F419938

General Info

Members Datasets Scaffolds Average Seq Length
354 260 245 194

Family's Representative Sequence

Representative Sequence 3300053125|Ga0500618_012813|Ga0500618_012813_625_1272
Length 215
Sequence MVKSCWRVCKPGFETGGIMDQMTMPALRREIHDLAQAADHIRGANRILVMGCSGGGKSTLSLKIAARFGLSYVSIDRDVLWLPGWVERGKDAQRAIIVSKVEGERWIMDGTNPSTFDIRLPRTDFVIWVRMPRLLCIWGAISRWVKWIGRTRPEMAPGCKEKIDWEFLRFIWTFEEKFTPRVVNGLVEHGPDVPVFQLTSRRQMRELLDLLGAPA

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
3 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
4 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
5 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
6 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
7 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
8 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
9 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
10 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
11 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
12 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
13 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
14 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
15 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
16 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
17 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
18 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
19 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
20 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
21 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
22 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
23 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
24 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
25 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
26 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
27 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
28 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
29 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
30 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
31 2643221568 Rhizobium sp. Root564 Isolate Unclassified
32 2643221618 Ensifer sp. Root231 Isolate Unclassified
33 2643221626 Ensifer sp. Root31 Isolate Unclassified
34 2643221655 Ensifer sp. Root1252 Isolate Unclassified
35 2643221659 Ensifer sp. Root127 Isolate Unclassified
36 2643221698 Ensifer sp. Root142 Isolate Unclassified
37 2643221712 Ensifer sp. Root258 Isolate Unclassified
38 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
39 2718217927 Rhizobium sp. N324 Isolate Nodule
40 2718218423 Rhizobium sp. N941 Isolate Nodule
41 2721755809 Rhizobium sp. N541 Isolate Nodule
42 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
43 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
44 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
45 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
46 2791355260 Rhizobium sp. L9 Isolate Nodule
47 2791355261 Rhizobium sp. J15 Isolate Nodule
48 2791355264 Rhizobium sp. S9 Isolate Nodule
49 2791355267 Rhizobium sp. L18 Isolate Nodule
50 2802429633 Rhizobium anhuiense J3 Isolate Nodule
51 2802429634 Rhizobium anhuiense S10 Isolate Nodule
52 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
53 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
54 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
55 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
56 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
57 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
58 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
59 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
60 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
61 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
62 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
63 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
64 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
65 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
66 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
67 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
68 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
69 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
70 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
71 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
72 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
73 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
74 2844163670 Ensifer sp. 1H6 Isolate Unclassified
75 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
76 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
77 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
78 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
79 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
80 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
81 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
82 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
83 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
84 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
85 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
86 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
87 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
88 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
89 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
90 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
91 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
92 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
93 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
94 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
95 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
96 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
97 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
98 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
99 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
100 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
101 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
102 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
103 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
104 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
105 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
106 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
107 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
108 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
109 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
110 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
111 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
112 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
113 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
114 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
115 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
116 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
117 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
118 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
119 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
120 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
121 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
122 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
123 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
124 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
125 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
126 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
127 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
128 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
129 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
130 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
131 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
132 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
133 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
134 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
137 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
138 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
139 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
141 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
143 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
145 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
148 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
159 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
160 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
161 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
162 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
163 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
164 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
165 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
166 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
167 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
168 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
169 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
170 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
171 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
172 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
173 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
174 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
175 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
176 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
177 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
178 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
179 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
180 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
181 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
182 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
183 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
184 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
185 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
186 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
187 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
188 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
189 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
190 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
191 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
192 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
193 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
194 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
195 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
196 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
197 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
198 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
204 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
205 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
206 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
207 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
208 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
209 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
210 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
211 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
212 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
213 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
214 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
218 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
219 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
220 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
221 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
222 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
223 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
224 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
225 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
226 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
227 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
228 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
229 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
230 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
231 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
232 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
233 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
234 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
235 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
236 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
237 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
238 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
239 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
240 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
241 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
242 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
243 8005275841 Rhizobium sp. N4311 Isolate Nodule
244 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
245 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
246 8005382845 Rhizobium sp. R634 Isolate Nodule
247 8005395548 Rhizobium sp. R339 Isolate Nodule
248 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
249 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
250 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
251 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
252 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
253 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
254 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
255 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
256 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
257 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
258 8056382006 Rhizobium croatiense 13T Isolate Nodule
259 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
260 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 69.49
Metatranscriptomes 0
Isolates 30.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 29.94
Nodule 16.67
Rhizoplane 2.82
Rhizosphere 25.42
Stem 0
Stem Tuber 0
Unclassified 25.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000351 3300002737 Bacteria 39572
2 JGI25162J39368_1002689 3300002737 Bacteria 6468
3 JGI25152J39213_1021392 3300002773 Bacteria 1135
4 JGI25159J45721_1002469 3300002987 Bacteria 7008
5 JGI25151J46595_10000238 3300003187 Bacteria 64884
6 JGI25165J46597_1000189 3300003214 Bacteria 91790
7 JGI25165J46597_1000777 3300003214 Bacteria 24294
8 JGI25165J46597_1014374 3300003214 Bacteria 1077
9 rootH1_10027309 3300003316 Bacteria 1686
10 rootH2_10012004 3300003320 Bacteria 1765
11 rootL2_10034778 3300003322 Bacteria 2514
12 rootH1_10017647 3300003323 Bacteria 1657
13 rootH1_10033534 3300003323 Bacteria 5948
14 rootH1_10113295 3300003323 Bacteria 2515
15 JGI25160J50197_1000004 3300003354 Bacteria 419797
16 JGI25161J50226_1000003 3300003374 Bacteria 413345
17 JGI25161J50226_1008427 3300003374 Bacteria 1589
18 Ga0055526_1000669 3300003771 Bacteria 26309
19 Ga0055526_1004202 3300003771 Bacteria 8745
20 Ga0055524_1004582 3300003775 Bacteria 6358
21 Ga0055524_1020725 3300003775 Bacteria 2204
22 Ga0055536_1004763 3300003781 Bacteria 6809
23 Ga0055528_1000918 3300003790 Bacteria 19824
24 Ga0055528_1008737 3300003790 Bacteria 4297
25 Ga0055528_1016436 3300003790 Bacteria 2617
26 Ga0055528_1020888 3300003790 Bacteria 2102
27 Ga0055540_1001884 3300003792 Bacteria 11760
28 Ga0055540_1026148 3300003792 Bacteria 1416
29 Ga0055531_10001165 3300003794 Bacteria 20245
30 Ga0058692_1034228 3300003856 Bacteria 935
31 Ga0055543_1000001 3300004625 Bacteria 419949
32 Ga0055543_1000808 3300004625 Bacteria 15443
33 Ga0065165_1000049 3300005262 Bacteria 195588
34 Ga0065165_1024195 3300005262 Bacteria 2044
35 Ga0070670_100001443 3300005331 Bacteria 19089
36 Ga0070667_100097202 3300005367 Bacteria 2540
37 Ga0070665_100537292 3300005548 Bacteria 1181
38 Ga0068855_100147887 3300005563 Bacteria 2673
39 Ga0068856_100108448 3300005614 Bacteria 2773
40 Ga0068852_100082239 3300005616 Bacteria 2861
41 Ga0075365_10025732 3300006038 Bacteria 3728
42 Ga0075363_100012667 3300006048 Bacteria 4068
43 Ga0075363_100100272 3300006048 Bacteria 1602
44 Ga0075364_10033491 3300006051 Bacteria 3309
45 Ga0075364_10188598 3300006051 Bacteria 1396
46 Ga0075362_10131862 3300006177 Bacteria 1189
47 Ga0075362_10161181 3300006177 Bacteria 1080
48 Ga0075367_10026480 3300006178 Bacteria 3290
49 Ga0075367_10348209 3300006178 Bacteria 935
50 Ga0075369_10004806 3300006186 Bacteria 5024
51 Ga0075366_10003432 3300006195 Bacteria 8356
52 Ga0075370_10006155 3300006353 Bacteria 6019
53 Ga0075370_10070723 3300006353 Bacteria 1996
54 Ga0105250_10119080 3300009092 Bacteria 1084
55 Ga0105240_10000005 3300009093 Bacteria 702630
56 Ga0105237_10002240 3300009545 Bacteria 24098
57 Ga0105238_11429912 3300009551 Bacteria 719
58 Ga0105239_10000739 3300010375 Bacteria 46483
59 Ga0157371_10005765 3300013102 Bacteria 10378
60 Ga0157370_10000284 3300013104 Bacteria 64323
61 Ga0157369_10459447 3300013105 Bacteria 1318
62 Ga0157369_10509929 3300013105 Bacteria 1244
63 Ga0163162_11873255 3300013306 Bacteria 686
64 Ga0182008_10096962 3300014497 Bacteria 1455
65 Ga0182007_10007082 3300015262 Bacteria 4746
66 Ga0182005_1006191 3300015265 Bacteria 3676
67 Ga0207427_108564 3300025231 Bacteria 1133
68 Ga0209437_100160 3300025233 Bacteria 149451
69 Ga0209437_100310 3300025233 Bacteria 65905
70 Ga0207425_1021384 3300025245 Bacteria 1372
71 Ga0209646_1023998 3300025246 Bacteria 861
72 Ga0209677_101256 3300025253 Bacteria 11408
73 Ga0209148_1011737 3300025254 Bacteria 1620
74 Ga0209759_1012005 3300025256 Bacteria 2425
75 Ga0209129_1000442 3300025258 Bacteria 30980
76 Ga0209233_1000168 3300025261 Bacteria 149312
77 Ga0209233_1000269 3300025261 Bacteria 74071
78 Ga0209233_1000303 3300025261 Bacteria 59138
79 Ga0209673_1000139 3300025273 Bacteria 157765
80 Ga0209673_1001538 3300025273 Bacteria 20946
81 Ga0209673_1002227 3300025273 Bacteria 14064
82 Ga0209673_1015353 3300025273 Bacteria 2915
83 Ga0209130_1000012 3300025284 Bacteria 421329
84 Ga0209676_1006026 3300025292 Bacteria 6116
85 Ga0209025_1000237 3300025294 Bacteria 128553
86 Ga0209564_1000794 3300025295 Bacteria 43506
87 Ga0209564_1000868 3300025295 Bacteria 40261
88 Ga0209758_1000155 3300025297 Bacteria 160455
89 Ga0209758_1000545 3300025297 Bacteria 59830
90 Ga0209758_1001100 3300025297 Bacteria 34985
91 Ga0209758_1002445 3300025297 Bacteria 18964
92 Ga0209758_1003692 3300025297 Bacteria 13607
93 Ga0209050_1005095 3300025298 Bacteria 8471
94 Ga0209256_1001048 3300025299 Bacteria 32169
95 Ga0209256_1004371 3300025299 Bacteria 8941
96 Ga0209256_1021477 3300025299 Bacteria 1979
97 Ga0209256_1050657 3300025299 Bacteria 1006
98 Ga0207426_1000010 3300025302 Bacteria 796003
99 Ga0207426_1000094 3300025302 Bacteria 275293
100 Ga0209051_1001031 3300025303 Bacteria 26450
101 Ga0209051_1008543 3300025303 Bacteria 5410
102 Ga0209257_1003296 3300025304 Bacteria 14065
103 Ga0207695_10000011 3300025913 Bacteria 910221
104 Ga0207671_10001291 3300025914 Bacteria 29425
105 Ga0207650_10002090 3300025925 Bacteria 13962
106 Ga0207667_10314809 3300025949 Bacteria 1599
107 Ga0207702_10222409 3300026078 Bacteria 1759
108 Ga0207698_10437206 3300026142 Bacteria 1259
109 Ga0209371_1001465 3300027312 Bacteria 15917
110 Ga0268266_10279517 3300028379 Bacteria 1552
111 Ga0307515_10013773 3300028794 Bacteria 15073
112 Ga0307515_10562408 3300028794 Bacteria 750
113 Ga0268256_1001794 3300030500 Bacteria 12086
114 Ga0451797_1375908 3300041453 Bacteria 1413
115 Ga0451835_0729785 3300041492 Bacteria 1097
116 Ga0451837_0388034 3300041494 Bacteria 3747
117 Ga0451839_0023933 3300041496 Bacteria 1259
118 Ga0451841_0329071 3300041498 Bacteria 3736
119 Ga0451845_0475619 3300041501 Bacteria 2849
120 Ga0451845_0513581 3300041501 Bacteria 2368
121 Ga0451847_0867267 3300041503 Bacteria 1815
122 Ga0451849_1243659 3300041505 Bacteria 1587
123 Ga0451851_0085356 3300041507 Bacteria 2421
124 Ga0451851_0377823 3300041507 Bacteria 895
125 Ga0451843_0556366 3300041509 Bacteria 3307
126 Ga0451855_0382238 3300041511 Bacteria 1109
127 Ga0451853_0114112 3300041512 Bacteria 3097
128 Ga0451853_1430482 3300041512 Bacteria 1014
129 Ga0466963_0014097 3300044694 Bacteria 4925
130 Ga0466970_0005266 3300044765 Bacteria 6405
131 Ga0466957_0218632 3300044842 Bacteria 1257
132 Ga0495650_0181029 3300046471 Bacteria 741
133 Ga0495605_0157831 3300046474 Bacteria 1008
134 Ga0495585_0030296 3300046492 Bacteria 3078
135 Ga0495585_0098414 3300046492 Bacteria 1567
136 Ga0495607_0089268 3300046501 Bacteria 1673
137 Ga0495583_0091176 3300046506 Bacteria 1312
138 Ga0495606_0001859 3300046507 Bacteria 26548
139 Ga0495606_0084721 3300046507 Bacteria 1962
140 Ga0495610_0010608 3300046512 Bacteria 5711
141 Ga0495610_0075657 3300046512 Bacteria 1558
142 Ga0495616_0026034 3300046513 Bacteria 3118
143 Ga0495632_0017000 3300046519 Bacteria 4029
144 Ga0495643_0001636 3300046522 Bacteria 19772
145 Ga0495643_0027496 3300046522 Bacteria 3195
146 Ga0495609_0164128 3300046538 Bacteria 940
147 Ga0495597_0205461 3300046542 Bacteria 787
148 Ga0495633_0058720 3300046558 Bacteria 1805
149 Ga0495633_0092907 3300046558 Bacteria 1402
150 Ga0495611_0290130 3300046648 Bacteria 755
151 Ga0495625_0044796 3300046660 Bacteria 3201
152 Ga0495661_0381952 3300046665 Bacteria 688
153 Ga0495670_0182488 3300046691 Bacteria 1108
154 Ga0495649_0122502 3300046694 Bacteria 1374
155 Ga0495636_0044906 3300047318 Bacteria 1841
156 Ga0495687_113901 3300047443 Bacteria 989
157 Ga0495681_0038886 3300047470 Bacteria 2327
158 Ga0495681_0233249 3300047470 Bacteria 733
159 Ga0495686_0004865 3300047472 Bacteria 10832
160 Ga0495686_0131954 3300047472 Bacteria 1480
161 Ga0496100_0012838 3300048903 Bacteria 4815
162 Ga0496101_0136825 3300048904 Bacteria 1865
163 Ga0496102_0008570 3300048905 Bacteria 8769
164 Ga0496103_0010686 3300048906 Bacteria 5431
165 Ga0496106_0004921 3300048909 Bacteria 9886
166 Ga0496106_0163764 3300048909 Bacteria 1760
167 Ga0496113_0169563 3300048916 Bacteria 1728
168 Ga0496116_0000043 3300048919 Bacteria 328085
169 Ga0496116_0008089 3300048919 Bacteria 9192
170 Ga0496116_0103446 3300048919 Bacteria 1694
171 Ga0496116_0118388 3300048919 Bacteria 1539
172 Ga0496117_0000338 3300048920 Bacteria 82688
173 Ga0496117_0038816 3300048920 Bacteria 3523
174 Ga0496117_0092882 3300048920 Bacteria 1937
175 Ga0496117_0109558 3300048920 Bacteria 1724
176 Ga0496117_0231398 3300048920 Bacteria 1021
177 Ga0496118_0000958 3300048921 Bacteria 45054
178 Ga0496118_0224170 3300048921 Bacteria 1091
179 Ga0496119_0004440 3300048922 Bacteria 13967
180 Ga0496119_0014110 3300048922 Bacteria 6287
181 Ga0496119_0063325 3300048922 Bacteria 2200
182 Ga0496119_0136719 3300048922 Bacteria 1328
183 Ga0496120_0001472 3300048923 Bacteria 28063
184 Ga0496120_0026172 3300048923 Bacteria 3607
185 Ga0496120_0070491 3300048923 Bacteria 1922
186 Ga0496121_0000003 3300048924 Bacteria 1191431
187 Ga0496121_0002723 3300048924 Bacteria 26365
188 Ga0496121_0027323 3300048924 Bacteria 5341
189 Ga0496121_0044344 3300048924 Bacteria 3837
190 Ga0496121_0074244 3300048924 Bacteria 2721
191 Ga0496122_0009324 3300048925 Bacteria 10368
192 Ga0496122_0018139 3300048925 Bacteria 6519
193 Ga0496122_0034794 3300048925 Bacteria 4113
194 Ga0496122_0055102 3300048925 Bacteria 2978
195 Ga0496122_0089146 3300048925 Bacteria 2110
196 Ga0496123_0012797 3300048926 Bacteria 7114
197 Ga0496123_0016748 3300048926 Bacteria 5931
198 Ga0496123_0034231 3300048926 Bacteria 3643
199 Ga0496123_0143613 3300048926 Bacteria 1300
200 Ga0496124_0025002 3300048927 Bacteria 5416
201 Ga0496124_0056057 3300048927 Bacteria 3326
202 Ga0496124_0447718 3300048927 Unclassified 881
203 Ga0496124_0463339 3300048927 Bacteria 860
204 Ga0496125_0000141 3300048928 Bacteria 158991
205 Ga0496125_0027520 3300048928 Bacteria 5152
206 Ga0496126_0000362 3300048929 Bacteria 94734
207 Ga0496126_0034554 3300048929 Bacteria 4747
208 Ga0496126_0251223 3300048929 Bacteria 1473
209 Ga0501034_0570997 3300049571 Bacteria 1039
210 Ga0501043_0128235 3300049579 Bacteria 1989
211 Ga0501047_0140440 3300049581 Bacteria 2294
212 Ga0501073_0324260 3300049589 Bacteria 1063
213 Ga0501083_0008060 3300049744 Bacteria 7452
214 nmdc:mga03683_151042_c1 3300050489 Bacteria 1048
215 nmdc:mga03683_175042_c1 3300050489 Bacteria 977
216 nmdc:mga03n38_3751_c1 3300050490 Bacteria 4924
217 nmdc:mga03n38_65686_c1 3300050490 Bacteria 1664
218 nmdc:mga00v17_3753_c1 3300050491 Bacteria 7841
219 nmdc:mga0yw44_94644_c1 3300050492 Bacteria 1894
220 nmdc:mga0k408_126867_c1 3300050493 Bacteria 1514
221 nmdc:mga0k408_127554_c1 3300050493 Bacteria 1509
222 nmdc:mga06z11_106612_c1 3300050494 Bacteria 1545
223 nmdc:mga06z11_41928_c1 3300050494 Bacteria 2293
224 nmdc:mga07m45_10513_c1 3300050496 Bacteria 4836
225 nmdc:mga07m45_200148_c1 3300050496 Bacteria 1162
226 nmdc:mga0sz30_7864_c1 3300050516 Bacteria 4012
227 Ga0500578_0108162 3300053086 Bacteria 1754
228 Ga0500651_0208329 3300053093 Bacteria 1151
229 Ga0500556_0167076 3300053104 Bacteria 869
230 Ga0500572_002869 3300053111 Bacteria 4050
231 Ga0500594_0089701 3300053118 Bacteria 932
232 Ga0500608_017972 3300053122 Bacteria 3220
233 Ga0500618_012813 3300053125 Bacteria 2185
234 Ga0500618_018855 3300053125 Bacteria 1703
235 Ga0500658_0015794 3300053134 Bacteria 2808
236 Ga0500568_0016433 3300053139 Bacteria 3291
237 Ga0500568_0092220 3300053139 Bacteria 1141
238 Ga0500604_0021875 3300053151 Bacteria 1811
239 Ga0500616_0043680 3300053153 Bacteria 2394
240 Ga0500622_0002307 3300053156 Bacteria 13947
241 Ga0500633_0001613 3300053160 Bacteria 4343
242 Ga0500636_0000065 3300053177 Bacteria 51565
243 Ga0500636_0006580 3300053177 Bacteria 6676
244 Ga0500636_0114689 3300053177 Bacteria 1517
245 Ga0501082_0385991 3300060353 Bacteria 1222

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053125 Ga0500618_018855 Ga0500618_018855_1023_1583 167
2 3300048922 Ga0496119_0136719 Ga0496119_0136719_23_532 168
3 3300041496 Ga0451839_0023933 Ga0451839_0023933_134_676 170
4 3300041498 Ga0451841_0329071 Ga0451841_0329071_266_808 170
5 3300041501 Ga0451845_0475619 Ga0451845_0475619_2069_2611 170
6 3300041507 Ga0451851_0377823 Ga0451851_0377823_71_613 170
7 3300041512 Ga0451853_1430482 Ga0451853_1430482_24_566 170
8 3300053104 Ga0500556_0167076 Ga0500556_0167076_225_788 183
9 iso_pu_bacteria 8057874678 8057875497 183
10 iso_pu_bacteria 2510917022 2511133709 184
11 iso_pu_bacteria 2582581307 2585270599 184
12 iso_pu_bacteria 2585427531 2585558304 184
13 iso_pu_bacteria 2585427609 2585904708 184
14 iso_pu_bacteria 2585428125 2587980176 184
15 iso_pu_bacteria 2775507049 2776913330 184
16 iso_pu_bacteria 2899803654 2899808943 184
17 3300028794 Ga0307515_10562408 Ga0307515_105624081 185
18 iso_pu_bacteria 2643221568 2643855523 185
19 iso_pu_bacteria 2838074704 2838079315 185
20 iso_pu_bacteria 2919166419 2919167716 185
21 iso_pu_bacteria 2920760137 2920765566 185
22 iso_pu_bacteria 2929138655 2929140614 185
23 iso_pu_bacteria 2978969890 2978974171 185
24 3300003781 Ga0055536_1004763 Ga0055536_10047634 186
25 3300003792 Ga0055540_1001884 Ga0055540_10018843 186
26 3300003794 Ga0055531_10001165 Ga0055531_100011659 186
27 3300025292 Ga0209676_1006026 Ga0209676_10060263 186
28 3300025297 Ga0209758_1000155 Ga0209758_100015587 186
29 3300025298 Ga0209050_1005095 Ga0209050_10050954 186
30 3300025304 Ga0209257_1003296 Ga0209257_10032969 186
31 3300028794 Ga0307515_10013773 Ga0307515_100137739 186
32 3300006353 Ga0075370_10006155 Ga0075370_100061556 188
33 3300025299 Ga0209256_1050657 Ga0209256_10506571 188
34 3300048925 Ga0496122_0009324 Ga0496122_0009324_9269_9838 188
35 3300053111 Ga0500572_002869 Ga0500572_002869_1118_1687 188
36 3300053177 Ga0500636_0000065 Ga0500636_0000065_41181_41750 188
37 3300053177 Ga0500636_0006580 Ga0500636_0006580_3461_4030 188
38 iso_pu_bacteria 2510917030 2511198269 188
39 iso_pu_bacteria 2582581308 2585276945 188
40 iso_pu_bacteria 2585427527 2585534749 188
41 iso_pu_bacteria 2585427530 2585551806 188
42 iso_pu_bacteria 2599185236 2599721200 188
43 iso_pu_bacteria 2818991453 2819638166 188
44 3300006051 Ga0075364_10033491 Ga0075364_100334914 189
45 3300013102 Ga0157371_10005765 Ga0157371_100057657 189
46 3300013105 Ga0157369_10509929 Ga0157369_105099292 189
47 3300048919 Ga0496116_0000043 Ga0496116_0000043_241985_242557 189
48 3300048920 Ga0496117_0038816 Ga0496117_0038816_248_820 189
49 3300048920 Ga0496117_0109558 Ga0496117_0109558_520_1092 189
50 3300048924 Ga0496121_0000003 Ga0496121_0000003_142650_143222 189
51 3300048925 Ga0496122_0089146 Ga0496122_0089146_24_596 189
52 3300048926 Ga0496123_0143613 Ga0496123_0143613_401_973 189
53 3300048927 Ga0496124_0447718 Ga0496124_0447718_259_831 189
54 3300048927 Ga0496124_0463339 Ga0496124_0463339_51_623 189
55 3300048928 Ga0496125_0000141 Ga0496125_0000141_63486_64058 189
56 3300048929 Ga0496126_0000362 Ga0496126_0000362_5002_5574 189
57 3300048929 Ga0496126_0251223 Ga0496126_0251223_497_1069 189
58 3300050491 nmdc:mga00v17_3753_c1 nmdc:mga00v17_3753_c1_4468_5040 189
59 iso_pu_bacteria 2582581298 2585225879 189
60 iso_pu_bacteria 2585427529 2585546839 189
61 iso_pu_bacteria 8056382006 8056387554 189
62 iso_pu_bacteria 2585427531 2585558303 190
63 iso_pu_bacteria 2585427609 2585904709 190
64 iso_pu_bacteria 2585428125 2587980175 190
65 iso_pu_bacteria 2643221618 2644109540 190
66 iso_pu_bacteria 2643221626 2644145224 190
67 iso_pu_bacteria 2643221655 2644307805 190
68 iso_pu_bacteria 2643221659 2644332581 190
69 iso_pu_bacteria 2643221698 2644544327 190
70 iso_pu_bacteria 2643221712 2644613894 190
71 iso_pu_bacteria 2844163670 2844170417 190
72 3300003214 JGI25165J46597_1014374 JGI25165J46597_10143742 192
73 3300005367 Ga0070667_100097202 Ga0070667_1000972023 192
74 3300005563 Ga0068855_100147887 Ga0068855_1001478875 192
75 3300005616 Ga0068852_100082239 Ga0068852_1000822394 192
76 3300025253 Ga0209677_101256 Ga0209677_1012569 192
77 3300025914 Ga0207671_10001291 Ga0207671_100012915 192
78 3300025949 Ga0207667_10314809 Ga0207667_103148092 192
79 3300026142 Ga0207698_10437206 Ga0207698_104372062 192
80 3300005548 Ga0070665_100537292 Ga0070665_1005372922 193
81 3300028379 Ga0268266_10279517 Ga0268266_102795173 193
82 3300046506 Ga0495583_0091176 Ga0495583_0091176_656_1243 193
83 3300046512 Ga0495610_0075657 Ga0495610_0075657_452_1039 193
84 3300046522 Ga0495643_0027496 Ga0495643_0027496_1258_1845 193
85 3300048909 Ga0496106_0004921 Ga0496106_0004921_5802_6389 193
86 3300048919 Ga0496116_0103446 Ga0496116_0103446_689_1276 193
87 3300048920 Ga0496117_0092882 Ga0496117_0092882_385_972 193
88 3300048924 Ga0496121_0074244 Ga0496121_0074244_811_1398 193
89 3300048925 Ga0496122_0055102 Ga0496122_0055102_1547_2134 193
90 3300048926 Ga0496123_0016748 Ga0496123_0016748_1166_1753 193
91 3300048927 Ga0496124_0056057 Ga0496124_0056057_172_759 193
92 3300053093 Ga0500651_0208329 Ga0500651_0208329_537_1124 193
93 3300053134 Ga0500658_0015794 Ga0500658_0015794_1077_1664 193
94 3300053139 Ga0500568_0016433 Ga0500568_0016433_1244_1831 193
95 3300053139 Ga0500568_0092220 Ga0500568_0092220_308_895 193
96 3300053151 Ga0500604_0021875 Ga0500604_0021875_995_1582 193
97 3300053156 Ga0500622_0002307 Ga0500622_0002307_11872_12459 193
98 3300053160 Ga0500633_0001613 Ga0500633_0001613_264_851 193
99 iso_pu_bacteria 2509276021 2509387058 193
100 iso_pu_bacteria 2510917022 2511133708 193
101 iso_pu_bacteria 2513237162 2514019900 193
102 iso_pu_bacteria 2515154134 2515738961 193
103 iso_pu_bacteria 2582581307 2585270598 193
104 iso_pu_bacteria 2582581315 2585324054 193
105 iso_pu_bacteria 2582581316 2585333552 193
106 iso_pu_bacteria 2585427528 2585540384 193
107 iso_pu_bacteria 2585427593 2585838583 193
108 iso_pu_bacteria 2615840624 2616292794 193
109 iso_pu_bacteria 2615840626 2616308318 193
110 iso_pu_bacteria 2615840698 2616556622 193
111 iso_pu_bacteria 2617270742 2617381669 193
112 iso_pu_bacteria 2667528174 2671115715 193
113 iso_pu_bacteria 2718217927 2719385434 193
114 iso_pu_bacteria 2718218423 2721399183 193
115 iso_pu_bacteria 2721755809 2724037996 193
116 iso_pu_bacteria 2738541333 2739038309 193
117 iso_pu_bacteria 2765235942 2766067896 193
118 iso_pu_bacteria 2775507266 2778176456 193
119 iso_pu_bacteria 2791355260 2793321228 193
120 iso_pu_bacteria 2791355264 2793347747 193
121 iso_pu_bacteria 2791355267 2793366429 193
122 iso_pu_bacteria 2802429633 2806045515 193
123 iso_pu_bacteria 2802429634 2806051680 193
124 iso_pu_bacteria 2802429635 2806061724 193
125 iso_pu_bacteria 2802429636 2806067905 193
126 iso_pu_bacteria 2818991448 2819610430 193
127 iso_pu_bacteria 2838022645 2838025505 193
128 iso_pu_bacteria 2838029111 2838034622 193
129 iso_pu_bacteria 2838686498 2838689107 193
130 iso_pu_bacteria 2838729681 2838730442 193
131 iso_pu_bacteria 2838742623 2838743383 193
132 iso_pu_bacteria 2841851746 2841854930 193
133 iso_pu_bacteria 2842156927 2842157792 193
134 iso_pu_bacteria 2842163707 2842165005 193
135 iso_pu_bacteria 2842180545 2842180624 193
136 iso_pu_bacteria 2842198810 2842201074 193
137 iso_pu_bacteria 2842229732 2842231325 193
138 iso_pu_bacteria 2842243621 2842244561 193
139 iso_pu_bacteria 2842257432 2842258374 193
140 iso_pu_bacteria 2842271015 2842273127 193
141 iso_pu_bacteria 2842475841 2842481369 193
142 iso_pu_bacteria 2842482326 2842487153 193
143 iso_pu_bacteria 2842502639 2842508269 193
144 iso_pu_bacteria 2844454524 2844459539 193
145 iso_pu_bacteria 2857516855 2857523699 193
146 iso_pu_bacteria 2919408235 2919409769 193
147 iso_pu_bacteria 2935901341 2935904840 193
148 iso_pu_bacteria 8005275841 8005280205 193
149 iso_pu_bacteria 8005307578 8005314558 193
150 iso_pu_bacteria 8005395548 8005397039 193
151 iso_pu_bacteria 8005484373 8005486617 193
152 iso_pu_bacteria 8005570704 8005575431 193
153 iso_pu_bacteria 8005645114 8005646241 193
154 iso_pu_bacteria 8005682033 8005686375 193
155 iso_pu_bacteria 8018127388 8018129557 193
156 iso_pu_bacteria 8046767195 8046770325 193
157 iso_pu_bacteria 8056375014 8056380141 193
158 iso_pu_bacteria 8057575449 8057578255 193
159 3300002737 JGI25162J39368_1002689 JGI25162J39368_10026895 194
160 3300003214 JGI25165J46597_1000777 JGI25165J46597_10007779 194
161 3300025231 Ga0207427_108564 Ga0207427_1085642 194
162 3300025233 Ga0209437_100310 Ga0209437_10031044 194
163 3300025261 Ga0209233_1000303 Ga0209233_100030344 194
164 iso_pu_bacteria 2510461076 2510894277 194
165 iso_pu_bacteria 2510461076 2510899302 194
166 iso_pu_bacteria 2513237103 2513710230 194
167 iso_pu_bacteria 2515154116 2515656240 194
168 iso_pu_bacteria 2516653077 2517035575 194
169 iso_pu_bacteria 2516653085 2517076034 194
170 iso_pu_bacteria 2585427526 2585528176 194
171 iso_pu_bacteria 2791355261 2793326357 194
172 iso_pu_bacteria 639633055 639648135 194
173 iso_pu_bacteria 8005382845 8005388006 194
174 iso_pu_bacteria 8018163183 8018168098 194
175 iso_pu_bacteria 8023680758 8023680972 194
176 iso_pu_bacteria 8024479707 8024485748 194
177 3300025297 Ga0209758_1001100 Ga0209758_100110032 195
178 3300025297 Ga0209758_1002445 Ga0209758_100244510 195
179 3300046507 Ga0495606_0001859 Ga0495606_0001859_24845_25435 196
180 3300047472 Ga0495686_0004865 Ga0495686_0004865_5435_6025 196
181 3300048924 Ga0496121_0027323 Ga0496121_0027323_754_1344 196
182 3300002737 JGI25162J39368_1000351 JGI25162J39368_100035146 197
183 3300002773 JGI25152J39213_1021392 JGI25152J39213_10213922 197
184 3300002987 JGI25159J45721_1002469 JGI25159J45721_10024696 197
185 3300003187 JGI25151J46595_10000238 JGI25151J46595_1000023811 197
186 3300003214 JGI25165J46597_1000189 JGI25165J46597_100018910 197
187 3300003316 rootH1_10027309 rootH1_100273093 197
188 3300003320 rootH2_10012004 rootH2_100120042 197
189 3300003322 rootL2_10034778 rootL2_100347784 197
190 3300003323 rootH1_10017647 rootH1_100176473 197
191 3300003323 rootH1_10033534 rootH1_100335343 197
192 3300003323 rootH1_10113295 rootH1_101132953 197
193 3300003354 JGI25160J50197_1000004 JGI25160J50197_100000492 197
194 3300003374 JGI25161J50226_1000003 JGI25161J50226_1000003336 197
195 3300003374 JGI25161J50226_1008427 JGI25161J50226_10084273 197
196 3300003771 Ga0055526_1000669 Ga0055526_100066915 197
197 3300003771 Ga0055526_1004202 Ga0055526_10042026 197
198 3300003775 Ga0055524_1004582 Ga0055524_10045825 197
199 3300003775 Ga0055524_1020725 Ga0055524_10207253 197
200 3300003790 Ga0055528_1000918 Ga0055528_100091810 197
201 3300003790 Ga0055528_1008737 Ga0055528_10087372 197
202 3300003790 Ga0055528_1016436 Ga0055528_10164363 197
203 3300003790 Ga0055528_1020888 Ga0055528_10208883 197
204 3300003792 Ga0055540_1026148 Ga0055540_10261482 197
205 3300003856 Ga0058692_1034228 Ga0058692_10342282 197
206 3300004625 Ga0055543_1000001 Ga0055543_1000001342 197
207 3300004625 Ga0055543_1000808 Ga0055543_100080810 197
208 3300005262 Ga0065165_1000049 Ga0065165_100004970 197
209 3300005262 Ga0065165_1024195 Ga0065165_10241953 197
210 3300005331 Ga0070670_100001443 Ga0070670_10000144311 197
211 3300005614 Ga0068856_100108448 Ga0068856_1001084482 197
212 3300006038 Ga0075365_10025732 Ga0075365_100257322 197
213 3300006048 Ga0075363_100012667 Ga0075363_1000126672 197
214 3300006048 Ga0075363_100100272 Ga0075363_1001002722 197
215 3300006051 Ga0075364_10188598 Ga0075364_101885982 197
216 3300006177 Ga0075362_10131862 Ga0075362_101318622 197
217 3300006177 Ga0075362_10161181 Ga0075362_101611812 197
218 3300006178 Ga0075367_10026480 Ga0075367_100264802 197
219 3300006178 Ga0075367_10348209 Ga0075367_103482092 197
220 3300006186 Ga0075369_10004806 Ga0075369_100048066 197
221 3300006195 Ga0075366_10003432 Ga0075366_100034325 197
222 3300006353 Ga0075370_10006155 Ga0075370_100061555 197
223 3300006353 Ga0075370_10070723 Ga0075370_100707232 197
224 3300009092 Ga0105250_10119080 Ga0105250_101190801 197
225 3300009093 Ga0105240_10000005 Ga0105240_10000005331 197
226 3300009545 Ga0105237_10002240 Ga0105237_1000224023 197
227 3300009551 Ga0105238_11429912 Ga0105238_114299121 197
228 3300010375 Ga0105239_10000739 Ga0105239_1000073924 197
229 3300013104 Ga0157370_10000284 Ga0157370_1000028413 197
230 3300013105 Ga0157369_10459447 Ga0157369_104594472 197
231 3300013306 Ga0163162_11873255 Ga0163162_118732551 197
232 3300014497 Ga0182008_10096962 Ga0182008_100969622 197
233 3300015262 Ga0182007_10007082 Ga0182007_100070827 197
234 3300015265 Ga0182005_1006191 Ga0182005_10061915 197
235 3300025233 Ga0209437_100160 Ga0209437_100160130 197
236 3300025245 Ga0207425_1021384 Ga0207425_10213843 197
237 3300025246 Ga0209646_1023998 Ga0209646_10239982 197
238 3300025254 Ga0209148_1011737 Ga0209148_10117372 197
239 3300025256 Ga0209759_1012005 Ga0209759_10120054 197
240 3300025258 Ga0209129_1000442 Ga0209129_10004427 197
241 3300025261 Ga0209233_1000168 Ga0209233_100016832 197
242 3300025261 Ga0209233_1000269 Ga0209233_100026957 197
243 3300025273 Ga0209673_1000139 Ga0209673_1000139126 197
244 3300025273 Ga0209673_1001538 Ga0209673_100153810 197
245 3300025273 Ga0209673_1002227 Ga0209673_10022275 197
246 3300025273 Ga0209673_1015353 Ga0209673_10153533 197
247 3300025284 Ga0209130_1000012 Ga0209130_100001292 197
248 3300025294 Ga0209025_1000237 Ga0209025_100023738 197
249 3300025295 Ga0209564_1000794 Ga0209564_100079432 197
250 3300025295 Ga0209564_1000868 Ga0209564_100086824 197
251 3300025297 Ga0209758_1000545 Ga0209758_100054532 197
252 3300025297 Ga0209758_1003692 Ga0209758_10036922 197
253 3300025299 Ga0209256_1001048 Ga0209256_100104821 197
254 3300025299 Ga0209256_1004371 Ga0209256_100437110 197
255 3300025299 Ga0209256_1021477 Ga0209256_10214771 197
256 3300025302 Ga0207426_1000010 Ga0207426_1000010451 197
257 3300025302 Ga0207426_1000094 Ga0207426_10000943 197
258 3300025303 Ga0209051_1001031 Ga0209051_100103110 197
259 3300025303 Ga0209051_1008543 Ga0209051_10085436 197
260 3300025913 Ga0207695_10000011 Ga0207695_10000011583 197
261 3300025925 Ga0207650_10002090 Ga0207650_100020907 197
262 3300026078 Ga0207702_10222409 Ga0207702_102224093 197
263 3300027312 Ga0209371_1001465 Ga0209371_100146512 197
264 3300030500 Ga0268256_1001794 Ga0268256_10017948 197
265 3300041453 Ga0451797_1375908 Ga0451797_1375908_197_793 197
266 3300041492 Ga0451835_0729785 Ga0451835_0729785_292_888 197
267 3300041494 Ga0451837_0388034 Ga0451837_0388034_460_1056 197
268 3300041501 Ga0451845_0513581 Ga0451845_0513581_869_1465 197
269 3300041503 Ga0451847_0867267 Ga0451847_0867267_1171_1767 197
270 3300041505 Ga0451849_1243659 Ga0451849_1243659_480_1076 197
271 3300041507 Ga0451851_0085356 Ga0451851_0085356_1507_2103 197
272 3300041509 Ga0451843_0556366 Ga0451843_0556366_148_744 197
273 3300041511 Ga0451855_0382238 Ga0451855_0382238_146_742 197
274 3300041512 Ga0451853_0114112 Ga0451853_0114112_710_1306 197
275 3300044694 Ga0466963_0014097 Ga0466963_0014097_555_1148 197
276 3300044765 Ga0466970_0005266 Ga0466970_0005266_2029_2622 197
277 3300044842 Ga0466957_0218632 Ga0466957_0218632_493_1086 197
278 3300046471 Ga0495650_0181029 Ga0495650_0181029_27_623 197
279 3300046474 Ga0495605_0157831 Ga0495605_0157831_26_622 197
280 3300046492 Ga0495585_0030296 Ga0495585_0030296_1142_1738 197
281 3300046492 Ga0495585_0098414 Ga0495585_0098414_579_1175 197
282 3300046501 Ga0495607_0089268 Ga0495607_0089268_925_1518 197
283 3300046507 Ga0495606_0084721 Ga0495606_0084721_931_1527 197
284 3300046512 Ga0495610_0010608 Ga0495610_0010608_3499_4095 197
285 3300046513 Ga0495616_0026034 Ga0495616_0026034_68_664 197
286 3300046519 Ga0495632_0017000 Ga0495632_0017000_938_1534 197
287 3300046522 Ga0495643_0001636 Ga0495643_0001636_4303_4899 197
288 3300046538 Ga0495609_0164128 Ga0495609_0164128_200_796 197
289 3300046542 Ga0495597_0205461 Ga0495597_0205461_106_702 197
290 3300046558 Ga0495633_0058720 Ga0495633_0058720_651_1247 197
291 3300046558 Ga0495633_0092907 Ga0495633_0092907_627_1220 197
292 3300046648 Ga0495611_0290130 Ga0495611_0290130_81_677 197
293 3300046660 Ga0495625_0044796 Ga0495625_0044796_1472_2068 197
294 3300046665 Ga0495661_0381952 Ga0495661_0381952_15_611 197
295 3300046691 Ga0495670_0182488 Ga0495670_0182488_407_1003 197
296 3300046694 Ga0495649_0122502 Ga0495649_0122502_69_665 197
297 3300047318 Ga0495636_0044906 Ga0495636_0044906_1078_1671 197
298 3300047443 Ga0495687_113901 Ga0495687_113901_250_846 197
299 3300047470 Ga0495681_0038886 Ga0495681_0038886_1260_1853 197
300 3300047470 Ga0495681_0233249 Ga0495681_0233249_31_627 197
301 3300047472 Ga0495686_0131954 Ga0495686_0131954_768_1364 197
302 3300048903 Ga0496100_0012838 Ga0496100_0012838_747_1340 197
303 3300048904 Ga0496101_0136825 Ga0496101_0136825_1233_1826 197
304 3300048905 Ga0496102_0008570 Ga0496102_0008570_3327_3920 197
305 3300048906 Ga0496103_0010686 Ga0496103_0010686_3218_3811 197
306 3300048909 Ga0496106_0163764 Ga0496106_0163764_260_853 197
307 3300048916 Ga0496113_0169563 Ga0496113_0169563_925_1518 197
308 3300048919 Ga0496116_0008089 Ga0496116_0008089_5344_5937 197
309 3300048919 Ga0496116_0118388 Ga0496116_0118388_509_1102 197
310 3300048920 Ga0496117_0000338 Ga0496117_0000338_52150_52743 197
311 3300048920 Ga0496117_0231398 Ga0496117_0231398_204_797 197
312 3300048921 Ga0496118_0000958 Ga0496118_0000958_29958_30551 197
313 3300048921 Ga0496118_0224170 Ga0496118_0224170_306_899 197
314 3300048922 Ga0496119_0004440 Ga0496119_0004440_10455_11048 197
315 3300048922 Ga0496119_0014110 Ga0496119_0014110_3798_4391 197
316 3300048922 Ga0496119_0063325 Ga0496119_0063325_1259_1852 197
317 3300048923 Ga0496120_0001472 Ga0496120_0001472_9998_10591 197
318 3300048923 Ga0496120_0026172 Ga0496120_0026172_2310_2903 197
319 3300048923 Ga0496120_0070491 Ga0496120_0070491_315_908 197
320 3300048924 Ga0496121_0002723 Ga0496121_0002723_10815_11408 197
321 3300048924 Ga0496121_0044344 Ga0496121_0044344_2739_3332 197
322 3300048925 Ga0496122_0018139 Ga0496122_0018139_1450_2043 197
323 3300048925 Ga0496122_0034794 Ga0496122_0034794_3152_3745 197
324 3300048926 Ga0496123_0012797 Ga0496123_0012797_3157_3750 197
325 3300048926 Ga0496123_0034231 Ga0496123_0034231_2372_2965 197
326 3300048927 Ga0496124_0025002 Ga0496124_0025002_860_1453 197
327 3300048928 Ga0496125_0027520 Ga0496125_0027520_1390_1983 197
328 3300048929 Ga0496126_0034554 Ga0496126_0034554_2377_2970 197
329 3300049571 Ga0501034_0570997 Ga0501034_0570997_68_673 197
330 3300049579 Ga0501043_0128235 Ga0501043_0128235_701_1306 197
331 3300049581 Ga0501047_0140440 Ga0501047_0140440_383_988 197
332 3300049589 Ga0501073_0324260 Ga0501073_0324260_224_829 197
333 3300049744 Ga0501083_0008060 Ga0501083_0008060_1199_1804 197
334 3300050489 nmdc:mga03683_151042_c1 nmdc:mga03683_151042_c1_229_822 197
335 3300050489 nmdc:mga03683_175042_c1 nmdc:mga03683_175042_c1_278_874 197
336 3300050490 nmdc:mga03n38_3751_c1 nmdc:mga03n38_3751_c1_4049_4645 197
337 3300050490 nmdc:mga03n38_65686_c1 nmdc:mga03n38_65686_c1_544_1137 197
338 3300050492 nmdc:mga0yw44_94644_c1 nmdc:mga0yw44_94644_c1_1019_1615 197
339 3300050493 nmdc:mga0k408_126867_c1 nmdc:mga0k408_126867_c1_280_876 197
340 3300050493 nmdc:mga0k408_127554_c1 nmdc:mga0k408_127554_c1_607_1200 197
341 3300050494 nmdc:mga06z11_106612_c1 nmdc:mga06z11_106612_c1_169_765 197
342 3300050494 nmdc:mga06z11_41928_c1 nmdc:mga06z11_41928_c1_1085_1681 197
343 3300050496 nmdc:mga07m45_10513_c1 nmdc:mga07m45_10513_c1_1180_1776 197
344 3300050496 nmdc:mga07m45_200148_c1 nmdc:mga07m45_200148_c1_496_1089 197
345 3300050516 nmdc:mga0sz30_7864_c1 nmdc:mga0sz30_7864_c1_27_623 197
346 3300053086 Ga0500578_0108162 Ga0500578_0108162_503_1099 197
347 3300053118 Ga0500594_0089701 Ga0500594_0089701_55_651 197
348 3300053122 Ga0500608_017972 Ga0500608_017972_2302_2895 197
349 3300053125 Ga0500618_012813 Ga0500618_012813_625_1272 197
350 3300053153 Ga0500616_0043680 Ga0500616_0043680_134_730 197
351 3300053177 Ga0500636_0114689 Ga0500636_0114689_885_1478 197
352 3300060353 Ga0501082_0385991 Ga0501082_0385991_142_747 197
353 iso_pu_bacteria 2510065019 2510132905 197
354 iso_pu_bacteria 8005314921 8005317319 197

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ndp-assembly2.cif.gz_B crystal structure of human ak4(l171p) 0.6865 25 113
1rkb-assembly1.cif.gz_A the structure of adrenal gland protein ad-004 0.6663 26 191
4cvn-assembly1.cif.gz_D structure of the fap7-rps14 complex 0.6599 28 191
1kag-assembly2.cif.gz_B crystal structure of the escherichia coli shikimate kinase i (arok) 0.6527 27 193
1ukz-assembly1.cif.gz_A substrate specificity and assembly of catalytic center derived from two structures of ligated uridylate kinase 0.651 27 191
ID Description Score Start End Superfamily
af_Q9UU88_2_175_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6985 26 191 3.40.50.300
3ndpB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6865 25 113 3.40.50.300
af_A0A2R9YJL3_1233_1444_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6863 29 192 3.40.50.300
af_Q5TCS8_1409_1601_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6825 28 193 3.40.50.300
af_Q556J1_15_364_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6706 29 102 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2U2DQK7-F1-model_v4 AAA family ATPase 0.9911 11 193
AF-A0A7W5X7L3-F1-model_v4 Adenylate kinase family enzyme 0.9852 43 197 GO:0016301
AF-A0A0Q7NY37-F1-model_v4 AAA family ATPase 0.9849 8 196
AF-A0A2T7VI87-F1-model_v4 deleted 0.9844 12 193
AF-A0A7K1Q9X1-F1-model_v4 deleted 0.9843 12 196

Feature Viewer

pLDDT pTM Quality
94.09 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map