F419947

General Info

Members Datasets Scaffolds Average Seq Length
354 295 708 486

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2508501114|2509074699
Length 504
Sequence VLIRIDRMFDLKPEFLQSVSNLEALEHRLAEDLSLLEIPPKEWVPASEYEGARILDVVIIGAGMCGLVAAAALKMLGIHNIVCVDRAPKGLEGPWVTFARMETLRSPKQLTGPALGLPALTFRAWYVAQFGTNAWEQLGKIPKNQWMDYLIWYRKVFALPVRNLVSVMNIEPVHDDLLALNVIDSGSGKAETLYARHVVLATGRDGLGGSYVPEFVESVPRKFWAHSADDIDFDALREKRVAVVGAGASAMDNAATALEAGAAKVDMIIRRKDLPRINKFTGIASQGVVQGFAGLSDEWKWKFLEHTLGAQTPPPRDSTLRVSRHPNSRFLLGTAVRGMHEEPESVVLKTSCGDLEYDFVIFATGFRVDLDRRPELVKFAPFIRFWKDVFTPEPGMENGELASSPYLGADFEFLERVPGSCPSLRLVHCFNYQATLSHGKLSGDIPAVSDGGRRLARGIARSLFVADRETHFANLVAFETPELLGDEWTDAAAAIADLQRGAAE

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
14 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
15 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
16 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
17 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
18 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
43 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
49 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
50 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
55 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
60 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
61 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
62 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
65 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
66 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
67 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
70 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
72 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
74 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
95 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
96 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
99 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
102 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
103 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
104 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
105 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
108 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
109 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
110 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
111 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
112 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
113 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
114 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
115 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
116 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
117 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
118 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
119 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
120 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
121 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
122 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
123 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
124 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
127 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
128 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
129 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
132 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
133 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
134 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
135 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
136 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
137 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
138 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
139 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
140 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
141 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
142 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
143 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
144 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
145 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
146 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
147 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
148 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
149 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
150 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
151 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
152 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
153 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
154 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
155 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
156 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
157 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
158 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
159 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
160 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
161 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
162 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
163 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
164 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
165 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
166 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
167 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
168 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
169 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
170 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
171 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
172 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
173 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
174 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
175 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
176 2519103095 Burkholderia sp. KJ006 Isolate Nodule
177 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
178 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
179 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
180 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
181 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
182 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
183 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
184 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
185 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
186 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
187 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
188 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
189 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
190 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
191 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
192 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
193 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
194 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
195 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
196 2643221736 Bosea sp. Root483D1 Isolate Unclassified
197 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
198 2718217882 Rhizobium sp. N741 Isolate Nodule
199 2718218009 Rhizobium sp. N561 Isolate Nodule
200 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
201 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
202 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
203 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
204 2718218363 Rhizobium sp. N113 Isolate Nodule
205 2718218365 Rhizobium sp. N731 Isolate Nodule
206 2718218366 Rhizobium sp. N621 Isolate Nodule
207 2721755514 Rhizobium sp. N6212 Isolate Nodule
208 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
209 2721755810 Rhizobium sp. N871 Isolate Nodule
210 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
211 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
212 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
213 2728369365 Rhizobium sp. N1341 Isolate Nodule
214 2728369397 Rhizobium sp. N1314 Isolate Nodule
215 2738541293 Rhizobium sp. GV031 Isolate Unclassified
216 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
217 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
218 2791355260 Rhizobium sp. L9 Isolate Nodule
219 2791355264 Rhizobium sp. S9 Isolate Nodule
220 2791355267 Rhizobium sp. L18 Isolate Nodule
221 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
222 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
223 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
224 2818991452 Burkholderia cepacia 561 Isolate Unclassified
225 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
226 2818991467 Bosea vestrisii 3192 Isolate Unclassified
227 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
228 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
229 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
230 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
231 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
232 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
233 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
234 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
235 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
236 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
237 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
238 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
239 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
240 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
241 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
242 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
243 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
244 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
245 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
246 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
247 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
248 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
249 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
250 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
251 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
252 2904564687 Burkholderia sp. 571 Isolate Unclassified
253 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
254 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
255 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
256 2928163908 Burkholderia sp. 567 Isolate Unclassified
257 2928170801 Burkholderia sp. 572 Isolate Unclassified
258 2928536128 Burkholderia sola 565 Isolate Unclassified
259 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
260 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
261 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
262 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
263 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
264 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
265 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
266 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
267 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
268 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
269 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
270 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
271 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
272 2936381700 Rhizobium chutanense C16 Isolate Unclassified
273 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
274 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
275 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
276 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
277 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
278 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
279 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
280 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
281 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
282 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
283 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
284 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
285 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
286 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
287 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
288 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
289 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
290 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
291 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
292 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
293 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
294 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
295 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 59.32
Metatranscriptomes 0
Isolates 40.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.06
Nodule 28.25
Rhizoplane 4.24
Rhizosphere 25.99
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10013817 3300001989 Bacteria 2943
2 JGI25155J39150_1000017 3300002704 Bacteria 159274
3 JGI25156J39149_1000034 3300002705 Bacteria 114036
4 JGI25154J39366_1000034 3300002738 Bacteria 176764
5 JGI25157J39369_1000092 3300002741 Bacteria 76674
6 JGI25152J39213_1000262 3300002773 Bacteria 35191
7 JGI25150J39212_1000184 3300002774 Bacteria 35191
8 JGI25159J45721_1008226 3300002987 Bacteria 2890
9 JGI25151J46595_10000536 3300003187 Bacteria 35191
10 JGI25153J46596_10001879 3300003215 Bacteria 12437
11 JGI25153J46596_10008209 3300003215 Bacteria 5023
12 JGI25153J46596_10016071 3300003215 Bacteria 3019
13 JGI25153J46596_10024374 3300003215 Bacteria 2183
14 rootH2_10027200 3300003320 Bacteria 4021
15 rootH1_10232535 3300003323 Bacteria 3768
16 Ga0055532_1000930 3300003758 Bacteria 9472
17 Ga0055532_1000931 3300003758 Bacteria 9460
18 Ga0055532_1001199 3300003758 Bacteria 7733
19 Ga0055527_1000350 3300003760 Bacteria 22800
20 Ga0055535_1000781 3300003761 Bacteria 23313
21 Ga0055535_1000800 3300003761 Bacteria 22800
22 Ga0055542_1000565 3300003762 Bacteria 32556
23 Ga0055542_1003745 3300003762 Bacteria 3970
24 Ga0055529_1000183 3300003763 Bacteria 86414
25 Ga0055529_1002545 3300003763 Bacteria 3445
26 Ga0055528_1002150 3300003790 Bacteria 10832
27 Ga0065165_1005325 3300005262 Bacteria 7312
28 Ga0070666_10046480 3300005335 Bacteria 2912
29 Ga0068868_100096749 3300005338 Bacteria 2385
30 Ga0070668_100056533 3300005347 Bacteria 3031
31 Ga0070671_100009773 3300005355 Bacteria 7703
32 Ga0070709_10001346 3300005434 Bacteria 13400
33 Ga0070714_100003028 3300005435 Bacteria 12463
34 Ga0070713_100015736 3300005436 Bacteria 5667
35 Ga0070710_10000695 3300005437 Bacteria 16014
36 Ga0070711_100008370 3300005439 Bacteria 6336
37 Ga0070663_100013530 3300005455 Bacteria 5208
38 Ga0068855_100056190 3300005563 Bacteria 4619
39 Ga0068855_100088976 3300005563 Bacteria 3566
40 Ga0068857_100098227 3300005577 Bacteria 2626
41 Ga0068860_100002365 3300005843 Bacteria 19823
42 Ga0068860_100110199 3300005843 Bacteria 2631
43 Ga0081540_1003964 3300005983 Bacteria 11501
44 Ga0075363_100001177 3300006048 Bacteria 9619
45 Ga0070715_10010564 3300006163 Bacteria 3295
46 Ga0070716_100000819 3300006173 Bacteria 13393
47 Ga0070712_100005702 3300006175 Bacteria 7700
48 Ga0075367_10005537 3300006178 Bacteria 6288
49 Ga0075369_10010092 3300006186 Bacteria 3689
50 Ga0075366_10009348 3300006195 Bacteria 5470
51 Ga0075370_10002196 3300006353 Bacteria 8958
52 Ga0075370_10010121 3300006353 Bacteria 4918
53 Ga0099824_1014944 3300006942 Bacteria 7531
54 Ga0099822_1043851 3300006943 Bacteria 2248
55 Ga0105240_10001873 3300009093 Bacteria 34963
56 Ga0105247_10026913 3300009101 Bacteria 3476
57 Ga0105248_10233359 3300009177 Bacteria 2071
58 Ga0105237_10014938 3300009545 Bacteria 8095
59 Ga0123340_1000571 3300009763 Bacteria 25557
60 Ga0123341_1000022 3300009765 Bacteria 78887
61 Ga0123341_1000694 3300009765 Bacteria 22335
62 Ga0123342_1022104 3300009766 Bacteria 4360
63 Ga0105239_10047226 3300010375 Bacteria 4719
64 Ga0105239_10236166 3300010375 Bacteria 2052
65 Ga0105246_10005128 3300011119 Bacteria 7963
66 Ga0163163_10026108 3300014325 Bacteria 5578
67 Ga0209435_100023 3300025206 Bacteria 201972
68 Ga0209566_100450 3300025225 Bacteria 30354
69 Ga0209672_100012 3300025228 Bacteria 795742
70 Ga0209672_100030 3300025228 Bacteria 337051
71 Ga0209147_100007 3300025229 Bacteria 795684
72 Ga0209147_100036 3300025229 Bacteria 337052
73 Ga0209147_100074 3300025229 Bacteria 208743
74 Ga0209258_100014 3300025242 Bacteria 720132
75 Ga0209258_100056 3300025242 Bacteria 337051
76 Ga0207425_1000101 3300025245 Bacteria 80528
77 Ga0209646_1000080 3300025246 Bacteria 201975
78 Ga0209026_1000076 3300025250 Bacteria 201975
79 Ga0209677_103559 3300025253 Bacteria 4964
80 Ga0209148_1000178 3300025254 Bacteria 126383
81 Ga0209148_1000287 3300025254 Bacteria 75762
82 Ga0209148_1004664 3300025254 Bacteria 3313
83 Ga0209759_1000059 3300025256 Bacteria 201975
84 Ga0209129_1000196 3300025258 Bacteria 80528
85 Ga0209233_1000216 3300025261 Bacteria 108123
86 Ga0209233_1004463 3300025261 Bacteria 4753
87 Ga0209455_1000061 3300025272 Bacteria 337052
88 Ga0209455_1001002 3300025272 Bacteria 14251
89 Ga0209673_1000046 3300025273 Bacteria 289907
90 Ga0209673_1001639 3300025273 Bacteria 19361
91 Ga0209130_1000106 3300025284 Bacteria 134559
92 Ga0209676_1017112 3300025292 Bacteria 2580
93 Ga0209025_1000450 3300025294 Bacteria 80528
94 Ga0209564_1000416 3300025295 Bacteria 74830
95 Ga0209758_1001075 3300025297 Bacteria 35521
96 Ga0209758_1001089 3300025297 Bacteria 35245
97 Ga0209758_1002625 3300025297 Bacteria 17862
98 Ga0209050_1010417 3300025298 Bacteria 4586
99 Ga0209256_1000550 3300025299 Bacteria 53839
100 Ga0209256_1009636 3300025299 Bacteria 4195
101 Ga0209051_1001073 3300025303 Bacteria 25371
102 Ga0209257_1001332 3300025304 Bacteria 29987
103 Ga0207692_10000754 3300025898 Bacteria 11446
104 Ga0207647_10002023 3300025904 Bacteria 15494
105 Ga0207647_10002595 3300025904 Bacteria 13666
106 Ga0207685_10009740 3300025905 Bacteria 2803
107 Ga0207699_10000406 3300025906 Bacteria 22137
108 Ga0207695_10000171 3300025913 Bacteria 191448
109 Ga0207693_10022641 3300025915 Bacteria 4991
110 Ga0207663_10004754 3300025916 Bacteria 6784
111 Ga0207700_10012422 3300025928 Bacteria 5491
112 Ga0207664_10010442 3300025929 Bacteria 6557
113 Ga0207665_10002155 3300025939 Bacteria 13329
114 Ga0207711_10021154 3300025941 Bacteria 5434
115 Ga0207667_10015080 3300025949 Bacteria 8788
116 Ga0207667_10078083 3300025949 Bacteria 3432
117 Ga0207677_10067568 3300026023 Bacteria 2505
118 Ga0207678_10038902 3300026067 Bacteria 4130
119 Ga0207674_10111335 3300026116 Bacteria 2712
120 Ga0209371_1000213 3300027312 Bacteria 79996
121 Ga0209589_1000035 3300027357 Bacteria 134091
122 Ga0209489_100079 3300027361 Bacteria 134091
123 Ga0209700_100077 3300027363 Bacteria 134091
124 Ga0268264_10000049 3300028381 Bacteria 329992
125 Ga0268256_1000170 3300030500 Bacteria 79996
126 Ga0307509_10005665 3300031507 Bacteria 17241
127 Ga0307408_100083927 3300031548 Bacteria 2388
128 Ga0307508_10000049 3300031616 Bacteria 137413
129 Ga0307508_10028784 3300031616 Bacteria 5024
130 Ga0307516_10001750 3300031730 Bacteria 29876
131 Ga0307516_10007205 3300031730 Bacteria 12831
132 Ga0307516_10009088 3300031730 Bacteria 11131
133 Ga0307405_10001289 3300031731 Bacteria 10464
134 Ga0307406_10036283 3300031901 Bacteria 3037
135 Ga0307412_10003452 3300031911 Bacteria 8784
136 Ga0307412_10028747 3300031911 Bacteria 3482
137 Ga0307416_100045894 3300032002 Bacteria 3444
138 Ga0307507_10028256 3300033179 Bacteria 5983
139 Ga0373925_0062732 3300037068 Bacteria 2795
140 Ga0451833_1259560 3300041491 Bacteria 3355
141 Ga0451837_0879995 3300041494 Bacteria 2327
142 Ga0451849_0727994 3300041505 Bacteria 2726
143 Ga0451851_0109300 3300041507 Bacteria 2479
144 Ga0495638_0002208 3300046460 Bacteria 16239
145 Ga0495580_0001516 3300046472 Bacteria 20427
146 Ga0495605_0032483 3300046474 Bacteria 2657
147 Ga0495585_0032130 3300046492 Bacteria 2975
148 Ga0495606_0015925 3300046507 Bacteria 5765
149 Ga0495606_0170703 3300046507 Bacteria 1262
150 Ga0495616_0073614 3300046513 Bacteria 1648
151 Ga0495643_0012353 3300046522 Bacteria 5155
152 Ga0495622_0010106 3300046557 Bacteria 4367
153 Ga0495660_0028022 3300046810 Bacteria 3185
154 Ga0495683_0059737 3300047323 Bacteria 1891
155 Ga0495687_011470 3300047443 Bacteria 4762
156 Ga0496101_0120202 3300048904 Bacteria 1985
157 Ga0496102_0020021 3300048905 Bacteria 5904
158 Ga0496103_0005249 3300048906 Bacteria 7778
159 Ga0496104_0001333 3300048907 Bacteria 21343
160 Ga0496104_0051485 3300048907 Bacteria 3886
161 Ga0496105_0000389 3300048908 Bacteria 28863
162 Ga0496106_0061803 3300048909 Bacteria 2843
163 Ga0496109_0032597 3300048912 Bacteria 4684
164 Ga0496112_0040181 3300048915 Bacteria 4573
165 Ga0496113_0047703 3300048916 Bacteria 3184
166 Ga0496116_0000540 3300048919 Bacteria 50890
167 Ga0496116_0010145 3300048919 Bacteria 7931
168 Ga0496116_0021739 3300048919 Bacteria 4828
169 Ga0496116_0031297 3300048919 Bacteria 3812
170 Ga0496117_0007537 3300048920 Bacteria 10609
171 Ga0496117_0007836 3300048920 Bacteria 10274
172 Ga0496117_0052632 3300048920 Bacteria 2866
173 Ga0496118_0006819 3300048921 Bacteria 12392
174 Ga0496118_0008468 3300048921 Bacteria 10625
175 Ga0496118_0008781 3300048921 Bacteria 10362
176 Ga0496118_0013065 3300048921 Bacteria 7895
177 Ga0496118_0032248 3300048921 Bacteria 4321
178 Ga0496119_0009377 3300048922 Bacteria 8413
179 Ga0496119_0016068 3300048922 Bacteria 5717
180 Ga0496119_0037697 3300048922 Bacteria 3136
181 Ga0496119_0058205 3300048922 Bacteria 2330
182 Ga0496119_0060232 3300048922 Bacteria 2274
183 Ga0496121_0000998 3300048924 Bacteria 50597
184 Ga0496121_0072477 3300048924 Bacteria 2765
185 Ga0496122_0017935 3300048925 Bacteria 6570
186 Ga0496122_0038865 3300048925 Bacteria 3803
187 Ga0496122_0088446 3300048925 Bacteria 2123
188 Ga0496123_0010413 3300048926 Bacteria 8221
189 Ga0496124_0000111 3300048927 Bacteria 166285
190 Ga0496124_0005318 3300048927 Bacteria 14551
191 Ga0496124_0010109 3300048927 Bacteria 9614
192 Ga0496124_0037947 3300048927 Bacteria 4185
193 Ga0496125_0026477 3300048928 Bacteria 5283
194 Ga0496125_0041210 3300048928 Bacteria 3951
195 Ga0496125_0055560 3300048928 Bacteria 3224
196 Ga0496126_0052668 3300048929 Bacteria 3697
197 nmdc:mga07m45_12288_c1 3300050496 Bacteria 4522
198 Ga0495655_0022256 3300053083 Bacteria 1446
199 Ga0500618_000243 3300053125 Bacteria 43364
200 Ga0500618_010210 3300053125 Bacteria 2526
201 Ga0500658_0000540 3300053134 Bacteria 15962
202 Ga0500573_0001274 3300053140 Bacteria 11902
203 Ga0500616_0000094 3300053153 Bacteria 181038
204 Ga0500616_0000416 3300053153 Bacteria 57074
205 Ga0500616_0020274 3300053153 Bacteria 3736
206 Ga0500616_0026836 3300053153 Bacteria 3184
207 Ga0500622_0041541 3300053156 Bacteria 2394
208 Ga0500634_0000035 3300053161 Bacteria 71073
209 Ga0500636_0147074 3300053177 Bacteria 1297
210 Ga0500596_001960 3300053735 Bacteria 4126
211 2509074699 2508501114 Bacteria 7082538
212 2508695831 2508501042 Bacteria 8719808
213 2509447450 2509276033 Bacteria 7180565
214 2510898027 2510461076 Bacteria 8618824
215 2511134367 2510917022 Bacteria 6504556
216 2511171966 2510917026 Bacteria 7046020
217 2513579140 2513237085 Bacteria 7695351
218 2513598889 2513237088 Bacteria 6927906
219 2513599175 2513237088 Bacteria 6927906
220 2513651947 2513237095 Bacteria 8976980
221 2513711725 2513237103 Bacteria 7647401
222 2513722664 2513237104 Bacteria 10034502
223 2513909095 2513237144 Bacteria 7530820
224 2514023347 2513237162 Bacteria 7468464
225 2515110665 2515075009 Bacteria 7288508
226 2515623970 2515154112 Bacteria 8294334
227 2515637952 2515154113 Bacteria 7807172
228 2515645878 2515154114 Bacteria 7848616
229 2515660642 2515154116 Bacteria 7552979
230 2515742831 2515154134 Bacteria 7220242
231 2517039366 2516653077 Bacteria 7555578
232 2517079607 2516653085 Bacteria 7346596
233 2517093541 2517093000 Bacteria 7412387
234 2517405239 2517287029 Bacteria 6905599
235 2519461025 2519103095 Bacteria 6629912
236 2535517928 2534681796 Bacteria 7146037
237 2585203422 2582581294 Bacteria 6626667
238 2585274592 2582581307 Bacteria 6597605
239 2585289924 2582581311 Bacteria 6763856
240 2585326808 2582581315 Bacteria 7318924
241 2585333082 2582581316 Bacteria 7774528
242 2585400546 2582581867 Bacteria 7184437
243 2585528556 2585427526 Bacteria 7258840
244 2585555463 2585427530 Bacteria 7383882
245 2585561974 2585427531 Bacteria 6992870
246 2585819892 2585427590 Bacteria 6824633
247 2585907715 2585427609 Bacteria 6667127
248 2585993064 2585427633 Bacteria 6413184
249 2586003799 2585427634 Bacteria 6455027
250 2587983137 2585428125 Bacteria 6662905
251 2599735777 2599185239 Bacteria 8686614
252 2599743669 2599185240 Bacteria 7968121
253 2600209217 2599185355 Bacteria 7968906
254 2616555271 2615840698 Bacteria 7319877
255 2644744004 2643221736 Bacteria 6608466
256 2676742544 2675903129 Bacteria 7964495
257 2719183734 2718217882 Bacteria 6556348
258 2719728175 2718218009 Bacteria 6478651
259 2720614367 2718218232 Bacteria 6720332
260 2720621139 2718218233 Bacteria 6662049
261 2720632467 2718218235 Bacteria 6630699
262 2720776189 2718218269 Bacteria 6906114
263 2721145036 2718218363 Bacteria 6524337
264 2721155773 2718218365 Bacteria 6274507
265 2721167123 2718218366 Bacteria 6425255
266 2722838101 2721755514 Bacteria 6424414
267 2723568039 2721755685 Bacteria 6704835
268 2724042369 2721755810 Bacteria 6479005
269 2724090796 2721755819 Bacteria 6906405
270 2724105304 2721755822 Bacteria 6726041
271 2728751290 2728368998 Bacteria 8720350
272 2730161874 2728369365 Bacteria 6555560
273 2730300880 2728369397 Bacteria 6274511
274 2738804072 2738541293 Bacteria 7065685
275 2770199270 2767802442 Bacteria 5747986
276 2793314222 2791355259 Bacteria 7254731
277 2793324072 2791355260 Bacteria 6598818
278 2793346209 2791355264 Bacteria 6429314
279 2793364919 2791355267 Bacteria 7222458
280 2817259129 2816332253 Bacteria 6764532
281 2817452356 2816332286 Bacteria 6853759
282 2818239205 2816332527 Bacteria 8933356
283 2819630182 2818991452 Bacteria 8442785
284 2819642295 2818991453 Bacteria 7181617
285 2819721533 2818991467 Bacteria 5893227
286 2838025064 2838022645 Bacteria 6494267
287 2838692343 2838686498 Bacteria 7807632
288 2838732561 2838729681 Bacteria 7400765
289 2838745456 2838742623 Bacteria 7396178
290 2841855100 2841851746 Bacteria 7532261
291 2842112460 2842110456 Bacteria 7656360
292 2842161870 2842156927 Bacteria 6894975
293 2842169247 2842163707 Bacteria 6916235
294 2842185487 2842180545 Bacteria 6888678
295 2842203264 2842198810 Bacteria 6608673
296 2842218545 2842217011 Bacteria 7497767
297 2842233425 2842229732 Bacteria 7475766
298 2842249645 2842243621 Bacteria 7421798
299 2842261714 2842257432 Bacteria 7401195
300 2842276812 2842271015 Bacteria 7807131
301 2842306220 2842304105 Bacteria 7023636
302 2842330361 2842324504 Bacteria 9364110
303 2842355022 2842348783 Bacteria 9002918
304 2842460418 2842454564 Bacteria 8730687
305 2842779895 2842775625 Bacteria 5587290
306 2844455715 2844454524 Bacteria 7952546
307 2863423458 2863421361 Bacteria 7300805
308 2870074620 2870068957 Bacteria 8925310
309 2888379160 2888378607 Bacteria 9652610
310 2894772454 2894772417 Bacteria 5305674
311 2904569675 2904564687 Bacteria 7609577
312 2904576986 2904571731 Bacteria 7608790
313 2919174016 2919171160 Bacteria 6499771
314 2923561334 2923556063 Bacteria 6793593
315 2928165702 2928163908 Bacteria 7561269
316 2928173852 2928170801 Bacteria 8785406
317 2928536925 2928536128 Bacteria 7657547
318 2933573289 2933570622 Bacteria 7023390
319 2933587789 2933586486 Bacteria 7667493
320 2935649014 2935648319 Bacteria 8801166
321 2935658214 2935656913 Bacteria 8965014
322 2935907405 2935901341 Bacteria 7341747
323 2935966465 2935959822 Bacteria 7869783
324 2935982163 2935975950 Bacteria 8347125
325 2935985299 2935984226 Bacteria 8302647
326 2936012433 2936011229 Bacteria 8801034
327 2936020486 2936019824 Bacteria 8804134
328 2936029726 2936028420 Bacteria 8965941
329 2936051809 2936046547 Bacteria 8903709
330 2936056937 2936055302 Bacteria 8785755
331 2936387093 2936381700 Bacteria 7006523
332 2981990942 2981990288 Bacteria 7590678
333 3005452101 3005445848 Bacteria 6906074
334 3005595394 3005594810 Bacteria 8716512
335 639646922 639633055 Bacteria 7751309
336 642418728 641736154 Bacteria 7689995
337 8005311005 8005307578 Bacteria 7395396
338 8005461307 8005460587 Bacteria 7157962
339 8005548800 8005542996 Bacteria 7077758
340 8005630091 8005626139 Bacteria 6534237
341 8005685679 8005682033 Bacteria 6726518
342 8018853003 8018845410 Bacteria 8933938
343 8019640826 8019638758 Bacteria 9062356
344 8019676367 8019668869 Bacteria 8791617
345 8019679627 8019678201 Bacteria 8863603
346 8020808969 8020807995 Bacteria 6801506
347 8020953023 8020945358 Bacteria 8467355
348 8021121272 8021120328 Bacteria 8782274
349 8023683975 8023680758 Bacteria 7729763
350 8039101940 8039098773 Bacteria 6602928
351 8040167854 8040167225 Bacteria 6542727
352 8040173553 8040173305 Bacteria 6827067
353 8056379119 8056375014 Bacteria 7006639
354 8057881201 8057874678 Bacteria 7494653
355 JGI24739J22299_10013817
356 JGI25155J39150_1000017
357 JGI25156J39149_1000034
358 JGI25154J39366_1000034
359 JGI25157J39369_1000092
360 JGI25152J39213_1000262
361 JGI25150J39212_1000184
362 JGI25159J45721_1008226
363 JGI25151J46595_10000536
364 JGI25153J46596_10001879
365 JGI25153J46596_10008209
366 JGI25153J46596_10016071
367 JGI25153J46596_10024374
368 rootH2_10027200
369 rootH1_10232535
370 Ga0055532_1000930
371 Ga0055532_1000931
372 Ga0055532_1001199
373 Ga0055527_1000350
374 Ga0055535_1000781
375 Ga0055535_1000800
376 Ga0055542_1000565
377 Ga0055542_1003745
378 Ga0055529_1000183
379 Ga0055529_1002545
380 Ga0055528_1002150
381 Ga0065165_1005325
382 Ga0070666_10046480
383 Ga0068868_100096749
384 Ga0070668_100056533
385 Ga0070671_100009773
386 Ga0070709_10001346
387 Ga0070714_100003028
388 Ga0070713_100015736
389 Ga0070710_10000695
390 Ga0070711_100008370
391 Ga0070663_100013530
392 Ga0068855_100056190
393 Ga0068855_100088976
394 Ga0068857_100098227
395 Ga0068860_100002365
396 Ga0068860_100110199
397 Ga0081540_1003964
398 Ga0075363_100001177
399 Ga0070715_10010564
400 Ga0070716_100000819
401 Ga0070712_100005702
402 Ga0075367_10005537
403 Ga0075369_10010092
404 Ga0075366_10009348
405 Ga0075370_10002196
406 Ga0075370_10010121
407 Ga0099824_1014944
408 Ga0099822_1043851
409 Ga0105240_10001873
410 Ga0105247_10026913
411 Ga0105248_10233359
412 Ga0105237_10014938
413 Ga0123340_1000571
414 Ga0123341_1000022
415 Ga0123341_1000694
416 Ga0123342_1022104
417 Ga0105239_10047226
418 Ga0105239_10236166
419 Ga0105246_10005128
420 Ga0163163_10026108
421 Ga0209435_100023
422 Ga0209566_100450
423 Ga0209672_100012
424 Ga0209672_100030
425 Ga0209147_100007
426 Ga0209147_100036
427 Ga0209147_100074
428 Ga0209258_100014
429 Ga0209258_100056
430 Ga0207425_1000101
431 Ga0209646_1000080
432 Ga0209026_1000076
433 Ga0209677_103559
434 Ga0209148_1000178
435 Ga0209148_1000287
436 Ga0209148_1004664
437 Ga0209759_1000059
438 Ga0209129_1000196
439 Ga0209233_1000216
440 Ga0209233_1004463
441 Ga0209455_1000061
442 Ga0209455_1001002
443 Ga0209673_1000046
444 Ga0209673_1001639
445 Ga0209130_1000106
446 Ga0209676_1017112
447 Ga0209025_1000450
448 Ga0209564_1000416
449 Ga0209758_1001075
450 Ga0209758_1001089
451 Ga0209758_1002625
452 Ga0209050_1010417
453 Ga0209256_1000550
454 Ga0209256_1009636
455 Ga0209051_1001073
456 Ga0209257_1001332
457 Ga0207692_10000754
458 Ga0207647_10002023
459 Ga0207647_10002595
460 Ga0207685_10009740
461 Ga0207699_10000406
462 Ga0207695_10000171
463 Ga0207693_10022641
464 Ga0207663_10004754
465 Ga0207700_10012422
466 Ga0207664_10010442
467 Ga0207665_10002155
468 Ga0207711_10021154
469 Ga0207667_10015080
470 Ga0207667_10078083
471 Ga0207677_10067568
472 Ga0207678_10038902
473 Ga0207674_10111335
474 Ga0209371_1000213
475 Ga0209589_1000035
476 Ga0209489_100079
477 Ga0209700_100077
478 Ga0268264_10000049
479 Ga0268256_1000170
480 Ga0307509_10005665
481 Ga0307408_100083927
482 Ga0307508_10000049
483 Ga0307508_10028784
484 Ga0307516_10001750
485 Ga0307516_10007205
486 Ga0307516_10009088
487 Ga0307405_10001289
488 Ga0307406_10036283
489 Ga0307412_10003452
490 Ga0307412_10028747
491 Ga0307416_100045894
492 Ga0307507_10028256
493 Ga0373925_0062732
494 Ga0451833_1259560
495 Ga0451837_0879995
496 Ga0451849_0727994
497 Ga0451851_0109300
498 Ga0495638_0002208
499 Ga0495580_0001516
500 Ga0495605_0032483
501 Ga0495585_0032130
502 Ga0495606_0015925
503 Ga0495606_0170703
504 Ga0495616_0073614
505 Ga0495643_0012353
506 Ga0495622_0010106
507 Ga0495660_0028022
508 Ga0495683_0059737
509 Ga0495687_011470
510 Ga0496101_0120202
511 Ga0496102_0020021
512 Ga0496103_0005249
513 Ga0496104_0001333
514 Ga0496104_0051485
515 Ga0496105_0000389
516 Ga0496106_0061803
517 Ga0496109_0032597
518 Ga0496112_0040181
519 Ga0496113_0047703
520 Ga0496116_0000540
521 Ga0496116_0010145
522 Ga0496116_0021739
523 Ga0496116_0031297
524 Ga0496117_0007537
525 Ga0496117_0007836
526 Ga0496117_0052632
527 Ga0496118_0006819
528 Ga0496118_0008468
529 Ga0496118_0008781
530 Ga0496118_0013065
531 Ga0496118_0032248
532 Ga0496119_0009377
533 Ga0496119_0016068
534 Ga0496119_0037697
535 Ga0496119_0058205
536 Ga0496119_0060232
537 Ga0496121_0000998
538 Ga0496121_0072477
539 Ga0496122_0017935
540 Ga0496122_0038865
541 Ga0496122_0088446
542 Ga0496123_0010413
543 Ga0496124_0000111
544 Ga0496124_0005318
545 Ga0496124_0010109
546 Ga0496124_0037947
547 Ga0496125_0026477
548 Ga0496125_0041210
549 Ga0496125_0055560
550 Ga0496126_0052668
551 nmdc:mga07m45_12288_c1
552 Ga0495655_0022256
553 Ga0500618_000243
554 Ga0500618_010210
555 Ga0500658_0000540
556 Ga0500573_0001274
557 Ga0500616_0000094
558 Ga0500616_0000416
559 Ga0500616_0020274
560 Ga0500616_0026836
561 Ga0500622_0041541
562 Ga0500634_0000035
563 Ga0500636_0147074
564 Ga0500596_001960
565 2509074699
566 2508695831
567 2509447450
568 2510898027
569 2511134367
570 2511171966
571 2513579140
572 2513598889
573 2513599175
574 2513651947
575 2513711725
576 2513722664
577 2513909095
578 2514023347
579 2515110665
580 2515623970
581 2515637952
582 2515645878
583 2515660642
584 2515742831
585 2517039366
586 2517079607
587 2517093541
588 2517405239
589 2519461025
590 2535517928
591 2585203422
592 2585274592
593 2585289924
594 2585326808
595 2585333082
596 2585400546
597 2585528556
598 2585555463
599 2585561974
600 2585819892
601 2585907715
602 2585993064
603 2586003799
604 2587983137
605 2599735777
606 2599743669
607 2600209217
608 2616555271
609 2644744004
610 2676742544
611 2719183734
612 2719728175
613 2720614367
614 2720621139
615 2720632467
616 2720776189
617 2721145036
618 2721155773
619 2721167123
620 2722838101
621 2723568039
622 2724042369
623 2724090796
624 2724105304
625 2728751290
626 2730161874
627 2730300880
628 2738804072
629 2770199270
630 2793314222
631 2793324072
632 2793346209
633 2793364919
634 2817259129
635 2817452356
636 2818239205
637 2819630182
638 2819642295
639 2819721533
640 2838025064
641 2838692343
642 2838732561
643 2838745456
644 2841855100
645 2842112460
646 2842161870
647 2842169247
648 2842185487
649 2842203264
650 2842218545
651 2842233425
652 2842249645
653 2842261714
654 2842276812
655 2842306220
656 2842330361
657 2842355022
658 2842460418
659 2842779895
660 2844455715
661 2863423458
662 2870074620
663 2888379160
664 2894772454
665 2904569675
666 2904576986
667 2919174016
668 2923561334
669 2928165702
670 2928173852
671 2928536925
672 2933573289
673 2933587789
674 2935649014
675 2935658214
676 2935907405
677 2935966465
678 2935982163
679 2935985299
680 2936012433
681 2936020486
682 2936029726
683 2936051809
684 2936056937
685 2936387093
686 2981990942
687 3005452101
688 3005595394
689 639646922
690 642418728
691 8005311005
692 8005461307
693 8005548800
694 8005630091
695 8005685679
696 8018853003
697 8019640826
698 8019676367
699 8019679627
700 8020808969
701 8020953023
702 8021121272
703 8023683975
704 8039101940
705 8040167854
706 8040173553
707 8056379119
708 8057881201

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13434

Lys_Orn_oxgnase

L-lysine 6-monooxygenase/L-ornithine 5-monooxygenase

130

306

0.86

PF13454

NAD_binding_9

FAD-NAD(P)-binding

58

205

0.82

PF13738

Pyr_redox_3

Pyridine nucleotide-disulphide oxidoreductase

58

283

0.78

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

55

286

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
4cpd-assembly2.cif.gz_C alcohol dehydrogenase tadh from thermus sp. atn1 0.9591 218 248
3ip1-assembly1.cif.gz_C structure of putative alcohol dehydrogenase (tm_042) from thermotoga maritima 0.9547 218 248
1pl6-assembly1.cif.gz_A human sdh/nadh/inhibitor complex 0.9513 217 248
8e7u-assembly1.cif.gz_B f93a horse liver alcohol dehydrogenase in complex with nadh and n-cyclohexylformamide 0.9379 217 252
3gfb-assembly1.cif.gz_C l-threonine dehydrogenase (tktdh) from the hyperthermophilic archaeon thermococcus kodakaraensis 0.9348 217 248
ID Description Score Start End Superfamily
af_P9WQC3_166_308_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9728 218 248 3.40.50.720
3ip1D02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9611 218 248 3.40.50.720
4uejA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9541 217 254 3.40.50.720
2dfvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9438 217 248 3.40.50.720
4rquB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9228 218 250 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A836ZLA4-F1-model_v4 deleted 0.9744 29 168
AF-A0A4Q1B853-F1-model_v4 FAD-binding protein 0.9726 3 132
AF-A0A257JUS7-F1-model_v4 FAD-dependent oxidoreductase 0.9672 3 390 GO:0004497
GO:0071949
AF-A0A7Y7IUF4-F1-model_v4 FAD-dependent monooxygenase 0.9662 1 186 GO:0004497
AF-A0A0E3VUI4-F1-model_v4 Oxidoreductase 0.9653 4 445 GO:0005886
GO:0015293

Map