F419934

General Info

Members Datasets Scaffolds Average Seq Length
354 222 343 301

Family's Representative Sequence

Representative Sequence 3300053087|Ga0500643_005255|Ga0500643_005255_645_1685
Length 346
Sequence VTDATLPPPPEPGERLPLDPDDAVLAEAEAAVDALEAHLDLAPLDRARRVLFLHAHPDDEAIGTGATMATYAADGALVTLVTCTLGEEGEVLVPELAHLASDRDDALGPHRIGELATAMEALGVTDHRFLGGPGRWRDSGMMGTPQNDRPDSFWQAGLDEPVRALVQVMREVRPQVVVTYDPNGGYGHPDHIQVHRVGTAAFERCGDEAYAPELGEPWRPTKLYWTALPKSVLWEGHLAMQAQGASLFGEVESVEDLPMGTPDDEVTTCIDGRDQLDAKIAAMRAYPTQIAVDGPFFALADNVGHRAFGFEYFTLVRGPRGTAVAADGREADLFGGLPEGLDSPTG

Samples

Sample ID Description Type Environment
1 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
2 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
3 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
4 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
5 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
6 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
7 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
8 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
9 2867475112 Streptomyces sp. TM32 Isolate Unclassified
10 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
11 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
12 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
34 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
54 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
55 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
75 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
76 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
77 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
78 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
79 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
80 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
81 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
82 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
83 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
84 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
85 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
86 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
87 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
88 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
89 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
90 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
91 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
92 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
93 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
94 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
95 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
96 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
97 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
98 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
99 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
106 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
107 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
108 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
109 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
110 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
111 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
112 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
113 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
114 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
115 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
116 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
117 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
118 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
119 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
120 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
121 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
122 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
123 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
124 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
125 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
126 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
127 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
128 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
129 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
130 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
131 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
132 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
133 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
134 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
135 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
136 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
137 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
138 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
139 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
140 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
141 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
142 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
143 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
144 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
145 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
146 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
147 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
148 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
149 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
150 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
151 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
152 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
153 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
154 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
155 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
156 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
157 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
175 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
176 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
177 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
193 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
194 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
195 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
196 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
197 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
198 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
199 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
200 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
201 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
202 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
205 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
214 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
215 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
216 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
217 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
218 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
219 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
220 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
221 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
222 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.05
Metatranscriptomes 0.85
Isolates 3.11

Biome Distribution

Category Percentage (%)
Aerial Root 0.28
Bulb 0
Endosphere 0.85
Nodule 0
Rhizoplane 8.47
Rhizosphere 87.01
Stem 0
Stem Tuber 0
Unclassified 3.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10019038 3300001979 Bacteria 2424
2 rootH2_10072207 3300003320 Bacteria 5067
3 Ga0070658_10013567 3300005327 Bacteria 6537
4 Ga0070680_100010301 3300005336 Bacteria 7206
5 Ga0070667_100003044 3300005367 Bacteria 14411
6 Ga0070709_10192554 3300005434 Bacteria 1439
7 Ga0070714_100005487 3300005435 Bacteria 9681
8 Ga0070714_100130429 3300005435 Bacteria 2246
9 Ga0070713_100092110 3300005436 Bacteria 2609
10 Ga0070713_100124626 3300005436 Bacteria 2264
11 Ga0070710_10009369 3300005437 Bacteria 4789
12 Ga0070711_100083062 3300005439 Bacteria 2287
13 Ga0070663_100279444 3300005455 Bacteria 1330
14 Ga0070681_10002907 3300005458 Bacteria 15849
15 Ga0070706_100019026 3300005467 Bacteria 6335
16 Ga0070707_100000946 3300005468 Bacteria 28820
17 Ga0070707_100059801 3300005468 Bacteria 3654
18 Ga0070698_100000287 3300005471 Bacteria 51413
19 Ga0070679_100029082 3300005530 Bacteria 5451
20 Ga0070696_100227458 3300005546 Bacteria 1402
21 Ga0070665_100118981 3300005548 Bacteria 2644
22 Ga0068855_100123491 3300005563 Bacteria 2962
23 Ga0068856_100040880 3300005614 Bacteria 4555
24 Ga0068856_100042465 3300005614 Bacteria 4473
25 Ga0081455_10006398 3300005937 Bacteria 12643
26 Ga0081455_10008676 3300005937 Bacteria 10529
27 Ga0081538_10001112 3300005981 Bacteria 28483
28 Ga0081540_1004774 3300005983 Bacteria 10229
29 Ga0070717_10120377 3300006028 Bacteria 2248
30 Ga0070715_10007255 3300006163 Bacteria 3811
31 Ga0070716_100003641 3300006173 Bacteria 7284
32 Ga0070712_100076825 3300006175 Bacteria 2405
33 Ga0075428_100034900 3300006844 Bacteria 5545
34 Ga0075428_100120180 3300006844 Bacteria 2860
35 Ga0075433_10027523 3300006852 Bacteria 4823
36 Ga0068865_100189570 3300006881 Bacteria 1589
37 Ga0105240_10804878 3300009093 Bacteria 1018
38 Ga0111539_10062919 3300009094 Bacteria 4391
39 Ga0105245_10020911 3300009098 Bacteria 5738
40 Ga0105245_10049948 3300009098 Bacteria 3747
41 Ga0114129_10003905 3300009147 Bacteria 21040
42 Ga0114129_10028769 3300009147 Bacteria 7873
43 Ga0105242_10488568 3300009176 Bacteria 1168
44 Ga0105238_10540310 3300009551 Bacteria 1169
45 Ga0157372_10664850 3300013307 Bacteria 1213
46 Ga0157375_10038356 3300013308 Bacteria 4600
47 Ga0206354_10682863 3300020081 Bacteria 12298
48 Ga0206353_10165729 3300020082 Bacteria 21921
49 Ga0224712_10010039 3300022467 Bacteria 2878
50 Ga0209758_1004520 3300025297 Bacteria 11527
51 Ga0207426_1002587 3300025302 Bacteria 11246
52 Ga0207699_10003064 3300025906 Bacteria 7938
53 Ga0207699_10121557 3300025906 Bacteria 1689
54 Ga0207705_10010741 3300025909 Bacteria 6647
55 Ga0207684_10005860 3300025910 Bacteria 11253
56 Ga0207684_10008251 3300025910 Bacteria 9273
57 Ga0207707_10017671 3300025912 Bacteria 6220
58 Ga0207693_10310923 3300025915 Bacteria 1234
59 Ga0207660_10013593 3300025917 Bacteria 5337
60 Ga0207652_10001309 3300025921 Bacteria 22123
61 Ga0207646_10000136 3300025922 Bacteria 100383
62 Ga0207646_10061512 3300025922 Bacteria 3351
63 Ga0207687_10241173 3300025927 Bacteria 1432
64 Ga0207700_10007701 3300025928 Bacteria 6614
65 Ga0207700_10090080 3300025928 Bacteria 2419
66 Ga0207664_10004832 3300025929 Bacteria 9162
67 Ga0207664_10024966 3300025929 Bacteria 4495
68 Ga0207664_10635647 3300025929 Bacteria 959
69 Ga0207704_10139696 3300025938 Bacteria 1692
70 Ga0207665_10000965 3300025939 Bacteria 19469
71 Ga0207661_10606771 3300025944 Bacteria 1005
72 Ga0207667_10102387 3300025949 Bacteria 2954
73 Ga0207678_10123249 3300026067 Bacteria 2212
74 Ga0207702_10092159 3300026078 Bacteria 2655
75 Ga0207702_10096498 3300026078 Bacteria 2600
76 Ga0207702_10145813 3300026078 Bacteria 2148
77 Ga0207428_10293437 3300027907 Bacteria 1204
78 Ga0268266_10091669 3300028379 Bacteria 2665
79 Ga0307511_10114607 3300030521 Bacteria 1698
80 Ga0307408_100138795 3300031548 Bacteria 1906
81 Ga0307508_10078537 3300031616 Bacteria 2881
82 Ga0316575_10003475 3300031665 Bacteria 5439
83 Ga0316579_10005829 3300031691 Bacteria 4994
84 Ga0316576_10001107 3300031727 Bacteria 14072
85 Ga0316576_10012088 3300031727 Bacteria 5692
86 Ga0316576_10031549 3300031727 Bacteria 3760
87 Ga0316577_10170625 3300031733 Bacteria 1227
88 Ga0307413_10382323 3300031824 Bacteria 1097
89 Ga0307416_100227420 3300032002 Bacteria 1795
90 Ga0307414_10377399 3300032004 Bacteria 1225
91 Ga0307411_10024379 3300032005 Bacteria 3606
92 Ga0307411_10118311 3300032005 Bacteria 1911
93 Ga0316583_10003013 3300032133 Bacteria 5919
94 Ga0316580_10002296 3300032139 Bacteria 5241
95 Ga0373934_0000029 3300035086 Bacteria 45560
96 Ga0373923_0034898 3300035111 Bacteria 2044
97 Ga0373953_0000039 3300035117 Bacteria 33975
98 Ga0373954_0007403 3300035118 Bacteria 4803
99 Ga0373956_0003608 3300035119 Bacteria 6246
100 Ga0373957_0000086 3300035120 Bacteria 21958
101 Ga0373955_0000012 3300035172 Bacteria 73957
102 Ga0316574_0015292 3300035398 Bacteria 4450
103 Ga0316574_0063248 3300035398 Bacteria 2327
104 Ga0373924_0001104 3300035410 Bacteria 8628
105 Ga0373933_0000032 3300035724 Bacteria 84625
106 Ga0373937_0000023 3300036401 Bacteria 127414
107 Ga0316582_0014395 3300036647 Bacteria 4487
108 Ga0373925_0009017 3300037068 Bacteria 7264
109 Ga0373925_0721855 3300037068 Unclassified 821
110 Ga0395899_0071355 3300037312 Bacteria 2541
111 Ga0395900_0006616 3300037418 Bacteria 12060
112 Ga0395900_0013396 3300037418 Bacteria 8378
113 Ga0395898_0081825 3300037466 Bacteria 3113
114 Ga0316581_0002417 3300037588 Bacteria 4462
115 Ga0395901_0016902 3300038443 Bacteria 7436
116 Ga0451855_0294732 3300041511 Bacteria 1089
117 Ga0466969_0040630 3300044656 Bacteria 2330
118 Ga0466965_0057215 3300044683 Bacteria 1943
119 Ga0466966_0002217 3300044684 Bacteria 12634
120 Ga0466966_0042738 3300044684 Bacteria 2907
121 Ga0466966_0065182 3300044684 Bacteria 2292
122 Ga0466961_0002096 3300044693 Bacteria 12421
123 Ga0466961_0028946 3300044693 Bacteria 3562
124 Ga0466961_0061949 3300044693 Bacteria 2377
125 Ga0466961_0073989 3300044693 Bacteria 2160
126 Ga0466961_0087580 3300044693 Bacteria 1967
127 Ga0466961_0144237 3300044693 Bacteria 1489
128 Ga0466961_0146194 3300044693 Bacteria 1478
129 Ga0466963_0279929 3300044694 Bacteria 1172
130 Ga0466971_0149032 3300044719 Bacteria 1091
131 Ga0466970_0032012 3300044765 Bacteria 2778
132 Ga0466970_0056275 3300044765 Bacteria 2102
133 Ga0466957_0010289 3300044842 Bacteria 5361
134 Ga0466960_0001394 3300044901 Bacteria 8805
135 Ga0466960_0017671 3300044901 Bacteria 3115
136 Ga0466959_0135022 3300045049 Bacteria 1747
137 Ga0466958_0018436 3300045836 Bacteria 4050
138 Ga0466958_0037070 3300045836 Bacteria 2921
139 Ga0466958_0038822 3300045836 Bacteria 2858
140 Ga0466958_0283483 3300045836 Bacteria 1062
141 Ga0466967_0002621 3300045976 Bacteria 11323
142 Ga0466967_0003184 3300045976 Bacteria 10586
143 Ga0466967_0005322 3300045976 Bacteria 8891
144 Ga0466967_0139153 3300045976 Bacteria 2260
145 Ga0495627_037794 3300046453 Bacteria 1496
146 Ga0495592_0000061 3300046454 Bacteria 99719
147 Ga0495592_0032895 3300046454 Bacteria 3911
148 Ga0495603_0152974 3300046455 Bacteria 1339
149 Ga0495629_0011963 3300046459 Bacteria 6292
150 Ga0495651_0000015 3300046462 Bacteria 127414
151 Ga0495651_0083485 3300046462 Bacteria 2408
152 Ga0495651_0097261 3300046462 Bacteria 2198
153 Ga0495653_0000927 3300046463 Bacteria 22687
154 Ga0495653_0191151 3300046463 Bacteria 1396
155 Ga0495580_0007809 3300046472 Bacteria 8566
156 Ga0495662_0000222 3300046476 Bacteria 23880
157 Ga0495662_0040255 3300046476 Bacteria 2257
158 Ga0495664_0006050 3300046477 Bacteria 6672
159 Ga0495585_0006351 3300046492 Bacteria 7342
160 Ga0495585_0066397 3300046492 Bacteria 1975
161 Ga0495594_0047801 3300046499 Bacteria 2350
162 Ga0495594_0126814 3300046499 Bacteria 1444
163 Ga0495596_0095369 3300046500 Bacteria 1155
164 Ga0495608_0000046 3300046511 Bacteria 99714
165 Ga0495608_0002656 3300046511 Bacteria 12835
166 Ga0495618_0050415 3300046514 Bacteria 2629
167 Ga0495628_0000272 3300046516 Bacteria 46316
168 Ga0495628_0000880 3300046516 Bacteria 27703
169 Ga0495628_0064546 3300046516 Bacteria 2866
170 Ga0495630_0430379 3300046517 Bacteria 1011
171 Ga0495666_0022973 3300046526 Bacteria 3086
172 Ga0495652_0000044 3300046529 Bacteria 123607
173 Ga0495652_0008754 3300046529 Bacteria 9211
174 Ga0495652_0071502 3300046529 Bacteria 2895
175 Ga0495665_0002034 3300046531 Bacteria 10951
176 Ga0495640_0008442 3300046533 Bacteria 8078
177 Ga0495640_0022013 3300046533 Bacteria 4667
178 Ga0495640_0069902 3300046533 Bacteria 2360
179 Ga0495586_0008637 3300046535 Bacteria 5423
180 Ga0495587_0000098 3300046536 Bacteria 67862
181 Ga0495587_0033913 3300046536 Bacteria 3079
182 Ga0495645_0002734 3300046543 Bacteria 11973
183 Ga0495645_0003143 3300046543 Bacteria 11195
184 Ga0495645_0181823 3300046543 Bacteria 1440
185 Ga0495622_0151754 3300046557 Bacteria 1048
186 Ga0495667_0000058 3300046559 Bacteria 99700
187 Ga0495667_0044258 3300046559 Bacteria 2948
188 Ga0495667_0095244 3300046559 Bacteria 1928
189 Ga0495634_0019220 3300046642 Bacteria 4856
190 Ga0495635_0070846 3300046663 Bacteria 2389
191 Ga0495657_0000030 3300046675 Bacteria 127400
192 Ga0495657_0014149 3300046675 Bacteria 5861
193 Ga0495599_0000041 3300046678 Bacteria 95695
194 Ga0495623_0000708 3300046679 Bacteria 22262
195 Ga0495623_0010850 3300046679 Bacteria 5897
196 Ga0495623_0015980 3300046679 Bacteria 4851
197 Ga0495646_0002405 3300046680 Bacteria 11485
198 Ga0495613_0004996 3300046689 Bacteria 9960
199 Ga0495613_0120409 3300046689 Bacteria 1885
200 Ga0495624_0031867 3300046690 Bacteria 3423
201 Ga0495600_0007771 3300046809 Bacteria 6564
202 Ga0495604_0000203 3300047317 Bacteria 54114
203 Ga0495604_0004414 3300047317 Bacteria 11134
204 Ga0495604_0061788 3300047317 Bacteria 2864
205 Ga0495604_0132423 3300047317 Bacteria 1791
206 Ga0495676_0011799 3300047321 Bacteria 7882
207 Ga0495680_0000051 3300047322 Bacteria 95695
208 Ga0495675_0000524 3300047444 Bacteria 24830
209 Ga0495675_0010129 3300047444 Bacteria 5881
210 Ga0495675_0021776 3300047444 Bacteria 4083
211 Ga0495675_0065634 3300047444 Bacteria 2295
212 Ga0495684_0012065 3300047471 Bacteria 6665
213 Ga0495602_0000071 3300048088 Bacteria 99698
214 Ga0496100_0334379 3300048903 Bacteria 1141
215 Ga0496101_0346431 3300048904 Bacteria 1167
216 Ga0496102_0354565 3300048905 Bacteria 1381
217 Ga0496103_0103257 3300048906 Bacteria 1806
218 Ga0496104_0002006 3300048907 Bacteria 17668
219 Ga0496104_0097075 3300048907 Bacteria 2820
220 Ga0496104_0235631 3300048907 Bacteria 1742
221 Ga0496105_0003839 3300048908 Bacteria 11215
222 Ga0496106_0020377 3300048909 Bacteria 4921
223 Ga0496107_0127051 3300048910 Bacteria 1881
224 Ga0496108_0027363 3300048911 Bacteria 4707
225 Ga0496108_0073008 3300048911 Bacteria 2897
226 Ga0496108_0229394 3300048911 Bacteria 1614
227 Ga0496108_0289278 3300048911 Bacteria 1427
228 Ga0496109_0020269 3300048912 Bacteria 5873
229 Ga0496109_0091136 3300048912 Bacteria 2819
230 Ga0496109_0229814 3300048912 Bacteria 1745
231 Ga0496110_0049598 3300048913 Bacteria 3683
232 Ga0496110_0235266 3300048913 Bacteria 1666
233 Ga0496110_0593847 3300048913 Bacteria 1005
234 Ga0496111_0005539 3300048914 Bacteria 8111
235 Ga0496111_0024094 3300048914 Bacteria 4281
236 Ga0496112_0011330 3300048915 Bacteria 8137
237 Ga0496113_0008369 3300048916 Bacteria 6739
238 Ga0496113_0021038 3300048916 Bacteria 4597
239 Ga0496113_0648151 3300048916 Bacteria 845
240 Ga0496114_0005981 3300048917 Bacteria 9577
241 Ga0496114_0025479 3300048917 Bacteria 4835
242 Ga0496115_0004997 3300048918 Bacteria 9633
243 Ga0496115_0146770 3300048918 Bacteria 1947
244 Ga0496119_0000125 3300048922 Bacteria 108373
245 Ga0496120_0021075 3300048923 Bacteria 4124
246 Ga0496124_0206819 3300048927 Bacteria 1488
247 Ga0501031_0014363 3300049568 Bacteria 5148
248 Ga0501031_0018964 3300049568 Bacteria 4479
249 Ga0501031_0052076 3300049568 Bacteria 2667
250 Ga0501032_0019019 3300049569 Bacteria 4806
251 Ga0501032_0042498 3300049569 Bacteria 3082
252 Ga0501032_0394262 3300049569 Bacteria 889
253 Ga0501033_0043444 3300049570 Bacteria 3347
254 Ga0501033_0111936 3300049570 Bacteria 1986
255 Ga0501034_0022456 3300049571 Bacteria 6430
256 Ga0501034_0059656 3300049571 Bacteria 3832
257 Ga0501034_0100436 3300049571 Bacteria 2887
258 Ga0501036_0009702 3300049572 Bacteria 7924
259 Ga0501036_0022982 3300049572 Bacteria 5249
260 Ga0501036_0123192 3300049572 Bacteria 2189
261 Ga0501037_0002695 3300049573 Bacteria 12826
262 Ga0501037_0044842 3300049573 Bacteria 3246
263 Ga0501037_0079707 3300049573 Bacteria 2377
264 Ga0501037_0082085 3300049573 Bacteria 2336
265 Ga0501038_0028687 3300049574 Bacteria 4943
266 Ga0501038_0081022 3300049574 Bacteria 2735
267 Ga0501038_0169212 3300049574 Bacteria 1770
268 Ga0501038_0220433 3300049574 Bacteria 1513
269 Ga0501039_0004330 3300049575 Bacteria 10704
270 Ga0501039_0076350 3300049575 Bacteria 2605
271 Ga0501040_0003541 3300049576 Bacteria 10094
272 Ga0501040_0014712 3300049576 Bacteria 5161
273 Ga0501040_0169255 3300049576 Bacteria 1547
274 Ga0501040_0304022 3300049576 Bacteria 1140
275 Ga0501041_0002505 3300049577 Bacteria 10455
276 Ga0501041_0037938 3300049577 Bacteria 2921
277 Ga0501042_0029857 3300049578 Bacteria 3845
278 Ga0501042_0094142 3300049578 Bacteria 2151
279 Ga0501043_0043259 3300049579 Bacteria 3540
280 Ga0501043_0047744 3300049579 Bacteria 3366
281 Ga0501043_0055268 3300049579 Bacteria 3118
282 Ga0501043_0064594 3300049579 Bacteria 2874
283 Ga0501046_0029328 3300049580 Bacteria 4472
284 Ga0501046_0245659 3300049580 Bacteria 1319
285 Ga0501047_0000064 3300049581 Bacteria 136110
286 Ga0501047_0000170 3300049581 Bacteria 79815
287 Ga0501047_0000336 3300049581 Bacteria 53637
288 Ga0501047_0003983 3300049581 Bacteria 13886
289 Ga0501047_0044310 3300049581 Bacteria 4298
290 Ga0501047_0124907 3300049581 Bacteria 2454
291 Ga0501048_0070296 3300049582 Bacteria 2472
292 Ga0501068_0023107 3300049584 Bacteria 3642
293 Ga0501069_0036184 3300049585 Bacteria 2721
294 Ga0501070_0015823 3300049586 Bacteria 6342
295 Ga0501070_0122660 3300049586 Bacteria 2148
296 Ga0501071_0000907 3300049587 Bacteria 16016
297 Ga0501071_0002285 3300049587 Bacteria 11553
298 Ga0501072_0002274 3300049588 Bacteria 14358
299 Ga0501072_0003081 3300049588 Bacteria 12571
300 Ga0501072_0060251 3300049588 Bacteria 2993
301 Ga0501073_0061493 3300049589 Bacteria 2620
302 Ga0501074_0024337 3300049590 Bacteria 4400
303 Ga0501074_0110497 3300049590 Bacteria 1967
304 Ga0501074_0311897 3300049590 Bacteria 1117
305 Ga0501075_0044779 3300049591 Bacteria 3320
306 Ga0501076_0013084 3300049592 Bacteria 6213
307 Ga0501198_017217 3300049649 Bacteria 1124
308 Ga0501079_0006767 3300049741 Bacteria 8623
309 Ga0501079_0122354 3300049741 Bacteria 2023
310 Ga0501080_0005295 3300049742 Bacteria 11490
311 Ga0501080_0075026 3300049742 Bacteria 3146
312 Ga0501081_0031489 3300049743 Bacteria 3594
313 Ga0501083_0029593 3300049744 Bacteria 3764
314 Ga0501035_0000762 3300049822 Bacteria 34623
315 Ga0501035_0027700 3300049822 Bacteria 5179
316 Ga0501044_0020285 3300049823 Bacteria 7093
317 Ga0501044_0099006 3300049823 Bacteria 2935
318 Ga0501044_0105783 3300049823 Bacteria 2826
319 Ga0501044_0136546 3300049823 Bacteria 2443
320 Ga0501044_0323241 3300049823 Bacteria 1467
321 Ga0501044_0392948 3300049823 Bacteria 1300
322 Ga0501045_0015609 3300049824 Bacteria 5389
323 Ga0501045_0079201 3300049824 Bacteria 2422
324 Ga0501045_0103772 3300049824 Bacteria 2106
325 nmdc:mga05p37_154123_c1 3300050507 Bacteria 2809
326 nmdc:mga05p37_8451_c1 3300050507 Bacteria 12175
327 nmdc:mga06r32_321980_c1 3300050510 Bacteria 1531
328 nmdc:mga08y16_48981_c1 3300050511 Bacteria 4421
329 nmdc:mga08x19_12875_c1 3300050514 Bacteria 5047
330 nmdc:mga0a205_31809_c1 3300050515 Bacteria 5058
331 Ga0495612_0023799 3300053078 Bacteria 2459
332 Ga0495655_0009818 3300053083 Bacteria 1869
333 Ga0495595_0002357 3300053084 Bacteria 7361
334 Ga0495619_0006329 3300053085 Bacteria 7510
335 Ga0500643_005255 3300053087 Bacteria 5622
336 Ga0501084_0024724 3300054114 Bacteria 5012
337 Ga0501084_0046849 3300054114 Bacteria 3621
338 Ga0501082_0004402 3300060353 Bacteria 12301
339 Ga0501082_0026992 3300060353 Bacteria 4947
340 Ga0466962_0043678 3300061719 Bacteria 2144
341 Ga0466962_0072498 3300061719 Bacteria 1646
342 Ga0466962_0094055 3300061719 Bacteria 1437
343 Ga0530510_0132991 3300061734 Bacteria 1830

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037068 Ga0373925_0721855 Ga0373925_0721855_22_786 243
2 3300005434 Ga0070709_10192554 Ga0070709_101925542 266
3 3300005435 Ga0070714_100130429 Ga0070714_1001304292 266
4 3300005436 Ga0070713_100124626 Ga0070713_1001246262 266
5 3300005437 Ga0070710_10009369 Ga0070710_100093693 266
6 3300005439 Ga0070711_100083062 Ga0070711_1000830622 266
7 3300005468 Ga0070707_100000946 Ga0070707_10000094622 266
8 3300005471 Ga0070698_100000287 Ga0070698_10000028726 266
9 3300005546 Ga0070696_100227458 Ga0070696_1002274581 266
10 3300005614 Ga0068856_100042465 Ga0068856_1000424652 266
11 3300006028 Ga0070717_10120377 Ga0070717_101203772 266
12 3300006163 Ga0070715_10007255 Ga0070715_100072552 266
13 3300006173 Ga0070716_100003641 Ga0070716_1000036412 266
14 3300006175 Ga0070712_100076825 Ga0070712_1000768253 266
15 3300025906 Ga0207699_10003064 Ga0207699_100030646 266
16 3300025910 Ga0207684_10005860 Ga0207684_100058607 266
17 3300025915 Ga0207693_10310923 Ga0207693_103109232 266
18 3300025922 Ga0207646_10000136 Ga0207646_1000013645 266
19 3300025928 Ga0207700_10007701 Ga0207700_100077012 266
20 3300025929 Ga0207664_10004832 Ga0207664_100048325 266
21 3300025939 Ga0207665_10000965 Ga0207665_1000096518 266
22 3300026078 Ga0207702_10092159 Ga0207702_100921593 266
23 3300037068 Ga0373925_0009017 Ga0373925_0009017_5333_6166 266
24 3300048905 Ga0496102_0354565 Ga0496102_0354565_244_1077 266
25 3300048907 Ga0496104_0002006 Ga0496104_0002006_2880_3713 266
26 3300048908 Ga0496105_0003839 Ga0496105_0003839_6404_7237 266
27 3300048909 Ga0496106_0020377 Ga0496106_0020377_688_1521 266
28 3300048911 Ga0496108_0027363 Ga0496108_0027363_371_1204 266
29 3300048912 Ga0496109_0020269 Ga0496109_0020269_3943_4776 266
30 3300048913 Ga0496110_0235266 Ga0496110_0235266_624_1457 266
31 3300048915 Ga0496112_0011330 Ga0496112_0011330_619_1452 266
32 3300048916 Ga0496113_0021038 Ga0496113_0021038_750_1583 266
33 3300048918 Ga0496115_0004997 Ga0496115_0004997_3127_3960 266
34 3300048916 Ga0496113_0648151 Ga0496113_0648151_14_829 268
35 3300032005 Ga0307411_10118311 Ga0307411_101183112 272
36 3300009176 Ga0105242_10488568 Ga0105242_104885682 273
37 3300049573 Ga0501037_0082085 Ga0501037_0082085_320_1216 274
38 3300049581 Ga0501047_0000064 Ga0501047_0000064_81860_82756 274
39 3300005548 Ga0070665_100118981 Ga0070665_1001189813 276
40 3300025929 Ga0207664_10635647 Ga0207664_106356471 276
41 3300028379 Ga0268266_10091669 Ga0268266_100916693 276
42 3300044684 Ga0466966_0042738 Ga0466966_0042738_55_954 277
43 3300044693 Ga0466961_0146194 Ga0466961_0146194_427_1326 277
44 3300045049 Ga0466959_0135022 Ga0466959_0135022_294_1193 277
45 3300049568 Ga0501031_0052076 Ga0501031_0052076_1333_2196 277
46 3300049569 Ga0501032_0042498 Ga0501032_0042498_1282_2145 277
47 3300049569 Ga0501032_0394262 Ga0501032_0394262_15_878 277
48 3300049571 Ga0501034_0100436 Ga0501034_0100436_513_1376 277
49 3300049573 Ga0501037_0044842 Ga0501037_0044842_1303_2166 277
50 3300049574 Ga0501038_0220433 Ga0501038_0220433_472_1335 277
51 3300049576 Ga0501040_0003541 Ga0501040_0003541_6931_7794 277
52 3300049578 Ga0501042_0094142 Ga0501042_0094142_187_1050 277
53 3300049579 Ga0501043_0055268 Ga0501043_0055268_1282_2145 277
54 3300049580 Ga0501046_0029328 Ga0501046_0029328_685_1548 277
55 3300049581 Ga0501047_0000336 Ga0501047_0000336_48283_49146 277
56 3300049585 Ga0501069_0036184 Ga0501069_0036184_1103_1966 277
57 3300049587 Ga0501071_0000907 Ga0501071_0000907_13642_14505 277
58 3300049588 Ga0501072_0003081 Ga0501072_0003081_10104_10967 277
59 3300049589 Ga0501073_0061493 Ga0501073_0061493_1073_1936 277
60 3300049590 Ga0501074_0024337 Ga0501074_0024337_1427_2290 277
61 3300049741 Ga0501079_0122354 Ga0501079_0122354_974_1837 277
62 3300049742 Ga0501080_0005295 Ga0501080_0005295_10114_10977 277
63 3300049744 Ga0501083_0029593 Ga0501083_0029593_1079_1942 277
64 3300049822 Ga0501035_0000762 Ga0501035_0000762_32506_33369 277
65 3300049823 Ga0501044_0136546 Ga0501044_0136546_925_1788 277
66 3300049823 Ga0501044_0392948 Ga0501044_0392948_399_1262 277
67 3300054114 Ga0501084_0024724 Ga0501084_0024724_2782_3645 277
68 3300060353 Ga0501082_0026992 Ga0501082_0026992_2739_3602 277
69 3300005937 Ga0081455_10006398 Ga0081455_100063985 279
70 3300046689 Ga0495613_0120409 Ga0495613_0120409_559_1500 279
71 3300044684 Ga0466966_0002217 Ga0466966_0002217_8407_9393 280
72 3300049568 Ga0501031_0014363 Ga0501031_0014363_1408_2331 280
73 3300049823 Ga0501044_0323241 Ga0501044_0323241_333_1256 280
74 3300046455 Ga0495603_0152974 Ga0495603_0152974_263_1183 281
75 3300046459 Ga0495629_0011963 Ga0495629_0011963_4676_5596 281
76 3300046462 Ga0495651_0083485 Ga0495651_0083485_1090_2010 281
77 3300046499 Ga0495594_0126814 Ga0495594_0126814_174_1094 281
78 3300046514 Ga0495618_0050415 Ga0495618_0050415_559_1479 281
79 3300046516 Ga0495628_0064546 Ga0495628_0064546_829_1749 281
80 3300046529 Ga0495652_0071502 Ga0495652_0071502_890_1810 281
81 3300046533 Ga0495640_0008442 Ga0495640_0008442_5342_6262 281
82 3300046559 Ga0495667_0095244 Ga0495667_0095244_809_1729 281
83 3300046642 Ga0495634_0019220 Ga0495634_0019220_2071_2991 281
84 3300046690 Ga0495624_0031867 Ga0495624_0031867_1934_2854 281
85 3300047321 Ga0495676_0011799 Ga0495676_0011799_817_1737 281
86 3300047444 Ga0495675_0065634 Ga0495675_0065634_395_1303 281
87 3300035398 Ga0316574_0015292 Ga0316574_0015292_77_934 282
88 3300046492 Ga0495585_0006351 Ga0495585_0006351_6127_7017 283
89 3300046499 Ga0495594_0047801 Ga0495594_0047801_858_1748 283
90 3300046533 Ga0495640_0022013 Ga0495640_0022013_2786_3676 283
91 3300046557 Ga0495622_0151754 Ga0495622_0151754_78_968 283
92 3300047317 Ga0495604_0132423 Ga0495604_0132423_436_1326 283
93 3300049569 Ga0501032_0019019 Ga0501032_0019019_1170_2096 283
94 3300049570 Ga0501033_0111936 Ga0501033_0111936_329_1255 283
95 3300049571 Ga0501034_0022456 Ga0501034_0022456_706_1632 283
96 3300049572 Ga0501036_0009702 Ga0501036_0009702_5964_6890 283
97 3300049573 Ga0501037_0079707 Ga0501037_0079707_1304_2230 283
98 3300049574 Ga0501038_0081022 Ga0501038_0081022_850_1776 283
99 3300049579 Ga0501043_0064594 Ga0501043_0064594_931_1857 283
100 3300049580 Ga0501046_0245659 Ga0501046_0245659_211_1137 283
101 3300049581 Ga0501047_0003983 Ga0501047_0003983_9579_10505 283
102 3300049586 Ga0501070_0015823 Ga0501070_0015823_5117_5974 283
103 3300049823 Ga0501044_0105783 Ga0501044_0105783_1095_2021 283
104 3300005467 Ga0070706_100019026 Ga0070706_1000190262 284
105 3300005468 Ga0070707_100059801 Ga0070707_1000598013 284
106 3300005563 Ga0068855_100123491 Ga0068855_1001234912 284
107 3300005614 Ga0068856_100040880 Ga0068856_1000408804 284
108 3300025910 Ga0207684_10008251 Ga0207684_100082515 284
109 3300025922 Ga0207646_10061512 Ga0207646_100615123 284
110 3300025949 Ga0207667_10102387 Ga0207667_101023874 284
111 3300026078 Ga0207702_10096498 Ga0207702_100964983 284
112 3300044719 Ga0466971_0149032 Ga0466971_0149032_11_868 284
113 3300048911 Ga0496108_0073008 Ga0496108_0073008_791_1654 284
114 3300048912 Ga0496109_0091136 Ga0496109_0091136_336_1199 284
115 3300048913 Ga0496110_0049598 Ga0496110_0049598_1065_1928 284
116 3300048914 Ga0496111_0024094 Ga0496111_0024094_671_1534 284
117 3300049581 Ga0501047_0000170 Ga0501047_0000170_74505_75362 284
118 3300049581 Ga0501047_0124907 Ga0501047_0124907_65_1057 284
119 3300049822 Ga0501035_0027700 Ga0501035_0027700_566_1435 284
120 3300049823 Ga0501044_0099006 Ga0501044_0099006_312_1181 284
121 3300005436 Ga0070713_100092110 Ga0070713_1000921101 285
122 3300006852 Ga0075433_10027523 Ga0075433_100275232 285
123 3300009094 Ga0111539_10062919 Ga0111539_100629191 285
124 3300009147 Ga0114129_10003905 Ga0114129_100039056 285
125 3300025906 Ga0207699_10121557 Ga0207699_101215571 285
126 3300025928 Ga0207700_10090080 Ga0207700_100900803 285
127 3300027907 Ga0207428_10293437 Ga0207428_102934372 285
128 3300030521 Ga0307511_10114607 Ga0307511_101146071 285
129 3300031616 Ga0307508_10078537 Ga0307508_100785371 285
130 3300049649 Ga0501198_017217 Ga0501198_017217_83_997 285
131 3300050507 nmdc:mga05p37_8451_c1 nmdc:mga05p37_8451_c1_452_1330 285
132 3300050511 nmdc:mga08y16_48981_c1 nmdc:mga08y16_48981_c1_34_912 285
133 3300050514 nmdc:mga08x19_12875_c1 nmdc:mga08x19_12875_c1_3258_4136 285
134 3300050515 nmdc:mga0a205_31809_c1 nmdc:mga0a205_31809_c1_3258_4136 285
135 3300003320 rootH2_10072207 rootH2_100722073 286
136 3300009093 Ga0105240_10804878 Ga0105240_108048781 286
137 3300009098 Ga0105245_10049948 Ga0105245_100499482 286
138 3300022467 Ga0224712_10010039 Ga0224712_100100392 286
139 3300044684 Ga0466966_0065182 Ga0466966_0065182_405_1274 286
140 3300049568 Ga0501031_0018964 Ga0501031_0018964_1807_2727 286
141 3300049570 Ga0501033_0043444 Ga0501033_0043444_1354_2274 286
142 3300049571 Ga0501034_0059656 Ga0501034_0059656_1649_2569 286
143 3300049572 Ga0501036_0123192 Ga0501036_0123192_1104_2024 286
144 3300049574 Ga0501038_0028687 Ga0501038_0028687_2960_3880 286
145 3300049575 Ga0501039_0076350 Ga0501039_0076350_755_1675 286
146 3300049579 Ga0501043_0043259 Ga0501043_0043259_1126_2046 286
147 3300049581 Ga0501047_0044310 Ga0501047_0044310_3145_4065 286
148 3300049586 Ga0501070_0122660 Ga0501070_0122660_114_1034 286
149 3300049823 Ga0501044_0020285 Ga0501044_0020285_1001_1921 286
150 iso_pu_bacteria 3006321560 3006323905 286
151 3300044693 Ga0466961_0061949 Ga0466961_0061949_1426_2319 288
152 3300046476 Ga0495662_0040255 Ga0495662_0040255_48_935 288
153 3300046517 Ga0495630_0430379 Ga0495630_0430379_84_971 288
154 3300046679 Ga0495623_0015980 Ga0495623_0015980_2537_3424 288
155 3300047317 Ga0495604_0061788 Ga0495604_0061788_1686_2573 288
156 3300047444 Ga0495675_0021776 Ga0495675_0021776_1437_2324 288
157 iso_pu_bacteria 2818991463 2819694860 288
158 3300061719 Ga0466962_0094055 Ga0466962_0094055_23_922 289
159 iso_pu_bacteria 2616644941 2616900168 289
160 3300005367 Ga0070667_100003044 Ga0070667_1000030448 290
161 3300005983 Ga0081540_1004774 Ga0081540_10047748 290
162 3300037312 Ga0395899_0071355 Ga0395899_0071355_1188_2066 290
163 3300044693 Ga0466961_0087580 Ga0466961_0087580_618_1517 290
164 3300044693 Ga0466961_0144237 Ga0466961_0144237_275_1162 290
165 3300044765 Ga0466970_0032012 Ga0466970_0032012_354_1253 290
166 3300045836 Ga0466958_0018436 Ga0466958_0018436_2536_3435 290
167 3300045836 Ga0466958_0283483 Ga0466958_0283483_164_1051 290
168 3300061719 Ga0466962_0043678 Ga0466962_0043678_85_984 290
169 3300061719 Ga0466962_0072498 Ga0466962_0072498_422_1309 290
170 3300031665 Ga0316575_10003475 Ga0316575_100034752 291
171 3300031691 Ga0316579_10005829 Ga0316579_100058292 291
172 3300031727 Ga0316576_10001107 Ga0316576_100011073 291
173 3300031727 Ga0316576_10031549 Ga0316576_100315495 291
174 3300031733 Ga0316577_10170625 Ga0316577_101706252 291
175 3300032133 Ga0316583_10003013 Ga0316583_100030132 291
176 3300032139 Ga0316580_10002296 Ga0316580_100022962 291
177 3300035086 Ga0373934_0000029 Ga0373934_0000029_9159_10073 291
178 3300035111 Ga0373923_0034898 Ga0373923_0034898_1083_1997 291
179 3300035117 Ga0373953_0000039 Ga0373953_0000039_29718_30632 291
180 3300035118 Ga0373954_0007403 Ga0373954_0007403_1187_2101 291
181 3300035119 Ga0373956_0003608 Ga0373956_0003608_4068_4982 291
182 3300035120 Ga0373957_0000086 Ga0373957_0000086_7108_8022 291
183 3300035172 Ga0373955_0000012 Ga0373955_0000012_35457_36371 291
184 3300035410 Ga0373924_0001104 Ga0373924_0001104_6024_6938 291
185 3300035724 Ga0373933_0000032 Ga0373933_0000032_48229_49143 291
186 3300036401 Ga0373937_0000023 Ga0373937_0000023_91018_91932 291
187 3300044656 Ga0466969_0040630 Ga0466969_0040630_937_1845 291
188 3300044693 Ga0466961_0002096 Ga0466961_0002096_8664_9557 291
189 3300044693 Ga0466961_0028946 Ga0466961_0028946_581_1489 291
190 3300045836 Ga0466958_0037070 Ga0466958_0037070_1680_2573 291
191 3300046454 Ga0495592_0000061 Ga0495592_0000061_63323_64237 291
192 3300046462 Ga0495651_0000015 Ga0495651_0000015_91018_91932 291
193 3300046463 Ga0495653_0000927 Ga0495653_0000927_5853_6767 291
194 3300046511 Ga0495608_0000046 Ga0495608_0000046_63318_64232 291
195 3300046516 Ga0495628_0000272 Ga0495628_0000272_9948_10862 291
196 3300046529 Ga0495652_0000044 Ga0495652_0000044_90969_91883 291
197 3300046536 Ga0495587_0000098 Ga0495587_0000098_63323_64237 291
198 3300046543 Ga0495645_0181823 Ga0495645_0181823_373_1287 291
199 3300046559 Ga0495667_0000058 Ga0495667_0000058_63304_64218 291
200 3300046675 Ga0495657_0000030 Ga0495657_0000030_91004_91918 291
201 3300046678 Ga0495599_0000041 Ga0495599_0000041_59299_60213 291
202 3300046679 Ga0495623_0000708 Ga0495623_0000708_17768_18682 291
203 3300046680 Ga0495646_0002405 Ga0495646_0002405_8520_9434 291
204 3300047317 Ga0495604_0000203 Ga0495604_0000203_17713_18627 291
205 3300047322 Ga0495680_0000051 Ga0495680_0000051_35483_36397 291
206 3300047444 Ga0495675_0000524 Ga0495675_0000524_12746_13660 291
207 3300048088 Ga0495602_0000071 Ga0495602_0000071_35483_36397 291
208 3300048912 Ga0496109_0229814 Ga0496109_0229814_33_944 291
209 3300048922 Ga0496119_0000125 Ga0496119_0000125_104278_105183 291
210 3300048923 Ga0496120_0021075 Ga0496120_0021075_132_1037 291
211 3300053084 Ga0495595_0002357 Ga0495595_0002357_3007_3921 291
212 iso_pu_bacteria 2867475112 2867478337 291
213 3300005435 Ga0070714_100005487 Ga0070714_1000054873 292
214 3300025297 Ga0209758_1004520 Ga0209758_10045203 292
215 3300025929 Ga0207664_10024966 Ga0207664_100249661 292
216 3300044694 Ga0466963_0279929 Ga0466963_0279929_152_1036 292
217 3300044842 Ga0466957_0010289 Ga0466957_0010289_297_1181 292
218 3300045836 Ga0466958_0038822 Ga0466958_0038822_383_1267 292
219 3300045976 Ga0466967_0003184 Ga0466967_0003184_8330_9232 292
220 3300048903 Ga0496100_0334379 Ga0496100_0334379_71_1051 292
221 3300048913 Ga0496110_0593847 Ga0496110_0593847_44_937 292
222 3300053083 Ga0495655_0009818 Ga0495655_0009818_35_931 292
223 3300025302 Ga0207426_1002587 Ga0207426_10025876 293
224 3300025944 Ga0207661_10606771 Ga0207661_106067711 293
225 3300031727 Ga0316576_10012088 Ga0316576_100120886 293
226 3300032004 Ga0307414_10377399 Ga0307414_103773991 293
227 3300035398 Ga0316574_0063248 Ga0316574_0063248_1116_2054 293
228 3300036647 Ga0316582_0014395 Ga0316582_0014395_3213_4109 293
229 3300037418 Ga0395900_0013396 Ga0395900_0013396_41_937 293
230 3300037466 Ga0395898_0081825 Ga0395898_0081825_970_1866 293
231 3300037588 Ga0316581_0002417 Ga0316581_0002417_1221_2117 293
232 3300038443 Ga0395901_0016902 Ga0395901_0016902_1908_2804 293
233 3300045976 Ga0466967_0005322 Ga0466967_0005322_2298_3194 293
234 3300048918 Ga0496115_0146770 Ga0496115_0146770_166_1134 293
235 3300049576 Ga0501040_0169255 Ga0501040_0169255_50_1072 293
236 3300049576 Ga0501040_0304022 Ga0501040_0304022_76_1098 293
237 3300049577 Ga0501041_0037938 Ga0501041_0037938_1665_2687 293
238 3300049588 Ga0501072_0060251 Ga0501072_0060251_55_1077 293
239 3300049590 Ga0501074_0110497 Ga0501074_0110497_211_1233 293
240 3300049591 Ga0501075_0044779 Ga0501075_0044779_1676_2698 293
241 3300049824 Ga0501045_0015609 Ga0501045_0015609_2983_4005 293
242 3300049824 Ga0501045_0103772 Ga0501045_0103772_896_1918 293
243 3300005327 Ga0070658_10013567 Ga0070658_100135672 294
244 3300005336 Ga0070680_100010301 Ga0070680_1000103012 294
245 3300005458 Ga0070681_10002907 Ga0070681_1000290710 294
246 3300005530 Ga0070679_100029082 Ga0070679_1000290822 294
247 3300006881 Ga0068865_100189570 Ga0068865_1001895701 294
248 3300009098 Ga0105245_10020911 Ga0105245_100209112 294
249 3300013308 Ga0157375_10038356 Ga0157375_100383562 294
250 3300020081 Ga0206354_10682863 Ga0206354_106828635 294
251 3300020082 Ga0206353_10165729 Ga0206353_101657298 294
252 3300025909 Ga0207705_10010741 Ga0207705_100107415 294
253 3300025912 Ga0207707_10017671 Ga0207707_100176713 294
254 3300025917 Ga0207660_10013593 Ga0207660_100135932 294
255 3300025921 Ga0207652_10001309 Ga0207652_1000130913 294
256 3300025938 Ga0207704_10139696 Ga0207704_101396962 294
257 3300046454 Ga0495592_0032895 Ga0495592_0032895_1373_2305 294
258 3300046462 Ga0495651_0097261 Ga0495651_0097261_183_1115 294
259 3300046463 Ga0495653_0191151 Ga0495653_0191151_438_1370 294
260 3300046472 Ga0495580_0007809 Ga0495580_0007809_59_991 294
261 3300046476 Ga0495662_0000222 Ga0495662_0000222_11538_12470 294
262 3300046477 Ga0495664_0006050 Ga0495664_0006050_3223_4155 294
263 3300046511 Ga0495608_0002656 Ga0495608_0002656_442_1374 294
264 3300046516 Ga0495628_0000880 Ga0495628_0000880_14988_15920 294
265 3300046526 Ga0495666_0022973 Ga0495666_0022973_632_1564 294
266 3300046529 Ga0495652_0008754 Ga0495652_0008754_746_1678 294
267 3300046531 Ga0495665_0002034 Ga0495665_0002034_8110_9042 294
268 3300046533 Ga0495640_0069902 Ga0495640_0069902_1402_2334 294
269 3300046535 Ga0495586_0008637 Ga0495586_0008637_1705_2637 294
270 3300046536 Ga0495587_0033913 Ga0495587_0033913_1402_2334 294
271 3300046543 Ga0495645_0002734 Ga0495645_0002734_6939_7874 294
272 3300046543 Ga0495645_0003143 Ga0495645_0003143_2143_3075 294
273 3300046559 Ga0495667_0044258 Ga0495667_0044258_1392_2324 294
274 3300046663 Ga0495635_0070846 Ga0495635_0070846_368_1300 294
275 3300046675 Ga0495657_0014149 Ga0495657_0014149_2103_3035 294
276 3300046679 Ga0495623_0010850 Ga0495623_0010850_1607_2539 294
277 3300046689 Ga0495613_0004996 Ga0495613_0004996_625_1557 294
278 3300046809 Ga0495600_0007771 Ga0495600_0007771_4549_5481 294
279 3300047317 Ga0495604_0004414 Ga0495604_0004414_2690_3622 294
280 3300047444 Ga0495675_0010129 Ga0495675_0010129_1860_2795 294
281 3300047471 Ga0495684_0012065 Ga0495684_0012065_1723_2655 294
282 3300048906 Ga0496103_0103257 Ga0496103_0103257_89_1141 294
283 3300048907 Ga0496104_0097075 Ga0496104_0097075_1441_2493 294
284 3300048910 Ga0496107_0127051 Ga0496107_0127051_297_1349 294
285 3300048911 Ga0496108_0229394 Ga0496108_0229394_84_1136 294
286 3300048911 Ga0496108_0289278 Ga0496108_0289278_23_907 294
287 3300048914 Ga0496111_0005539 Ga0496111_0005539_4085_5137 294
288 3300048916 Ga0496113_0008369 Ga0496113_0008369_5704_6660 294
289 3300048917 Ga0496114_0005981 Ga0496114_0005981_3609_4661 294
290 3300053078 Ga0495612_0023799 Ga0495612_0023799_389_1321 294
291 3300053085 Ga0495619_0006329 Ga0495619_0006329_1035_1967 294
292 3300053087 Ga0500643_005255 Ga0500643_005255_645_1685 294
293 iso_pu_bacteria 2799112218 2799185503 294
294 3300005937 Ga0081455_10008676 Ga0081455_100086765 295
295 3300006844 Ga0075428_100034900 Ga0075428_1000349003 295
296 3300006844 Ga0075428_100120180 Ga0075428_1001201802 295
297 3300009147 Ga0114129_10028769 Ga0114129_100287696 295
298 3300032005 Ga0307411_10024379 Ga0307411_100243792 295
299 3300037418 Ga0395900_0006616 Ga0395900_0006616_1123_2034 295
300 3300050507 nmdc:mga05p37_154123_c1 nmdc:mga05p37_154123_c1_700_1602 295
301 3300050510 nmdc:mga06r32_321980_c1 nmdc:mga06r32_321980_c1_465_1367 295
302 iso_pu_bacteria 2731639228 2731908155 295
303 3300031824 Ga0307413_10382323 Ga0307413_103823232 296
304 3300032002 Ga0307416_100227420 Ga0307416_1002274202 296
305 iso_pu_bacteria 2643221961 2645722712 296
306 iso_pu_bacteria 2643221962 2645725684 296
307 iso_pu_bacteria 2643221697 2644538339 297
308 iso_pu_bacteria 2984592036 2984592089 297
309 3300048904 Ga0496101_0346431 Ga0496101_0346431_87_992 298
310 3300048907 Ga0496104_0235631 Ga0496104_0235631_705_1610 298
311 3300048917 Ga0496114_0025479 Ga0496114_0025479_3463_4368 298
312 3300013307 Ga0157372_10664850 Ga0157372_106648502 299
313 3300031548 Ga0307408_100138795 Ga0307408_1001387953 299
314 3300044683 Ga0466965_0057215 Ga0466965_0057215_875_1780 299
315 3300044693 Ga0466961_0073989 Ga0466961_0073989_102_1004 299
316 3300044765 Ga0466970_0056275 Ga0466970_0056275_265_1170 299
317 3300044901 Ga0466960_0001394 Ga0466960_0001394_427_1332 299
318 3300044901 Ga0466960_0017671 Ga0466960_0017671_1043_1948 299
319 3300045976 Ga0466967_0139153 Ga0466967_0139153_761_1666 299
320 3300048927 Ga0496124_0206819 Ga0496124_0206819_123_1028 299
321 iso_pu_bacteria 2816332119 2816427793 299
322 3300045976 Ga0466967_0002621 Ga0466967_0002621_6118_7050 300
323 3300025927 Ga0207687_10241173 Ga0207687_102411731 301
324 3300026078 Ga0207702_10145813 Ga0207702_101458132 301
325 3300005981 Ga0081538_10001112 Ga0081538_100011123 302
326 3300049572 Ga0501036_0022982 Ga0501036_0022982_3166_4083 302
327 3300049573 Ga0501037_0002695 Ga0501037_0002695_2089_3006 302
328 3300049574 Ga0501038_0169212 Ga0501038_0169212_793_1710 302
329 3300049575 Ga0501039_0004330 Ga0501039_0004330_6929_7846 302
330 3300049576 Ga0501040_0014712 Ga0501040_0014712_1022_1939 302
331 3300049577 Ga0501041_0002505 Ga0501041_0002505_8665_9582 302
332 3300049578 Ga0501042_0029857 Ga0501042_0029857_2794_3711 302
333 3300049579 Ga0501043_0047744 Ga0501043_0047744_1457_2374 302
334 3300049582 Ga0501048_0070296 Ga0501048_0070296_841_1758 302
335 3300049584 Ga0501068_0023107 Ga0501068_0023107_864_1781 302
336 3300049587 Ga0501071_0002285 Ga0501071_0002285_8112_9029 302
337 3300049588 Ga0501072_0002274 Ga0501072_0002274_8216_9133 302
338 3300049590 Ga0501074_0311897 Ga0501074_0311897_146_1063 302
339 3300049592 Ga0501076_0013084 Ga0501076_0013084_2807_3724 302
340 3300049741 Ga0501079_0006767 Ga0501079_0006767_5224_6141 302
341 3300049742 Ga0501080_0075026 Ga0501080_0075026_2120_3037 302
342 3300049743 Ga0501081_0031489 Ga0501081_0031489_153_1070 302
343 3300049824 Ga0501045_0079201 Ga0501045_0079201_855_1772 302
344 3300054114 Ga0501084_0046849 Ga0501084_0046849_331_1248 302
345 3300060353 Ga0501082_0004402 Ga0501082_0004402_2724_3641 302
346 3300061734 Ga0530510_0132991 Ga0530510_0132991_29_946 302
347 3300001979 JGI24740J21852_10019038 JGI24740J21852_100190382 303
348 3300005455 Ga0070663_100279444 Ga0070663_1002794442 303
349 3300009551 Ga0105238_10540310 Ga0105238_105403102 303
350 3300026067 Ga0207678_10123249 Ga0207678_101232491 303
351 3300041511 Ga0451855_0294732 Ga0451855_0294732_17_934 303
352 3300046453 Ga0495627_037794 Ga0495627_037794_419_1330 303
353 3300046492 Ga0495585_0066397 Ga0495585_0066397_556_1467 303
354 3300046500 Ga0495596_0095369 Ga0495596_0095369_55_966 303

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02585

PIG-L

GlcNAc-PI de-N-acetylase

51

202

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1q74-assembly4.cif.gz_D the crystal structure of 1d-myo-inositol 2-acetamido-2-deoxy-alpha-d-glucopyranoside deacetylase (mshb) 0.9079 7 302
1q74-assembly2.cif.gz_B the crystal structure of 1d-myo-inositol 2-acetamido-2-deoxy-alpha-d-glucopyranoside deacetylase (mshb) 0.888 5 302
1q74-assembly4.cif.gz_D the crystal structure of 1d-myo-inositol 2-acetamido-2-deoxy-alpha-d-glucopyranoside deacetylase (mshb) 0.8857 7 302
1q74-assembly2.cif.gz_B the crystal structure of 1d-myo-inositol 2-acetamido-2-deoxy-alpha-d-glucopyranoside deacetylase (mshb) 0.8756 5 302
4ewl-assembly2.cif.gz_B crystal structure of mshb with glycerol and acetate bound in the active site 0.872 1 302
ID Description Score Start End Superfamily
1q74D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.9079 7 302 3.40.50.10320
1q74D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8857 7 302 3.40.50.10320
af_P9WJN1_3_287_3.40.50.10320 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8403 6 303 3.40.50.10320
af_P9WJN1_3_287_3.40.50.10320 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8348 6 303 3.40.50.10320
1uanB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8223 9 256 3.40.50.10320
ID Description Score Start End GO Terms
AF-A0A7W9GL68-F1-model_v4 1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase (GlcNAc-Ins deacetylase) (EC 3.5.1.103) (N-acetyl-1-D-myo-inositol-2-amino-2-deoxy-alpha-D-glucopyranoside deacetylase) 0.9656 3 303 GO:0008270
GO:0010125
GO:0035595
AF-A0A354XNZ5-F1-model_v4 deleted 0.9586 3 177
AF-A0A7W9GL68-F1-model_v4 1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase (GlcNAc-Ins deacetylase) (EC 3.5.1.103) (N-acetyl-1-D-myo-inositol-2-amino-2-deoxy-alpha-D-glucopyranoside deacetylase) 0.9562 3 303 GO:0008270
GO:0010125
GO:0035595
AF-A0A522B975-F1-model_v4 N-acetyl-1-D-myo-inositol-2-amino-2-deoxy-alpha-D-glucopyranoside deacetylase 0.9557 120 303 GO:0016137
GO:0016811
AF-A0A7K0YK02-F1-model_v4 N-acetyl-1-D-myo-inositol-2-amino-2-deoxy-alpha-D-glucopyranoside deacetylase (EC 3.5.1.103) 0.9552 3 251 GO:0010125
GO:0035595

Feature Viewer

pLDDT pTM Quality
91.01 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map