F419906

General Info

Members Datasets Scaffolds Average Seq Length
354 209 708 269

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0010186|Ga0501033_0010186_1692_2717
Length 306
Sequence MSDATRAVAAGTEPAGVQEPPSAASLETVLSLRDATLGFADRTLWSGLDLNVHGGEFIAVLGANGSGKTSLLRVILGQQKLVSGSIDFLGEPVTRGNRRIGYVPQQRLADEGTPLRARDLVGLGLDGHRWGVPWPSRRRRERIDGLLDAVGAVPYGSVPIATLSGGEQQRLRVGQALAGDPRLLLCDEPLLSLDLAHQRAVSELIDRQRRERQLGVLFVTHDVNPVLDLVDRVLYLAGGKFRIGTPDQVLRSEVLSELYDAPVDVIRTRGRIVVVGTADAPGAHPDGLHAHHDTMPGAATGGSSER

Samples

Sample ID Description Type Environment
1 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
11 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
12 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
57 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
58 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
62 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
87 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
88 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
91 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
95 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
96 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
97 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
98 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
99 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
100 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
101 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
102 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
103 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
104 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
105 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
106 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
107 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
108 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
109 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
110 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
111 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
112 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
113 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
114 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
115 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
116 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
117 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
118 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
119 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
120 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
121 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
122 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
123 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
124 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
125 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
126 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
127 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
128 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
141 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
142 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
143 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
144 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
145 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
146 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
147 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
148 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
149 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
151 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
152 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
153 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
154 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
155 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
156 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
157 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
158 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
159 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
160 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
161 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
162 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
163 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
164 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
165 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
166 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
167 2582580736 Prauserella sp. Am3 Isolate Unclassified
168 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
169 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
170 2643221546 Microbacterium sp. Root53 Isolate Unclassified
171 2643221566 Microbacterium sp. Root166 Isolate Unclassified
172 2643221597 Microbacterium sp. Root180 Isolate Unclassified
173 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
174 2643221649 Leifsonia sp. Root4 Isolate Unclassified
175 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
176 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
177 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
178 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
179 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
180 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
181 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
182 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
183 2891562705 Microbispora tritici MT50 Isolate Unclassified
184 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
185 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
186 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
187 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
188 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
189 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
190 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
191 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
192 2919069694 Microbacterium sp. 1154 Isolate Unclassified
193 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
194 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
195 2928153084 Leifsonia sp. 563 Isolate Unclassified
196 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
197 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
198 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
199 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
200 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
201 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
202 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
203 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
204 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
205 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
206 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
207 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
208 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
209 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.16
Metatranscriptomes 1.41
Isolates 12.43

Biome Distribution

Category Percentage (%)
Aerial Root 0.56
Bulb 0
Endosphere 14.41
Nodule 0
Rhizoplane 3.95
Rhizosphere 58.47
Stem 0
Stem Tuber 0
Unclassified 0.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501033_0010186 3300049570 Bacteria 7219
2 JGI24735J21928_10004858 3300002067 Bacteria 4481
3 JGI25164J39214_1000397 3300002772 Bacteria 25332
4 JGI25165J46597_1000005 3300003214 Bacteria 623702
5 rootL2_10062257 3300003322 Bacteria 1750
6 Ga0006562J51391_1006080 3300003578 Bacteria 11098
7 Ga0006562J51391_1006082 3300003578 Bacteria 4290
8 Ga0055539_1000014 3300003752 Bacteria 381086
9 Ga0055533_1000002 3300003756 Bacteria 1196393
10 Ga0055525_1000421 3300003759 Bacteria 25425
11 Ga0055525_1001814 3300003759 Bacteria 2942
12 Ga0055527_1000004 3300003760 Bacteria 570634
13 Ga0055542_1000019 3300003762 Bacteria 341174
14 Ga0055529_1000008 3300003763 Bacteria 394786
15 Ga0070658_10000298 3300005327 Bacteria 43158
16 Ga0070658_10035237 3300005327 Bacteria 4031
17 Ga0070658_10039424 3300005327 Bacteria 3811
18 Ga0070658_10055107 3300005327 Bacteria 3230
19 Ga0070690_100045890 3300005330 Bacteria 2777
20 Ga0070682_100044876 3300005337 Bacteria 2738
21 Ga0070682_100083837 3300005337 Bacteria 2070
22 Ga0068868_100377852 3300005338 Bacteria 1218
23 Ga0070660_100042247 3300005339 Bacteria 3479
24 Ga0070660_100413854 3300005339 Bacteria 1116
25 Ga0070661_100103383 3300005344 Bacteria 2121
26 Ga0070659_100000783 3300005366 Bacteria 23117
27 Ga0070659_100062048 3300005366 Bacteria 2954
28 Ga0070667_100032534 3300005367 Bacteria 4350
29 Ga0070714_100005110 3300005435 Bacteria 9981
30 Ga0070713_100624238 3300005436 Bacteria 1025
31 Ga0070685_10012833 3300005466 Bacteria 4409
32 Ga0068853_100011464 3300005539 Bacteria 7205
33 Ga0068853_100108666 3300005539 Bacteria 2461
34 Ga0070672_100129148 3300005543 Bacteria 2076
35 Ga0068855_100010920 3300005563 Bacteria 10962
36 Ga0068855_100182336 3300005563 Bacteria 2373
37 Ga0068857_100010949 3300005577 Bacteria 7893
38 Ga0068854_100299106 3300005578 Bacteria 1301
39 Ga0068852_100106792 3300005616 Bacteria 2539
40 Ga0068852_100107538 3300005616 Bacteria 2530
41 Ga0068859_100071413 3300005617 Bacteria 3508
42 Ga0068858_100000867 3300005842 Bacteria 31292
43 Ga0075365_10002458 3300006038 Bacteria 9098
44 Ga0075365_10005786 3300006038 Bacteria 6715
45 Ga0075369_10022083 3300006186 Bacteria 2623
46 Ga0097620_100071411 3300006931 Bacteria 3508
47 Ga0105244_10035749 3300009036 Bacteria 2608
48 Ga0105240_10011822 3300009093 Bacteria 12121
49 Ga0105240_10292597 3300009093 Bacteria 1866
50 Ga0105245_10004196 3300009098 Bacteria 12794
51 Ga0105247_10013352 3300009101 Bacteria 4930
52 Ga0105243_10080277 3300009148 Bacteria 2660
53 Ga0105241_10002520 3300009174 Bacteria 13742
54 Ga0105248_10007269 3300009177 Bacteria 12148
55 Ga0105237_10100332 3300009545 Bacteria 2886
56 Ga0105237_10100854 3300009545 Bacteria 2879
57 Ga0105238_10136855 3300009551 Bacteria 2427
58 Ga0157371_10086687 3300013102 Bacteria 2217
59 Ga0157370_10097567 3300013104 Bacteria 2757
60 Ga0157369_10026412 3300013105 Bacteria 6440
61 Ga0157369_10084741 3300013105 Bacteria 3387
62 Ga0157369_10240299 3300013105 Bacteria 1892
63 Ga0157369_10399219 3300013105 Bacteria 1426
64 Ga0157374_10582799 3300013296 Bacteria 1128
65 Ga0157372_10577232 3300013307 Bacteria 1310
66 Ga0157379_10019290 3300014968 Bacteria 6022
67 Ga0206354_10047148 3300020081 Bacteria 5041
68 Ga0206353_10036517 3300020082 Bacteria 7349
69 Ga0206353_11454628 3300020082 Bacteria 1761
70 Ga0209566_100056 3300025225 Bacteria 209595
71 Ga0209674_100001 3300025226 Bacteria 4013750
72 Ga0209672_100011 3300025228 Bacteria 856297
73 Ga0209563_100001 3300025230 Bacteria 4013775
74 Ga0209563_100335 3300025230 Bacteria 18136
75 Ga0207427_100024 3300025231 Bacteria 438403
76 Ga0209437_100243 3300025233 Bacteria 88712
77 Ga0209258_102049 3300025242 Bacteria 5744
78 Ga0209677_100001 3300025253 Bacteria 4013787
79 Ga0209677_101216 3300025253 Bacteria 11724
80 Ga0209148_1000023 3300025254 Bacteria 680511
81 Ga0209148_1000931 3300025254 Bacteria 19265
82 Ga0209233_1000001 3300025261 Bacteria 2992747
83 Ga0209455_1000023 3300025272 Bacteria 680449
84 Ga0209455_1000565 3300025272 Bacteria 24721
85 Ga0207655_1004351 3300025728 Bacteria 10076
86 Ga0207655_1024450 3300025728 Bacteria 2960
87 Ga0207647_10004822 3300025904 Bacteria 9977
88 Ga0207705_10000001 3300025909 Bacteria 2061880
89 Ga0207705_10166882 3300025909 Bacteria 1656
90 Ga0207654_10000001 3300025911 Bacteria 1816198
91 Ga0207695_10001965 3300025913 Bacteria 31843
92 Ga0207695_10114224 3300025913 Bacteria 2676
93 Ga0207695_10383851 3300025913 Bacteria 1290
94 Ga0207671_10082894 3300025914 Bacteria 2407
95 Ga0207671_10128664 3300025914 Bacteria 1942
96 Ga0207657_10096560 3300025919 Bacteria 2458
97 Ga0207694_10080900 3300025924 Bacteria 2550
98 Ga0207687_10018338 3300025927 Bacteria 4617
99 Ga0207700_10020137 3300025928 Bacteria 4523
100 Ga0207664_10002066 3300025929 Bacteria 13221
101 Ga0207690_10000713 3300025932 Bacteria 21429
102 Ga0207709_10004264 3300025935 Bacteria 8279
103 Ga0207691_10320742 3300025940 Bacteria 1328
104 Ga0207711_10012169 3300025941 Bacteria 7152
105 Ga0207711_10183693 3300025941 Bacteria 1903
106 Ga0207667_10003872 3300025949 Bacteria 18418
107 Ga0207667_10020205 3300025949 Bacteria 7412
108 Ga0207667_10029884 3300025949 Bacteria 5903
109 Ga0207658_10032533 3300025986 Bacteria 3712
110 Ga0207703_10000121 3300026035 Bacteria 94523
111 Ga0207639_10025875 3300026041 Bacteria 4259
112 Ga0207639_10106852 3300026041 Bacteria 2273
113 Ga0207678_10019846 3300026067 Bacteria 5908
114 Ga0207702_10094742 3300026078 Bacteria 2621
115 Ga0207702_10259014 3300026078 Bacteria 1637
116 Ga0207702_10321066 3300026078 Bacteria 1475
117 Ga0207674_10004042 3300026116 Bacteria 17798
118 Ga0207698_10005350 3300026142 Bacteria 7916
119 Ga0207698_10058374 3300026142 Bacteria 2990
120 Ga0307513_10025493 3300031456 Bacteria 6848
121 Ga0307514_10126020 3300031649 Bacteria 1774
122 Ga0307518_10177682 3300031838 Bacteria 1443
123 Ga0307416_100126040 3300032002 Bacteria 2294
124 Ga0307507_10005233 3300033179 Bacteria 21590
125 Ga0395899_0013247 3300037312 Bacteria 6310
126 Ga0395899_0025711 3300037312 Bacteria 4444
127 Ga0395900_0001470 3300037418 Bacteria 28112
128 Ga0395900_0053053 3300037418 Bacteria 4173
129 Ga0395898_0000355 3300037466 Bacteria 101003
130 Ga0395898_0610244 3300037466 Bacteria 1034
131 Ga0395901_0299355 3300038443 Bacteria 1668
132 Ga0439465_0032346 3300041413 Bacteria 1670
133 Ga0451791_1705021 3300041451 Bacteria 1537
134 Ga0439462_0005836 3300042015 Bacteria 3047
135 Ga0466965_0000004 3300044683 Bacteria 229348
136 Ga0466965_0154196 3300044683 Bacteria 1202
137 Ga0466961_0010348 3300044693 Bacteria 5948
138 Ga0466961_0148193 3300044693 Bacteria 1466
139 Ga0466961_0181630 3300044693 Bacteria 1306
140 Ga0466961_0182917 3300044693 Bacteria 1301
141 Ga0466963_0304781 3300044694 Bacteria 1121
142 Ga0466970_0038464 3300044765 Bacteria 2537
143 Ga0466970_0073000 3300044765 Bacteria 1846
144 Ga0466970_0099695 3300044765 Bacteria 1581
145 Ga0466957_0037964 3300044842 Bacteria 2901
146 Ga0466957_0050230 3300044842 Bacteria 2538
147 Ga0466960_0247307 3300044901 Bacteria 989
148 Ga0466959_0052709 3300045049 Bacteria 2978
149 Ga0466959_0223406 3300045049 Bacteria 1305
150 Ga0466967_0506050 3300045976 Bacteria 1186
151 Ga0495590_0000091 3300046457 Bacteria 55288
152 Ga0495650_0000211 3300046471 Bacteria 125248
153 Ga0495672_0022559 3300047320 Bacteria 4090
154 Ga0495672_0063499 3300047320 Bacteria 2119
155 Ga0496100_0143344 3300048903 Bacteria 1696
156 Ga0496102_0029611 3300048905 Bacteria 4900
157 Ga0496102_0613063 3300048905 Bacteria 1011
158 Ga0496103_0007844 3300048906 Bacteria 6345
159 Ga0496104_0047744 3300048907 Bacteria 4036
160 Ga0496104_0204064 3300048907 Bacteria 1888
161 Ga0496105_0066260 3300048908 Bacteria 2981
162 Ga0496107_0086229 3300048910 Bacteria 2292
163 Ga0496114_0036324 3300048917 Bacteria 4072
164 Ga0496114_0080296 3300048917 Bacteria 2754
165 Ga0496115_0028473 3300048918 Bacteria 4379
166 Ga0496115_0124841 3300048918 Bacteria 2120
167 Ga0496115_0174848 3300048918 Bacteria 1775
168 Ga0496116_0098782 3300048919 Bacteria 1750
169 Ga0496117_0000174 3300048920 Bacteria 132648
170 Ga0496117_0000964 3300048920 Bacteria 44066
171 Ga0496117_0000988 3300048920 Bacteria 43571
172 Ga0496117_0010998 3300048920 Bacteria 8147
173 Ga0496117_0011054 3300048920 Bacteria 8128
174 Ga0496117_0032545 3300048920 Bacteria 3960
175 Ga0496117_0052738 3300048920 Bacteria 2862
176 Ga0496117_0110585 3300048920 Bacteria 1712
177 Ga0496117_0166409 3300048920 Bacteria 1285
178 Ga0496118_0001023 3300048921 Bacteria 43511
179 Ga0496118_0012972 3300048921 Bacteria 7934
180 Ga0496118_0028229 3300048921 Bacteria 4732
181 Ga0496118_0036785 3300048921 Bacteria 3951
182 Ga0496118_0037274 3300048921 Bacteria 3917
183 Ga0496118_0046371 3300048921 Bacteria 3382
184 Ga0496119_0001425 3300048922 Bacteria 28914
185 Ga0496119_0004747 3300048922 Bacteria 13353
186 Ga0496119_0005538 3300048922 Bacteria 12031
187 Ga0496119_0005866 3300048922 Bacteria 11594
188 Ga0496119_0016295 3300048922 Bacteria 5665
189 Ga0496119_0026116 3300048922 Bacteria 4058
190 Ga0496119_0053427 3300048922 Bacteria 2468
191 Ga0496119_0064734 3300048922 Bacteria 2169
192 Ga0496120_0001113 3300048923 Bacteria 34863
193 Ga0496120_0004584 3300048923 Bacteria 11506
194 Ga0496120_0008857 3300048923 Bacteria 7217
195 Ga0496120_0014330 3300048923 Bacteria 5291
196 Ga0496120_0021735 3300048923 Bacteria 4048
197 Ga0496120_0027182 3300048923 Bacteria 3524
198 Ga0496120_0044676 3300048923 Bacteria 2572
199 Ga0496121_0000046 3300048924 Bacteria 335942
200 Ga0496121_0041971 3300048924 Bacteria 3988
201 Ga0496121_0094095 3300048924 Bacteria 2332
202 Ga0496121_0095367 3300048924 Bacteria 2312
203 Ga0496122_0000071 3300048925 Bacteria 222537
204 Ga0496122_0000235 3300048925 Bacteria 124769
205 Ga0496122_0001637 3300048925 Bacteria 34821
206 Ga0496122_0123911 3300048925 Bacteria 1659
207 Ga0496122_0165277 3300048925 Bacteria 1343
208 Ga0496123_0000006 3300048926 Bacteria 647258
209 Ga0496123_0000036 3300048926 Bacteria 265722
210 Ga0496123_0042348 3300048926 Bacteria 3143
211 Ga0496124_0000323 3300048927 Bacteria 88352
212 Ga0496124_0006954 3300048927 Bacteria 12152
213 Ga0496125_0015829 3300048928 Bacteria 7266
214 Ga0496126_0002769 3300048929 Bacteria 23107
215 Ga0496126_0038102 3300048929 Bacteria 4475
216 Ga0496126_0185990 3300048929 Bacteria 1762
217 Ga0501031_0004291 3300049568 Bacteria 9220
218 Ga0501031_0036199 3300049568 Bacteria 3220
219 Ga0501032_0050649 3300049569 Bacteria 2800
220 Ga0501032_0059247 3300049569 Bacteria 2570
221 Ga0501032_0153001 3300049569 Bacteria 1516
222 Ga0501033_0008500 3300049570 Bacteria 7944
223 Ga0501033_0029502 3300049570 Bacteria 4122
224 Ga0501033_0062414 3300049570 Bacteria 2744
225 Ga0501033_0107671 3300049570 Bacteria 2030
226 Ga0501033_0189576 3300049570 Bacteria 1472
227 Ga0501034_0002837 3300049571 Bacteria 20198
228 Ga0501034_0035337 3300049571 Bacteria 5066
229 Ga0501034_0049941 3300049571 Bacteria 4220
230 Ga0501034_0066419 3300049571 Bacteria 3620
231 Ga0501034_0067572 3300049571 Bacteria 3586
232 Ga0501034_0104109 3300049571 Bacteria 2831
233 Ga0501034_0144109 3300049571 Bacteria 2360
234 Ga0501034_0148422 3300049571 Bacteria 2321
235 Ga0501034_0319702 3300049571 Bacteria 1485
236 Ga0501036_0035942 3300049572 Bacteria 4192
237 Ga0501037_0001056 3300049573 Bacteria 20390
238 Ga0501037_0084604 3300049573 Bacteria 2297
239 Ga0501037_0114478 3300049573 Bacteria 1941
240 Ga0501037_0130757 3300049573 Bacteria 1800
241 Ga0501037_0131877 3300049573 Bacteria 1792
242 Ga0501037_0157727 3300049573 Bacteria 1619
243 Ga0501037_0340940 3300049573 Bacteria 1035
244 Ga0501038_0021966 3300049574 Bacteria 5723
245 Ga0501038_0072159 3300049574 Bacteria 2926
246 Ga0501038_0148504 3300049574 Bacteria 1912
247 Ga0501038_0462772 3300049574 Bacteria 974
248 Ga0501039_0361517 3300049575 Bacteria 1140
249 Ga0501042_0007500 3300049578 Bacteria 7149
250 Ga0501043_0001586 3300049579 Bacteria 19754
251 Ga0501043_0034912 3300049579 Bacteria 3955
252 Ga0501043_0180566 3300049579 Bacteria 1644
253 Ga0501046_0031040 3300049580 Bacteria 4334
254 Ga0501046_0049498 3300049580 Bacteria 3323
255 Ga0501047_0006847 3300049581 Bacteria 10709
256 Ga0501047_0021788 3300049581 Bacteria 6153
257 Ga0501047_0065962 3300049581 Bacteria 3489
258 Ga0501047_0070058 3300049581 Bacteria 3376
259 Ga0501047_0155844 3300049581 Bacteria 2158
260 Ga0501048_0007540 3300049582 Bacteria 8245
261 Ga0501067_0070493 3300049583 Bacteria 1936
262 Ga0501068_0128710 3300049584 Bacteria 1582
263 Ga0501069_0024065 3300049585 Bacteria 3322
264 Ga0501069_0156016 3300049585 Bacteria 1313
265 Ga0501070_0000407 3300049586 Bacteria 39131
266 Ga0501070_0061984 3300049586 Bacteria 3098
267 Ga0501070_0419550 3300049586 Bacteria 1081
268 Ga0501072_0029509 3300049588 Bacteria 4285
269 Ga0501073_0011248 3300049589 Bacteria 6547
270 Ga0501073_0038283 3300049589 Bacteria 3403
271 Ga0501077_0267048 3300049593 Bacteria 1088
272 Ga0501080_0010478 3300049742 Bacteria 8488
273 Ga0501080_0048839 3300049742 Bacteria 3937
274 Ga0501083_0000178 3300049744 Bacteria 41100
275 Ga0501083_0010591 3300049744 Bacteria 6492
276 Ga0501083_0016310 3300049744 Bacteria 5202
277 Ga0501035_0002897 3300049822 Bacteria 16522
278 Ga0501035_0044463 3300049822 Bacteria 3999
279 Ga0501035_0049454 3300049822 Bacteria 3767
280 Ga0501035_0060481 3300049822 Bacteria 3372
281 Ga0501035_0196966 3300049822 Bacteria 1730
282 Ga0501044_0002388 3300049823 Bacteria 21404
283 Ga0501044_0033799 3300049823 Bacteria 5369
284 Ga0501044_0193892 3300049823 Bacteria 1992
285 Ga0501044_0292519 3300049823 Bacteria 1560
286 Ga0501044_0420702 3300049823 Bacteria 1246
287 nmdc:mga00v17_28267_c1 3300050491 Bacteria 3283
288 nmdc:mga00v17_43141_c1 3300050491 Bacteria 2715
289 nmdc:mga0yw44_13884_c1 3300050492 Bacteria 4257
290 nmdc:mga0sz30_8410_c1 3300050516 Bacteria 3897
291 Ga0500635_0000241 3300053080 Bacteria 23974
292 Ga0500651_0000692 3300053093 Bacteria 16729
293 Ga0500556_0000133 3300053104 Bacteria 63387
294 Ga0500559_0000534 3300053136 Bacteria 26496
295 Ga0500559_0004644 3300053136 Bacteria 6477
296 Ga0500568_0000007 3300053139 Bacteria 292579
297 Ga0500568_0000099 3300053139 Bacteria 80197
298 Ga0500568_0003779 3300053139 Bacteria 8288
299 Ga0500568_0006347 3300053139 Bacteria 5945
300 Ga0500573_0000005 3300053140 Bacteria 315762
301 Ga0500573_0001951 3300053140 Bacteria 10078
302 Ga0500573_0162087 3300053140 Bacteria 1216
303 Ga0500573_0202246 3300053140 Bacteria 1053
304 Ga0500588_0009258 3300053146 Bacteria 2336
305 Ga0500590_002660 3300053148 Bacteria 8024
306 Ga0500604_0002879 3300053151 Unclassified 4663
307 Ga0500616_0000010 3300053153 Bacteria 761410
308 Ga0500616_0000807 3300053153 Bacteria 35698
309 Ga0500620_000019 3300053155 Bacteria 32857
310 Ga0500645_004661 3300053730 Bacteria 5219
311 2537900490 2537561592 Bacteria 4348607
312 2583152010 2582580736 Bacteria 5325865
313 2587861917 2585428094 Bacteria 3604039
314 2588107466 2585428157 Bacteria 3018951
315 2643751847 2643221546 Bacteria 2910897
316 2643847306 2643221566 Bacteria 3460379
317 2643997272 2643221597 Bacteria 3347721
318 2644181879 2643221632 Bacteria 3406696
319 2644280203 2643221649 Bacteria 3867359
320 2753300546 2751185788 Bacteria 4541048
321 2758225432 2757320536 Bacteria 3629334
322 2774379567 2773857758 Bacteria 3592392
323 2844844280 2844841374 Bacteria 3917147
324 2844853594 2844852863 Bacteria 3849151
325 2856746860 2856741275 Bacteria 8096094
326 2857730683 2857729791 Bacteria 4040535
327 2857735031 2857733635 Bacteria 3532004
328 2891565128 2891562705 Bacteria 8039471
329 2904502425 2904501621 Bacteria 3401437
330 2904512948 2904509784 Bacteria 3520416
331 2906802839 2906799679 Bacteria 4031749
332 2908677436 2908674828 Bacteria 3382763
333 2908679410 2908678064 Bacteria 3482747
334 2917739061 2917736166 Bacteria 9690793
335 2919045253 2919042368 Bacteria 3905917
336 2919056246 2919055335 Bacteria 3875751
337 2919070049 2919069694 Bacteria 3622919
338 2919526248 2919523602 Bacteria 3788128
339 2928106912 2928104781 Bacteria 3877447
340 2928154375 2928153084 Bacteria 4020257
341 2928503607 2928500415 Bacteria 3384541
342 2939661447 2939660829 Bacteria 3784848
343 2966922881 2966921586 Bacteria 3092803
344 2974295623 2974294766 Bacteria 3767688
345 2974324574 2974324384 Bacteria 3750535
346 2977229607 2977228692 Bacteria 3450105
347 2977238345 2977236895 Bacteria 3569373
348 2977264871 2977264416 Bacteria 3750737
349 2984543873 2984542743 Bacteria 3569378
350 2984552659 2984551494 Bacteria 3877562
351 8004212943 8004212874 Bacteria 2861420
352 8016255847 8016254467 Bacteria 3797036
353 8056040393 8056037122 Bacteria 3854319
354 8057346576 8057345674 Bacteria 4160394
355 Ga0501033_0010186
356 JGI24735J21928_10004858
357 JGI25164J39214_1000397
358 JGI25165J46597_1000005
359 rootL2_10062257
360 Ga0006562J51391_1006080
361 Ga0006562J51391_1006082
362 Ga0055539_1000014
363 Ga0055533_1000002
364 Ga0055525_1000421
365 Ga0055525_1001814
366 Ga0055527_1000004
367 Ga0055542_1000019
368 Ga0055529_1000008
369 Ga0070658_10000298
370 Ga0070658_10035237
371 Ga0070658_10039424
372 Ga0070658_10055107
373 Ga0070690_100045890
374 Ga0070682_100044876
375 Ga0070682_100083837
376 Ga0068868_100377852
377 Ga0070660_100042247
378 Ga0070660_100413854
379 Ga0070661_100103383
380 Ga0070659_100000783
381 Ga0070659_100062048
382 Ga0070667_100032534
383 Ga0070714_100005110
384 Ga0070713_100624238
385 Ga0070685_10012833
386 Ga0068853_100011464
387 Ga0068853_100108666
388 Ga0070672_100129148
389 Ga0068855_100010920
390 Ga0068855_100182336
391 Ga0068857_100010949
392 Ga0068854_100299106
393 Ga0068852_100106792
394 Ga0068852_100107538
395 Ga0068859_100071413
396 Ga0068858_100000867
397 Ga0075365_10002458
398 Ga0075365_10005786
399 Ga0075369_10022083
400 Ga0097620_100071411
401 Ga0105244_10035749
402 Ga0105240_10011822
403 Ga0105240_10292597
404 Ga0105245_10004196
405 Ga0105247_10013352
406 Ga0105243_10080277
407 Ga0105241_10002520
408 Ga0105248_10007269
409 Ga0105237_10100332
410 Ga0105237_10100854
411 Ga0105238_10136855
412 Ga0157371_10086687
413 Ga0157370_10097567
414 Ga0157369_10026412
415 Ga0157369_10084741
416 Ga0157369_10240299
417 Ga0157369_10399219
418 Ga0157374_10582799
419 Ga0157372_10577232
420 Ga0157379_10019290
421 Ga0206354_10047148
422 Ga0206353_10036517
423 Ga0206353_11454628
424 Ga0209566_100056
425 Ga0209674_100001
426 Ga0209672_100011
427 Ga0209563_100001
428 Ga0209563_100335
429 Ga0207427_100024
430 Ga0209437_100243
431 Ga0209258_102049
432 Ga0209677_100001
433 Ga0209677_101216
434 Ga0209148_1000023
435 Ga0209148_1000931
436 Ga0209233_1000001
437 Ga0209455_1000023
438 Ga0209455_1000565
439 Ga0207655_1004351
440 Ga0207655_1024450
441 Ga0207647_10004822
442 Ga0207705_10000001
443 Ga0207705_10166882
444 Ga0207654_10000001
445 Ga0207695_10001965
446 Ga0207695_10114224
447 Ga0207695_10383851
448 Ga0207671_10082894
449 Ga0207671_10128664
450 Ga0207657_10096560
451 Ga0207694_10080900
452 Ga0207687_10018338
453 Ga0207700_10020137
454 Ga0207664_10002066
455 Ga0207690_10000713
456 Ga0207709_10004264
457 Ga0207691_10320742
458 Ga0207711_10012169
459 Ga0207711_10183693
460 Ga0207667_10003872
461 Ga0207667_10020205
462 Ga0207667_10029884
463 Ga0207658_10032533
464 Ga0207703_10000121
465 Ga0207639_10025875
466 Ga0207639_10106852
467 Ga0207678_10019846
468 Ga0207702_10094742
469 Ga0207702_10259014
470 Ga0207702_10321066
471 Ga0207674_10004042
472 Ga0207698_10005350
473 Ga0207698_10058374
474 Ga0307513_10025493
475 Ga0307514_10126020
476 Ga0307518_10177682
477 Ga0307416_100126040
478 Ga0307507_10005233
479 Ga0395899_0013247
480 Ga0395899_0025711
481 Ga0395900_0001470
482 Ga0395900_0053053
483 Ga0395898_0000355
484 Ga0395898_0610244
485 Ga0395901_0299355
486 Ga0439465_0032346
487 Ga0451791_1705021
488 Ga0439462_0005836
489 Ga0466965_0000004
490 Ga0466965_0154196
491 Ga0466961_0010348
492 Ga0466961_0148193
493 Ga0466961_0181630
494 Ga0466961_0182917
495 Ga0466963_0304781
496 Ga0466970_0038464
497 Ga0466970_0073000
498 Ga0466970_0099695
499 Ga0466957_0037964
500 Ga0466957_0050230
501 Ga0466960_0247307
502 Ga0466959_0052709
503 Ga0466959_0223406
504 Ga0466967_0506050
505 Ga0495590_0000091
506 Ga0495650_0000211
507 Ga0495672_0022559
508 Ga0495672_0063499
509 Ga0496100_0143344
510 Ga0496102_0029611
511 Ga0496102_0613063
512 Ga0496103_0007844
513 Ga0496104_0047744
514 Ga0496104_0204064
515 Ga0496105_0066260
516 Ga0496107_0086229
517 Ga0496114_0036324
518 Ga0496114_0080296
519 Ga0496115_0028473
520 Ga0496115_0124841
521 Ga0496115_0174848
522 Ga0496116_0098782
523 Ga0496117_0000174
524 Ga0496117_0000964
525 Ga0496117_0000988
526 Ga0496117_0010998
527 Ga0496117_0011054
528 Ga0496117_0032545
529 Ga0496117_0052738
530 Ga0496117_0110585
531 Ga0496117_0166409
532 Ga0496118_0001023
533 Ga0496118_0012972
534 Ga0496118_0028229
535 Ga0496118_0036785
536 Ga0496118_0037274
537 Ga0496118_0046371
538 Ga0496119_0001425
539 Ga0496119_0004747
540 Ga0496119_0005538
541 Ga0496119_0005866
542 Ga0496119_0016295
543 Ga0496119_0026116
544 Ga0496119_0053427
545 Ga0496119_0064734
546 Ga0496120_0001113
547 Ga0496120_0004584
548 Ga0496120_0008857
549 Ga0496120_0014330
550 Ga0496120_0021735
551 Ga0496120_0027182
552 Ga0496120_0044676
553 Ga0496121_0000046
554 Ga0496121_0041971
555 Ga0496121_0094095
556 Ga0496121_0095367
557 Ga0496122_0000071
558 Ga0496122_0000235
559 Ga0496122_0001637
560 Ga0496122_0123911
561 Ga0496122_0165277
562 Ga0496123_0000006
563 Ga0496123_0000036
564 Ga0496123_0042348
565 Ga0496124_0000323
566 Ga0496124_0006954
567 Ga0496125_0015829
568 Ga0496126_0002769
569 Ga0496126_0038102
570 Ga0496126_0185990
571 Ga0501031_0004291
572 Ga0501031_0036199
573 Ga0501032_0050649
574 Ga0501032_0059247
575 Ga0501032_0153001
576 Ga0501033_0008500
577 Ga0501033_0029502
578 Ga0501033_0062414
579 Ga0501033_0107671
580 Ga0501033_0189576
581 Ga0501034_0002837
582 Ga0501034_0035337
583 Ga0501034_0049941
584 Ga0501034_0066419
585 Ga0501034_0067572
586 Ga0501034_0104109
587 Ga0501034_0144109
588 Ga0501034_0148422
589 Ga0501034_0319702
590 Ga0501036_0035942
591 Ga0501037_0001056
592 Ga0501037_0084604
593 Ga0501037_0114478
594 Ga0501037_0130757
595 Ga0501037_0131877
596 Ga0501037_0157727
597 Ga0501037_0340940
598 Ga0501038_0021966
599 Ga0501038_0072159
600 Ga0501038_0148504
601 Ga0501038_0462772
602 Ga0501039_0361517
603 Ga0501042_0007500
604 Ga0501043_0001586
605 Ga0501043_0034912
606 Ga0501043_0180566
607 Ga0501046_0031040
608 Ga0501046_0049498
609 Ga0501047_0006847
610 Ga0501047_0021788
611 Ga0501047_0065962
612 Ga0501047_0070058
613 Ga0501047_0155844
614 Ga0501048_0007540
615 Ga0501067_0070493
616 Ga0501068_0128710
617 Ga0501069_0024065
618 Ga0501069_0156016
619 Ga0501070_0000407
620 Ga0501070_0061984
621 Ga0501070_0419550
622 Ga0501072_0029509
623 Ga0501073_0011248
624 Ga0501073_0038283
625 Ga0501077_0267048
626 Ga0501080_0010478
627 Ga0501080_0048839
628 Ga0501083_0000178
629 Ga0501083_0010591
630 Ga0501083_0016310
631 Ga0501035_0002897
632 Ga0501035_0044463
633 Ga0501035_0049454
634 Ga0501035_0060481
635 Ga0501035_0196966
636 Ga0501044_0002388
637 Ga0501044_0033799
638 Ga0501044_0193892
639 Ga0501044_0292519
640 Ga0501044_0420702
641 nmdc:mga00v17_28267_c1
642 nmdc:mga00v17_43141_c1
643 nmdc:mga0yw44_13884_c1
644 nmdc:mga0sz30_8410_c1
645 Ga0500635_0000241
646 Ga0500651_0000692
647 Ga0500556_0000133
648 Ga0500559_0000534
649 Ga0500559_0004644
650 Ga0500568_0000007
651 Ga0500568_0000099
652 Ga0500568_0003779
653 Ga0500568_0006347
654 Ga0500573_0000005
655 Ga0500573_0001951
656 Ga0500573_0162087
657 Ga0500573_0202246
658 Ga0500588_0009258
659 Ga0500590_002660
660 Ga0500604_0002879
661 Ga0500616_0000010
662 Ga0500616_0000807
663 Ga0500620_000019
664 Ga0500645_004661
665 2537900490
666 2583152010
667 2587861917
668 2588107466
669 2643751847
670 2643847306
671 2643997272
672 2644181879
673 2644280203
674 2753300546
675 2758225432
676 2774379567
677 2844844280
678 2844853594
679 2856746860
680 2857730683
681 2857735031
682 2891565128
683 2904502425
684 2904512948
685 2906802839
686 2908677436
687 2908679410
688 2917739061
689 2919045253
690 2919056246
691 2919070049
692 2919526248
693 2928106912
694 2928154375
695 2928503607
696 2939661447
697 2966922881
698 2974295623
699 2974324574
700 2977229607
701 2977238345
702 2977264871
703 2984543873
704 2984552659
705 8004212943
706 8016255847
707 8056040393
708 8057346576

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

45

191

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nq2-assembly1.cif.gz_D an inward-facing conformation of a putative metal-chelate type abc transporter. 0.914 16 247
2nq2-assembly1.cif.gz_C an inward-facing conformation of a putative metal-chelate type abc transporter. 0.9022 15 247
7kyo-assembly1.cif.gz_B psabc from streptococcus pneumoniae in complex with fab 0.8836 18 250
5b57-assembly1.cif.gz_C inward-facing conformation of abc heme importer bhuuv from burkholderia cenocepacia 0.8831 18 247
2ihy-assembly1.cif.gz_A structure of the staphylococcus aureus putative atpase subunit of an atp-binding cassette (abc) transporter 0.8803 15 247
ID Description Score Start End Superfamily
af_Q58283_1_248_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9089 18 250 3.40.50.300
af_Q2G1L8_1_252_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9059 15 247 3.40.50.300
2nq2C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9022 15 247 3.40.50.300
af_Q2FWA1_1_260_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9001 17 247 3.40.50.300
af_P0A9X1_1_228_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8967 15 244 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A5R9AMN4-F1-model_v4 Metal ABC transporter ATP-binding protein 0.9338 16 231 GO:0005524
GO:0016887
AF-A0A1H5GCX7-F1-model_v4 Iron complex transport system ATP-binding protein 0.9214 18 247 GO:0005524
GO:0016887
AF-A0A7X3RY25-F1-model_v4 Heme ABC transporter ATP-binding protein 0.9168 16 247 GO:0005524
GO:0016887
AF-A0A6P1MAD8-F1-model_v4 ATP-binding cassette domain-containing protein 0.9149 15 248 GO:0005524
GO:0016887
AF-A0A535BEJ5-F1-model_v4 ABC transporter ATP-binding protein 0.9148 15 247 GO:0004842
GO:0005524
GO:0016567
GO:0016887

Map