306 Ga0395898_0162927 3300037466 Bacteria 2133
307 Ga0395905_0000974 3300037471 Bacteria 36725
308 Ga0395905_0002062 3300037471 Bacteria 22902
309 Ga0395905_0004757 3300037471 Bacteria 14031
310 Ga0395905_0008521 3300037471 Bacteria 10110
311 Ga0395905_0010733 3300037471 Bacteria 8882
312 Ga0395905_0013490 3300037471 Bacteria 7829
313 Ga0395905_0038274 3300037471 Bacteria 4500
314 Ga0395905_0043405 3300037471 Bacteria 4218
315 Ga0395905_0045226 3300037471 Bacteria 4129
316 Ga0395905_0093660 3300037471 Bacteria 2817
317 Ga0395905_0193672 3300037471 Bacteria 1906
318 Ga0395905_0206160 3300037471 Bacteria 1842
319 Ga0395905_0250931 3300037471 Bacteria 1653
320 Ga0395905_0273795 3300037471 Bacteria 1574
321 Ga0395905_0282641 3300037471 Bacteria 1545
322 Ga0395901_0015236 3300038443 Bacteria 7823
323 Ga0395901_0039088 3300038443 Bacteria 4909
324 Ga0395901_0047091 3300038443 Bacteria 4478
325 Ga0395901_0049121 3300038443 Bacteria 4382
326 Ga0395901_0076920 3300038443 Bacteria 3482
327 Ga0395901_0216471 3300038443 Bacteria 2003
328 Ga0395901_0357956 3300038443 Bacteria 1505
329 Ga0439438_022957 3300041405 Bacteria 1725
330 Ga0439448_0006381 3300042005 Bacteria 3390
331 Ga0450889_000005 3300042144 Bacteria 19354
332 Ga0439458_0000012 3300042157 Bacteria 27891
333 Ga0439464_0003424 3300042439 Bacteria 3999
334 Ga0466966_0000004 3300044684 Bacteria 223594
335 Ga0466966_0125445 3300044684 Bacteria 1575
336 Ga0466961_0015272 3300044693 Bacteria 4931
337 Ga0466961_0049536 3300044693 Bacteria 2684
338 Ga0466963_0001967 3300044694 Bacteria 11280
339 Ga0466963_0075839 3300044694 Bacteria 2270
340 Ga0466971_0048749 3300044719 Bacteria 1904
341 Ga0466970_0015736 3300044765 Bacteria 3894
342 Ga0466970_0035002 3300044765 Bacteria 2660
343 Ga0466970_0153050 3300044765 Bacteria 1274
344 Ga0466957_0004237 3300044842 Bacteria 7953
345 Ga0466957_0092533 3300044842 Bacteria 1896
346 Ga0466959_0124353 3300045049 Bacteria 1831
347 Ga0466958_0001495 3300045836 Bacteria 11169
348 Ga0495668_0003737 3300046616 Bacteria 11181
349 Ga0495669_0018051 3300046684 Bacteria 3031
350 Ga0495669_0022569 3300046684 Bacteria 2734
351 Ga0495669_0050308 3300046684 Bacteria 1868
352 Ga0500658_0000173 3300053134 Bacteria 30720
353 Ga0466962_0004605 3300061719 Bacteria 6617
354 Ga0466962_0021612 3300061719 Bacteria 3088

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013308 Ga0157375_10185031 Ga0157375_101850312 318
2 3300005985 Ga0081539_10040870 Ga0081539_100408702 321
3 3300005367 Ga0070667_100068114 Ga0070667_1000681143 325
4 3300005367 Ga0070667_100158642 Ga0070667_1001586422 326
5 3300009177 Ga0105248_10009193 Ga0105248_100091933 326
6 3300025941 Ga0207711_10015381 Ga0207711_100153812 326
7 3300046684 Ga0495669_0050308 Ga0495669_0050308_338_1555 331
8 3300005535 Ga0070684_100280291 Ga0070684_1002802912 332
9 3300005614 Ga0068856_100130219 Ga0068856_1001302193 336
10 3300009545 Ga0105237_10426039 Ga0105237_104260391 336
11 3300013102 Ga0157371_10056490 Ga0157371_100564902 336
12 3300013104 Ga0157370_10330180 Ga0157370_103301801 336
13 3300026078 Ga0207702_10008747 Ga0207702_100087475 336
14 3300037418 Ga0395900_0247272 Ga0395900_0247272_247_1434 336
15 3300005327 Ga0070658_10092199 Ga0070658_100921993 339
16 3300037418 Ga0395900_0108525 Ga0395900_0108525_1237_2436 340
17 3300005329 Ga0070683_100055232 Ga0070683_1000552323 342
18 3300005335 Ga0070666_10016172 Ga0070666_100161725 342
19 3300005367 Ga0070667_100024755 Ga0070667_1000247555 342
20 3300005436 Ga0070713_100150088 Ga0070713_1001500881 342
21 3300005548 Ga0070665_100069672 Ga0070665_1000696723 342
22 3300005578 Ga0068854_100014552 Ga0068854_1000145525 342
23 3300006028 Ga0070717_10030093 Ga0070717_100300932 342
24 3300013307 Ga0157372_10180276 Ga0157372_101802762 342
25 3300025904 Ga0207647_10135203 Ga0207647_101352032 342
26 3300025928 Ga0207700_10107863 Ga0207700_101078633 342
27 3300025933 Ga0207706_10108873 Ga0207706_101088732 342
28 3300026041 Ga0207639_10065869 Ga0207639_100658693 342
29 3300026067 Ga0207678_10000198 Ga0207678_1000019831 342
30 3300026116 Ga0207674_10012074 Ga0207674_100120749 342
31 3300037471 Ga0395905_0093660 Ga0395905_0093660_1296_2495 342
32 3300005578 Ga0068854_100004256 Ga0068854_1000042566 344
33 3300025904 Ga0207647_10042920 Ga0207647_100429203 344
34 3300025913 Ga0207695_10001271 Ga0207695_1000127129 344
35 3300025981 Ga0207640_10000295 Ga0207640_1000029529 344
36 3300037471 Ga0395905_0002062 Ga0395905_0002062_13344_14537 344
37 3300026067 Ga0207678_10097854 Ga0207678_100978542 345
38 3300037312 Ga0395899_0038441 Ga0395899_0038441_1940_3133 345
39 3300037418 Ga0395900_0294835 Ga0395900_0294835_272_1465 345
40 3300044684 Ga0466966_0125445 Ga0466966_0125445_307_1506 345
41 3300044765 Ga0466970_0153050 Ga0466970_0153050_28_1227 345
42 3300005366 Ga0070659_100019123 Ga0070659_1000191234 346
43 3300025932 Ga0207690_10031571 Ga0207690_100315713 346
44 3300037471 Ga0395905_0250931 Ga0395905_0250931_103_1305 346
45 3300044694 Ga0466963_0075839 Ga0466963_0075839_567_1766 346
46 3300037312 Ga0395899_0005689 Ga0395899_0005689_3473_4672 347
47 3300037418 Ga0395900_0035752 Ga0395900_0035752_1328_2527 347
48 3300037418 Ga0395900_0195706 Ga0395900_0195706_296_1510 347
49 3300037466 Ga0395898_0027954 Ga0395898_0027954_997_2196 347
50 3300037471 Ga0395905_0013490 Ga0395905_0013490_4108_5307 347
51 3300037471 Ga0395905_0038274 Ga0395905_0038274_1467_2699 347
52 3300037471 Ga0395905_0282641 Ga0395905_0282641_95_1294 347
53 3300038443 Ga0395901_0015236 Ga0395901_0015236_3300_4532 347
54 3300038443 Ga0395901_0039088 Ga0395901_0039088_1626_2825 347
55 3300038443 Ga0395901_0076920 Ga0395901_0076920_1844_3043 347
56 3300005347 Ga0070668_100019739 Ga0070668_1000197393 348
57 3300005366 Ga0070659_100028009 Ga0070659_1000280095 348
58 3300005455 Ga0070663_100102310 Ga0070663_1001023102 348
59 3300005843 Ga0068860_100060088 Ga0068860_1000600882 348
60 3300005844 Ga0068862_100008684 Ga0068862_1000086846 348
61 3300025909 Ga0207705_10000955 Ga0207705_1000095514 348
62 3300025919 Ga0207657_10004723 Ga0207657_1000472315 348
63 3300025920 Ga0207649_10015973 Ga0207649_100159732 348
64 3300025933 Ga0207706_10034047 Ga0207706_100340475 348
65 3300028380 Ga0268265_10010998 Ga0268265_100109981 348
66 3300037418 Ga0395900_0043543 Ga0395900_0043543_2087_3316 348
67 3300037471 Ga0395905_0206160 Ga0395905_0206160_203_1435 348
68 3300044693 Ga0466961_0015272 Ga0466961_0015272_3489_4682 348
69 3300003323 rootH1_10286338 rootH1_102863382 349
70 3300044693 Ga0466961_0049536 Ga0466961_0049536_611_1810 349
71 3300044694 Ga0466963_0001967 Ga0466963_0001967_3465_4658 349
72 3300044719 Ga0466971_0048749 Ga0466971_0048749_311_1510 349
73 3300044765 Ga0466970_0015736 Ga0466970_0015736_2653_3846 349
74 3300044765 Ga0466970_0035002 Ga0466970_0035002_1248_2447 349
75 3300044842 Ga0466957_0004237 Ga0466957_0004237_6468_7661 349
76 3300044842 Ga0466957_0092533 Ga0466957_0092533_564_1763 349
77 3300045049 Ga0466959_0124353 Ga0466959_0124353_145_1344 349
78 3300045836 Ga0466958_0001495 Ga0466958_0001495_1927_3120 349
79 3300061719 Ga0466962_0004605 Ga0466962_0004605_1209_2402 349
80 3300061719 Ga0466962_0021612 Ga0466962_0021612_1118_2317 349
81 3300005353 Ga0070669_100034044 Ga0070669_1000340442 350
82 3300005355 Ga0070671_100070247 Ga0070671_1000702474 350
83 3300005367 Ga0070667_100000787 Ga0070667_10000078716 350
84 3300005367 Ga0070667_100007477 Ga0070667_1000074772 350
85 3300005455 Ga0070663_100064118 Ga0070663_1000641182 350
86 3300005543 Ga0070672_100170099 Ga0070672_1001700992 350
87 3300005617 Ga0068859_100000324 Ga0068859_10000032428 350
88 3300005618 Ga0068864_100000291 Ga0068864_10000029119 350
89 3300005841 Ga0068863_100002255 Ga0068863_10000225511 350
90 3300005842 Ga0068858_100005886 Ga0068858_1000058869 350
91 3300005843 Ga0068860_100001774 Ga0068860_10000177416 350
92 3300006931 Ga0097620_100000324 Ga0097620_10000032428 350
93 3300009092 Ga0105250_10007638 Ga0105250_100076381 350
94 3300009177 Ga0105248_10000123 Ga0105248_1000012351 350
95 3300014325 Ga0163163_10000265 Ga0163163_100002659 350
96 3300014968 Ga0157379_10002236 Ga0157379_100022368 350
97 3300025923 Ga0207681_10061706 Ga0207681_100617063 350
98 3300025931 Ga0207644_10048417 Ga0207644_100484172 350
99 3300025941 Ga0207711_10000100 Ga0207711_1000010053 350
100 3300025961 Ga0207712_10032226 Ga0207712_100322262 350
101 3300025986 Ga0207658_10001697 Ga0207658_100016977 350
102 3300026067 Ga0207678_10139030 Ga0207678_101390302 350
103 3300026088 Ga0207641_10000221 Ga0207641_1000022152 350
104 3300026095 Ga0207676_10000378 Ga0207676_1000037828 350
105 3300028380 Ga0268265_10146134 Ga0268265_101461342 350
106 3300028381 Ga0268264_10169695 Ga0268264_101696951 350
107 3300037471 Ga0395905_0010733 Ga0395905_0010733_2022_3242 350
108 3300044684 Ga0466966_0000004 Ga0466966_0000004_18932_20143 350
109 3300046616 Ga0495668_0003737 Ga0495668_0003737_7157_8359 350
110 3300046684 Ga0495669_0022569 Ga0495669_0022569_116_1318 350
111 3300053134 Ga0500658_0000173 Ga0500658_0000173_22945_24147 350
112 3300013100 Ga0157373_10120344 Ga0157373_101203442 352
113 3300013296 Ga0157374_10002301 Ga0157374_100023019 352
114 3300042005 Ga0439448_0006381 Ga0439448_0006381_549_1748 352
115 3300042157 Ga0439458_0000012 Ga0439458_0000012_14606_15805 352
116 3300013102 Ga0157371_10051837 Ga0157371_100518372 353
117 3300013105 Ga0157369_10129433 Ga0157369_101294333 353
118 3300037471 Ga0395905_0000974 Ga0395905_0000974_10631_11827 353
119 3300038443 Ga0395901_0047091 Ga0395901_0047091_2000_3196 353
120 3300005327 Ga0070658_10164989 Ga0070658_101649892 354
121 3300005336 Ga0070680_100171983 Ga0070680_1001719832 354
122 3300005435 Ga0070714_100005008 Ga0070714_1000050085 354
123 3300005458 Ga0070681_10222435 Ga0070681_102224351 354
124 3300005530 Ga0070679_100068865 Ga0070679_1000688653 354
125 3300013104 Ga0157370_10030536 Ga0157370_100305363 354
126 3300025917 Ga0207660_10164543 Ga0207660_101645432 354
127 3300025919 Ga0207657_10007978 Ga0207657_100079782 354
128 3300025928 Ga0207700_10139607 Ga0207700_101396072 354
129 3300026041 Ga0207639_10120212 Ga0207639_101202122 354
130 3300001979 JGI24740J21852_10009623 JGI24740J21852_100096234 355
131 3300005366 Ga0070659_100054480 Ga0070659_1000544803 355
132 3300005578 Ga0068854_100037465 Ga0068854_1000374652 355
133 3300005616 Ga0068852_100028132 Ga0068852_1000281322 355
134 3300025919 Ga0207657_10007311 Ga0207657_100073119 355
135 3300025920 Ga0207649_10000176 Ga0207649_1000017620 355
136 3300025932 Ga0207690_10032936 Ga0207690_100329363 355
137 3300025949 Ga0207667_10016701 Ga0207667_100167014 355
138 3300025981 Ga0207640_10028717 Ga0207640_100287173 355
139 3300026067 Ga0207678_10024551 Ga0207678_100245512 355
140 3300026116 Ga0207674_10242524 Ga0207674_102425242 355
141 3300026142 Ga0207698_10029432 Ga0207698_100294322 355
142 3300037418 Ga0395900_0056442 Ga0395900_0056442_2660_3859 355
143 3300037466 Ga0395898_0162927 Ga0395898_0162927_833_2032 355
144 3300037471 Ga0395905_0045226 Ga0395905_0045226_1938_3137 355
145 3300038443 Ga0395901_0357956 Ga0395901_0357956_246_1439 355
146 3300035170 Ga0373943_0016072 Ga0373943_0016072_807_2006 357
147 3300035692 Ga0373935_0010669 Ga0373935_0010669_2479_3678 357
148 3300037068 Ga0373925_0007643 Ga0373925_0007643_2410_3609 357
149 3300037471 Ga0395905_0004757 Ga0395905_0004757_8295_9494 357
150 3300037471 Ga0395905_0273795 Ga0395905_0273795_160_1359 357
151 3300031911 Ga0307412_10214928 Ga0307412_102149282 358
152 3300031901 Ga0307406_10168284 Ga0307406_101682842 359
153 3300031911 Ga0307412_10162064 Ga0307412_101620642 359
154 3300001990 JGI24737J22298_10017367 JGI24737J22298_100173672 360
155 3300005329 Ga0070683_100121116 Ga0070683_1001211161 360
156 3300005344 Ga0070661_100010124 Ga0070661_1000101242 360
157 3300005455 Ga0070663_100001867 Ga0070663_1000018676 360
158 3300005563 Ga0068855_100046324 Ga0068855_1000463244 360
159 3300005614 Ga0068856_100005795 Ga0068856_10000579510 360
160 3300005616 Ga0068852_100000751 Ga0068852_1000007518 360
161 3300009093 Ga0105240_10056373 Ga0105240_100563732 360
162 3300010375 Ga0105239_10368052 Ga0105239_103680522 360
163 3300013102 Ga0157371_10002546 Ga0157371_1000254612 360
164 3300013105 Ga0157369_10000823 Ga0157369_1000082314 360
165 3300013105 Ga0157369_10005643 Ga0157369_1000564312 360
166 3300013105 Ga0157369_10123636 Ga0157369_101236362 360
167 3300013307 Ga0157372_10088593 Ga0157372_100885933 360
168 3300025909 Ga0207705_10000753 Ga0207705_1000075325 360
169 3300025913 Ga0207695_10006302 Ga0207695_1000630215 360
170 3300025949 Ga0207667_10013772 Ga0207667_100137727 360
171 3300025986 Ga0207658_10067648 Ga0207658_100676483 360
172 3300026067 Ga0207678_10002551 Ga0207678_100025515 360
173 3300026078 Ga0207702_10008268 Ga0207702_100082685 360
174 3300026142 Ga0207698_10004848 Ga0207698_100048488 360
175 3300037418 Ga0395900_0292617 Ga0395900_0292617_115_1302 360
176 3300037466 Ga0395898_0003841 Ga0395898_0003841_7186_8379 360
177 3300005577 Ga0068857_100131875 Ga0068857_1001318752 361
178 3300005841 Ga0068863_100033904 Ga0068863_1000339045 361
179 3300013102 Ga0157371_10069825 Ga0157371_100698252 361
180 3300026088 Ga0207641_10027083 Ga0207641_100270835 361
181 3300026116 Ga0207674_10140812 Ga0207674_101408122 361
182 3300032004 Ga0307414_10012920 Ga0307414_100129202 361
183 3300037312 Ga0395899_0035798 Ga0395899_0035798_729_1922 363
184 3300037418 Ga0395900_0053831 Ga0395900_0053831_617_1810 363
185 3300037466 Ga0395898_0107741 Ga0395898_0107741_762_1955 363
186 3300037471 Ga0395905_0043405 Ga0395905_0043405_2147_3340 363
187 3300038443 Ga0395901_0216471 Ga0395901_0216471_218_1594 363
188 3300013102 Ga0157371_10029261 Ga0157371_100292612 364
189 3300031995 Ga0307409_100062846 Ga0307409_1000628463 364
190 3300032002 Ga0307416_100013849 Ga0307416_1000138494 364
191 3300037312 Ga0395899_0033513 Ga0395899_0033513_1197_2393 364
192 3300037418 Ga0395900_0086497 Ga0395900_0086497_944_2140 364
193 3300037466 Ga0395898_0120325 Ga0395898_0120325_773_1969 364
194 3300038443 Ga0395901_0049121 Ga0395901_0049121_2477_3673 364
195 3300005331 Ga0070670_100178904 Ga0070670_1001789042 365
196 3300005356 Ga0070674_100008524 Ga0070674_1000085246 365
197 3300005367 Ga0070667_100179800 Ga0070667_1001798002 365
198 3300005435 Ga0070714_100224850 Ga0070714_1002248501 365
199 3300005459 Ga0068867_100012558 Ga0068867_1000125583 365
200 3300005530 Ga0070679_100234866 Ga0070679_1002348662 365
201 3300005543 Ga0070672_100185058 Ga0070672_1001850582 365
202 3300005548 Ga0070665_100004457 Ga0070665_1000044574 365
203 3300005614 Ga0068856_100289862 Ga0068856_1002898622 365
204 3300005614 Ga0068856_100388227 Ga0068856_1003882272 365
205 3300005616 Ga0068852_100001393 Ga0068852_1000013936 365
206 3300005843 Ga0068860_100197562 Ga0068860_1001975622 365
207 3300005844 Ga0068862_100003906 Ga0068862_1000039066 365
208 3300009177 Ga0105248_10023758 Ga0105248_100237583 365
209 3300013308 Ga0157375_10020866 Ga0157375_100208662 365
210 3300025907 Ga0207645_10000418 Ga0207645_1000041820 365
211 3300025908 Ga0207643_10058941 Ga0207643_100589412 365
212 3300025909 Ga0207705_10039780 Ga0207705_100397803 365
213 3300025923 Ga0207681_10014078 Ga0207681_100140784 365
214 3300025923 Ga0207681_10146943 Ga0207681_101469432 365
215 3300025937 Ga0207669_10005747 Ga0207669_100057472 365
216 3300025938 Ga0207704_10126843 Ga0207704_101268432 365
217 3300025940 Ga0207691_10203373 Ga0207691_102033732 365
218 3300025941 Ga0207711_10009429 Ga0207711_100094294 365
219 3300025949 Ga0207667_10219469 Ga0207667_102194691 365
220 3300025960 Ga0207651_10032476 Ga0207651_100324763 365
221 3300025972 Ga0207668_10000080 Ga0207668_1000008058 365
222 3300025981 Ga0207640_10274150 Ga0207640_102741502 365
223 3300025986 Ga0207658_10147835 Ga0207658_101478352 365
224 3300026067 Ga0207678_10230744 Ga0207678_102307442 365
225 3300026088 Ga0207641_10075248 Ga0207641_100752483 365
226 3300026089 Ga0207648_10019358 Ga0207648_100193585 365
227 3300026142 Ga0207698_10000125 Ga0207698_1000012520 365
228 3300028379 Ga0268266_10006457 Ga0268266_100064579 365
229 3300028380 Ga0268265_10001441 Ga0268265_1000144111 365
230 3300028380 Ga0268265_10322166 Ga0268265_103221661 365
231 3300032004 Ga0307414_10121035 Ga0307414_101210352 365
232 3300037471 Ga0395905_0008521 Ga0395905_0008521_3310_4506 365
233 3300001979 JGI24740J21852_10005120 JGI24740J21852_100051205 366
234 3300001989 JGI24739J22299_10000659 JGI24739J22299_1000065910 366
235 3300001990 JGI24737J22298_10000051 JGI24737J22298_100000514 366
236 3300002075 JGI24738J21930_10000189 JGI24738J21930_1000018912 366
237 3300005328 Ga0070676_10000346 Ga0070676_100003463 366
238 3300005330 Ga0070690_100057468 Ga0070690_1000574683 366
239 3300005331 Ga0070670_100006004 Ga0070670_10000600410 366
240 3300005334 Ga0068869_100000742 Ga0068869_10000074216 366
241 3300005335 Ga0070666_10032484 Ga0070666_100324842 366
242 3300005338 Ga0068868_100011860 Ga0068868_1000118603 366
243 3300005339 Ga0070660_100000843 Ga0070660_1000008435 366
244 3300005344 Ga0070661_100026575 Ga0070661_1000265752 366
245 3300005344 Ga0070661_100058399 Ga0070661_1000583992 366
246 3300005347 Ga0070668_100007338 Ga0070668_1000073386 366
247 3300005347 Ga0070668_100026063 Ga0070668_1000260633 366
248 3300005353 Ga0070669_100000752 Ga0070669_10000075212 366
249 3300005354 Ga0070675_100074669 Ga0070675_1000746692 366
250 3300005355 Ga0070671_100007775 Ga0070671_1000077753 366
251 3300005356 Ga0070674_100009790 Ga0070674_1000097902 366
252 3300005364 Ga0070673_100000145 Ga0070673_10000014521 366
253 3300005366 Ga0070659_100000982 Ga0070659_10000098215 366
254 3300005366 Ga0070659_100098140 Ga0070659_1000981401 366
255 3300005367 Ga0070667_100041589 Ga0070667_1000415893 366
256 3300005455 Ga0070663_100035586 Ga0070663_1000355862 366
257 3300005455 Ga0070663_100054430 Ga0070663_1000544303 366
258 3300005457 Ga0070662_100000586 Ga0070662_1000005869 366
259 3300005459 Ga0068867_100001195 Ga0068867_1000011954 366
260 3300005539 Ga0068853_100000470 Ga0068853_10000047014 366
261 3300005539 Ga0068853_100009706 Ga0068853_1000097063 366
262 3300005539 Ga0068853_100091244 Ga0068853_1000912442 366
263 3300005543 Ga0070672_100002839 Ga0070672_1000028392 366
264 3300005548 Ga0070665_100006112 Ga0070665_1000061126 366
265 3300005548 Ga0070665_100134592 Ga0070665_1001345923 366
266 3300005563 Ga0068855_100005215 Ga0068855_1000052152 366
267 3300005564 Ga0070664_100027011 Ga0070664_1000270115 366
268 3300005564 Ga0070664_100076899 Ga0070664_1000768992 366
269 3300005577 Ga0068857_100001148 Ga0068857_10000114820 366
270 3300005578 Ga0068854_100000061 Ga0068854_1000000615 366
271 3300005578 Ga0068854_100172745 Ga0068854_1001727452 366
272 3300005614 Ga0068856_100262673 Ga0068856_1002626732 366
273 3300005616 Ga0068852_100000288 Ga0068852_10000028821 366
274 3300005616 Ga0068852_100006051 Ga0068852_1000060513 366
275 3300005616 Ga0068852_100167056 Ga0068852_1001670562 366
276 3300005617 Ga0068859_100000778 Ga0068859_10000077811 366
277 3300005618 Ga0068864_100000795 Ga0068864_10000079520 366
278 3300005718 Ga0068866_10006297 Ga0068866_100062972 366
279 3300005719 Ga0068861_100052822 Ga0068861_1000528222 366
280 3300005834 Ga0068851_10002886 Ga0068851_100028866 366
281 3300005834 Ga0068851_10014434 Ga0068851_100144342 366
282 3300005841 Ga0068863_100001605 Ga0068863_10000160517 366
283 3300005842 Ga0068858_100002203 Ga0068858_10000220317 366
284 3300005843 Ga0068860_100001686 Ga0068860_10000168622 366
285 3300005844 Ga0068862_100042404 Ga0068862_1000424043 366
286 3300006358 Ga0068871_100177892 Ga0068871_1001778922 366
287 3300006881 Ga0068865_100007421 Ga0068865_1000074215 366
288 3300006931 Ga0097620_100000778 Ga0097620_10000077825 366
289 3300009098 Ga0105245_10000326 Ga0105245_1000032639 366
290 3300009148 Ga0105243_10073739 Ga0105243_100737393 366
291 3300009174 Ga0105241_10172323 Ga0105241_101723232 366
292 3300009177 Ga0105248_10000159 Ga0105248_1000015939 366
293 3300009545 Ga0105237_10255511 Ga0105237_102555112 366
294 3300010375 Ga0105239_10020658 Ga0105239_100206584 366
295 3300011119 Ga0105246_10019698 Ga0105246_100196983 366
296 3300013100 Ga0157373_10002590 Ga0157373_100025906 366
297 3300013102 Ga0157371_10001589 Ga0157371_100015899 366
298 3300013297 Ga0157378_10002474 Ga0157378_1000247418 366
299 3300013306 Ga0163162_10014860 Ga0163162_100148603 366
300 3300013308 Ga0157375_10030674 Ga0157375_100306745 366
301 3300025315 Ga0207697_10000664 Ga0207697_1000066416 366
302 3300025321 Ga0207656_10002512 Ga0207656_100025122 366
303 3300025321 Ga0207656_10002673 Ga0207656_100026736 366
304 3300025901 Ga0207688_10000730 Ga0207688_100007304 366
305 3300025903 Ga0207680_10013220 Ga0207680_100132202 366
306 3300025904 Ga0207647_10002581 Ga0207647_100025815 366
307 3300025907 Ga0207645_10015378 Ga0207645_100153784 366
308 3300025909 Ga0207705_10028245 Ga0207705_100282453 366
309 3300025911 Ga0207654_10133836 Ga0207654_101338361 366
310 3300025919 Ga0207657_10002400 Ga0207657_1000240016 366
311 3300025923 Ga0207681_10001054 Ga0207681_100010546 366
312 3300025924 Ga0207694_10062350 Ga0207694_100623503 366
313 3300025925 Ga0207650_10014311 Ga0207650_100143114 366
314 3300025926 Ga0207659_10064364 Ga0207659_100643643 366
315 3300025927 Ga0207687_10003615 Ga0207687_1000361510 366
316 3300025931 Ga0207644_10005155 Ga0207644_100051557 366
317 3300025932 Ga0207690_10006190 Ga0207690_100061905 366
318 3300025933 Ga0207706_10000171 Ga0207706_1000017142 366
319 3300025935 Ga0207709_10047802 Ga0207709_100478022 366
320 3300025938 Ga0207704_10008679 Ga0207704_100086792 366
321 3300025940 Ga0207691_10001864 Ga0207691_100018642 366
322 3300025941 Ga0207711_10009134 Ga0207711_100091342 366
323 3300025942 Ga0207689_10000092 Ga0207689_1000009220 366
324 3300025945 Ga0207679_10103116 Ga0207679_101031161 366
325 3300025945 Ga0207679_10104134 Ga0207679_101041342 366
326 3300025949 Ga0207667_10135934 Ga0207667_101359342 366
327 3300025960 Ga0207651_10000521 Ga0207651_100005215 366
328 3300025972 Ga0207668_10010968 Ga0207668_100109683 366
329 3300025972 Ga0207668_10045583 Ga0207668_100455832 366
330 3300026023 Ga0207677_10047130 Ga0207677_100471302 366
331 3300026035 Ga0207703_10002403 Ga0207703_100024032 366
332 3300026041 Ga0207639_10002585 Ga0207639_1000258512 366
333 3300026041 Ga0207639_10050451 Ga0207639_100504513 366
334 3300026067 Ga0207678_10001415 Ga0207678_100014153 366
335 3300026067 Ga0207678_10074590 Ga0207678_100745902 366
336 3300026088 Ga0207641_10002549 Ga0207641_1000254912 366
337 3300026089 Ga0207648_10000317 Ga0207648_1000031715 366
338 3300026089 Ga0207648_10005328 Ga0207648_1000532813 366
339 3300026095 Ga0207676_10001355 Ga0207676_1000135520 366
340 3300026116 Ga0207674_10033675 Ga0207674_100336753 366
341 3300026118 Ga0207675_100092591 Ga0207675_1000925913 366
342 3300026142 Ga0207698_10009150 Ga0207698_100091503 366
343 3300026142 Ga0207698_10057657 Ga0207698_100576573 366
344 3300028379 Ga0268266_10000433 Ga0268266_1000043352 366
345 3300028380 Ga0268265_10021625 Ga0268265_100216253 366
346 3300028380 Ga0268265_10073863 Ga0268265_100738632 366
347 3300035111 Ga0373923_0034859 Ga0373923_0034859_222_1421 366
348 3300035724 Ga0373933_0083037 Ga0373933_0083037_338_1537 366
349 3300036401 Ga0373937_0244628 Ga0373937_0244628_129_1328 366
350 3300037471 Ga0395905_0193672 Ga0395905_0193672_670_1863 366
351 3300041405 Ga0439438_022957 Ga0439438_022957_10_1206 366
352 3300042144 Ga0450889_000005 Ga0450889_000005_2479_3675 366
353 3300042439 Ga0439464_0003424 Ga0439464_0003424_367_1557 366
354 3300046684 Ga0495669_0018051 Ga0495669_0018051_119_1318 366

Feature Viewer

pLDDT pTM Quality
62.79 0.41 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map