F419984

General Info

Members Datasets Scaffolds Average Seq Length
355 230 710 212

Family's Representative Sequence

Representative Sequence 3300003322|rootL2_10213808|rootL2_102138083
Length 238
Sequence MLMPMARGNPDILLLRRIFLTFDCTFILHPMNIETVFRNNEQWIKARLEADPAYFEHLAQGQTPELLYIGCSDSRVTAEDIMGLQPGEAFVHRNIANLVNNVDLSVMSVLNYAVRHLKVNHVVVCGHYNCGGVKAAMQPADMGILNPWLRNIRDVYRLHKDELNAITDEGKRYDRLVELNVQEQCVNLIKTAAVQEAYKERGLRVHGWVFDIRTGKLIDLKIDFDKILKDIREIYNLY

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
3 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
63 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
89 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
90 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
91 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
95 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
97 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
99 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
100 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
136 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
145 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
148 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
149 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
150 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
151 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
152 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
153 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
154 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
155 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
156 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
157 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
158 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
159 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
160 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
161 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
162 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
163 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
164 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
169 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
170 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
171 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
172 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
173 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
174 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
175 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
176 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
177 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
178 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
179 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
180 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
181 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
182 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
183 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
184 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
185 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
186 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
187 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
188 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
189 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
190 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
191 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
192 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
193 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
194 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
195 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
196 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
197 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
198 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
199 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
200 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
201 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
202 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
203 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
204 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
205 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
206 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
207 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
208 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
209 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
210 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
211 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
212 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
213 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
214 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
215 2738541302 Pedobacter sp. CF074 Isolate Unclassified
216 2739367651 Pedobacter sp. OK291 Isolate Unclassified
217 2739367656 Pedobacter sp. CF523 Isolate Unclassified
218 2739367663 Pedobacter sp. YR510 Isolate Unclassified
219 2818991437 Pedobacter terrae 518 Isolate Unclassified
220 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
221 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
222 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
223 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
224 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
225 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
226 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
227 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
228 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
229 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
230 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.08
Metatranscriptomes 0
Isolates 5.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.3
Nodule 0
Rhizoplane 1.13
Rhizosphere 83.66
Stem 0
Stem Tuber 0
Unclassified 6.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10213808 3300003322 Bacteria 2104
2 CNBas_1000622 3300000531 Bacteria 1624
3 CNAas_1000866 3300000532 Unclassified 2853
4 JGI24751J29686_10000085 3300002459 Bacteria 52356
5 JGI25152J39213_1000173 3300002773 Bacteria 43619
6 JGI25150J39212_1000015 3300002774 Bacteria 170613
7 JGI25151J46595_10000043 3300003187 Bacteria 170613
8 JGI25406J46586_10014069 3300003203 Bacteria 3411
9 JGI25153J46596_10000009 3300003215 Bacteria 340925
10 rootH1_10069206 3300003316 Bacteria 4133
11 rootH1_10085030 3300003316 Bacteria 1150
12 rootH1_10117961 3300003316 Bacteria 1798
13 rootH2_10178981 3300003320 Bacteria 2194
14 rootL2_10043609 3300003322 Bacteria 3576
15 rootL2_10161806 3300003322 Bacteria 2285
16 Ga0055536_1000038 3300003781 Bacteria 133102
17 Ga0055530_10004665 3300003791 Bacteria 6950
18 Ga0065714_10064423 3300005288 Bacteria 257266
19 Ga0065714_10077479 3300005288 Bacteria 2672
20 Ga0065714_10091394 3300005288 Bacteria 1911
21 Ga0065714_10111169 3300005288 Bacteria 1474
22 Ga0065704_10086192 3300005289 Bacteria 3145
23 Ga0065704_10350609 3300005289 Bacteria 810
24 Ga0065704_10383512 3300005289 Bacteria 770
25 Ga0065707_10004569 3300005295 Bacteria 7877
26 Ga0065707_10005370 3300005295 Bacteria 5312
27 Ga0070676_10089518 3300005328 Unclassified 1883
28 Ga0070690_100390922 3300005330 Bacteria 1019
29 Ga0070670_100000057 3300005331 Bacteria 118540
30 Ga0070670_100226403 3300005331 Bacteria 1627
31 Ga0070677_10004320 3300005333 Bacteria 4629
32 Ga0068868_100077375 3300005338 Bacteria 2661
33 Ga0070687_100041178 3300005343 Unclassified 2333
34 Ga0070692_10035567 3300005345 Bacteria 2522
35 Ga0070675_100066899 3300005354 Bacteria 2972
36 Ga0070671_100017952 3300005355 Bacteria 5740
37 Ga0070674_100030866 3300005356 Bacteria 3546
38 Ga0070673_100215380 3300005364 Bacteria 1660
39 Ga0070673_100518074 3300005364 Bacteria 1080
40 Ga0070659_100362329 3300005366 Bacteria 1218
41 Ga0070659_100566304 3300005366 Bacteria 974
42 Ga0070705_100059963 3300005440 Bacteria 2255
43 Ga0070705_100849452 3300005440 Bacteria 730
44 Ga0070700_100001165 3300005441 Bacteria 12994
45 Ga0070694_100011491 3300005444 Bacteria 5484
46 Ga0070694_100125271 3300005444 Unclassified 1849
47 Ga0070694_100184730 3300005444 Bacteria 1544
48 Ga0070681_10035651 3300005458 Bacteria 4997
49 Ga0070681_10080988 3300005458 Bacteria 3202
50 Ga0068867_100093951 3300005459 Bacteria 2280
51 Ga0068867_100180251 3300005459 Bacteria 1679
52 Ga0070706_100420863 3300005467 Bacteria 1243
53 Ga0070707_100221259 3300005468 Bacteria 1844
54 Ga0070698_100064688 3300005471 Bacteria 3684
55 Ga0070699_100295318 3300005518 Bacteria 1453
56 Ga0070697_100271750 3300005536 Bacteria 1453
57 Ga0070672_100015950 3300005543 Bacteria 5366
58 Ga0070672_100237428 3300005543 Unclassified 1532
59 Ga0070672_100555386 3300005543 Bacteria 997
60 Ga0070695_100489267 3300005545 Unclassified 949
61 Ga0070696_100050262 3300005546 Unclassified 2898
62 Ga0070696_100222302 3300005546 Bacteria 1417
63 Ga0070696_100278596 3300005546 Unclassified 1274
64 Ga0070693_100049937 3300005547 Unclassified 2389
65 Ga0070704_100160165 3300005549 Bacteria 1779
66 Ga0068855_100309480 3300005563 Bacteria 1748
67 Ga0070664_100005272 3300005564 Bacteria 10372
68 Ga0070664_101159948 3300005564 Bacteria 728
69 Ga0068857_100131687 3300005577 Bacteria 2256
70 Ga0068857_100647108 3300005577 Bacteria 1002
71 Ga0068859_100168146 3300005617 Bacteria 2273
72 Ga0068864_100060246 3300005618 Bacteria 3287
73 Ga0068864_100208122 3300005618 Bacteria 1800
74 Ga0068864_100498468 3300005618 Bacteria 1171
75 Ga0068861_100000717 3300005719 Bacteria 19814
76 Ga0068861_100012649 3300005719 Bacteria 5890
77 Ga0068861_100116126 3300005719 Bacteria 2151
78 Ga0068861_100209494 3300005719 Bacteria 1641
79 Ga0068851_10151402 3300005834 Unclassified 1268
80 Ga0068863_100111949 3300005841 Bacteria 2600
81 Ga0068860_100365267 3300005843 Bacteria 1423
82 Ga0068862_100019246 3300005844 Bacteria 5693
83 Ga0068862_100463274 3300005844 Bacteria 1197
84 Ga0081539_10000931 3300005985 Bacteria 54965
85 Ga0081539_10191882 3300005985 Bacteria 950
86 Ga0075430_100085070 3300006846 Bacteria 2648
87 Ga0075431_100022871 3300006847 Bacteria 6390
88 Ga0075433_10199592 3300006852 Bacteria 1779
89 Ga0075433_10912600 3300006852 Bacteria 766
90 Ga0075434_100233061 3300006871 Bacteria 1861
91 Ga0075429_100052472 3300006880 Bacteria 3548
92 Ga0075429_100153597 3300006880 Bacteria 2016
93 Ga0068865_100030006 3300006881 Bacteria 3613
94 Ga0097620_100168149 3300006931 Bacteria 2273
95 Ga0105251_10112133 3300009011 Bacteria 1242
96 Ga0105244_10012248 3300009036 Bacteria 5080
97 Ga0105240_10249507 3300009093 Unclassified 2053
98 Ga0111539_10001784 3300009094 Bacteria 28601
99 Ga0111539_10028899 3300009094 Bacteria 6760
100 Ga0111539_10047971 3300009094 Bacteria 5101
101 Ga0111539_10098256 3300009094 Bacteria 3439
102 Ga0111539_10219460 3300009094 Bacteria 2215
103 Ga0105245_10558009 3300009098 Bacteria 1168
104 Ga0105247_10041765 3300009101 Bacteria 2807
105 Ga0114129_10035729 3300009147 Bacteria 7019
106 Ga0114129_10091679 3300009147 Bacteria 4209
107 Ga0105243_10206510 3300009148 Bacteria 1726
108 Ga0105243_10605791 3300009148 Bacteria 1055
109 Ga0105241_10632766 3300009174 Bacteria 970
110 Ga0105242_10117394 3300009176 Bacteria 2278
111 Ga0105248_10004355 3300009177 Bacteria 15659
112 Ga0105248_10278866 3300009177 Bacteria 1882
113 Ga0105248_10601702 3300009177 Bacteria 1240
114 Ga0105248_10910823 3300009177 Bacteria 993
115 Ga0105237_10046966 3300009545 Unclassified 4341
116 Ga0105238_10003979 3300009551 Bacteria 14660
117 Ga0105249_10725368 3300009553 Bacteria 1055
118 Ga0105249_10803840 3300009553 Bacteria 1004
119 Ga0105239_10344341 3300010375 Bacteria 1683
120 Ga0105239_11256411 3300010375 Bacteria 854
121 Ga0105246_10133097 3300011119 Bacteria 1860
122 Ga0157373_10035619 3300013100 Bacteria 3573
123 Ga0157373_10308994 3300013100 Bacteria 1123
124 Ga0157371_10000076 3300013102 Bacteria 161805
125 Ga0157371_10165292 3300013102 Bacteria 1580
126 Ga0157370_10003006 3300013104 Bacteria 20011
127 Ga0157370_10003873 3300013104 Bacteria 17430
128 Ga0157370_10013679 3300013104 Bacteria 8342
129 Ga0157370_10168289 3300013104 Bacteria 2038
130 Ga0157370_10956751 3300013104 Bacteria 776
131 Ga0157369_10000007 3300013105 Bacteria 402562
132 Ga0157378_10098974 3300013297 Bacteria 2660
133 Ga0163162_10000035 3300013306 Bacteria 147102
134 Ga0163162_10412799 3300013306 Unclassified 1482
135 Ga0163162_10948211 3300013306 Bacteria 972
136 Ga0163162_10990620 3300013306 Bacteria 950
137 Ga0157372_10154751 3300013307 Bacteria 2648
138 Ga0157372_10718721 3300013307 Bacteria 1162
139 Ga0157375_10005467 3300013308 Bacteria 11047
140 Ga0157375_10006063 3300013308 Bacteria 10541
141 Ga0157375_10453309 3300013308 Bacteria 1448
142 Ga0163163_10000184 3300014325 Bacteria 64203
143 Ga0163163_10131066 3300014325 Bacteria 2547
144 Ga0163163_10198506 3300014325 Bacteria 2054
145 Ga0163163_10255570 3300014325 Bacteria 1803
146 Ga0157380_10000008 3300014326 Bacteria 154993
147 Ga0157380_10001861 3300014326 Bacteria 13957
148 Ga0157380_10276040 3300014326 Bacteria 1535
149 Ga0157380_10501151 3300014326 Bacteria 1179
150 Ga0182008_10000222 3300014497 Bacteria 44722
151 Ga0182006_1000220 3300015261 Bacteria 55777
152 Ga0182006_1000233 3300015261 Bacteria 52709
153 Ga0182007_10000007 3300015262 Bacteria 376596
154 Ga0183373_1001 3300015682 Bacteria 1410374
155 Ga0163161_10000129 3300017792 Bacteria 70623
156 Ga0163161_10000130 3300017792 Bacteria 70533
157 Ga0163161_10002968 3300017792 Bacteria 12021
158 Ga0163161_10003393 3300017792 Bacteria 11184
159 Ga0163161_10004473 3300017792 Bacteria 9726
160 Ga0163161_10018415 3300017792 Bacteria 4896
161 Ga0209258_100068 3300025242 Bacteria 286288
162 Ga0207425_1000023 3300025245 Bacteria 341339
163 Ga0209148_1000182 3300025254 Bacteria 123558
164 Ga0209129_1000032 3300025258 Bacteria 341150
165 Ga0209676_1000201 3300025292 Bacteria 133195
166 Ga0209025_1000047 3300025294 Bacteria 341150
167 Ga0209758_1000144 3300025297 Bacteria 170724
168 Ga0209050_1000203 3300025298 Bacteria 133156
169 Ga0207682_10007631 3300025893 Bacteria 4304
170 Ga0207710_10429227 3300025900 Bacteria 681
171 Ga0207645_10093736 3300025907 Unclassified 1932
172 Ga0207654_10093961 3300025911 Bacteria 1834
173 Ga0207695_10217179 3300025913 Bacteria 1820
174 Ga0207660_10241682 3300025917 Bacteria 1423
175 Ga0207662_10056772 3300025918 Unclassified 2339
176 Ga0207662_10110425 3300025918 Bacteria 1714
177 Ga0207646_10119090 3300025922 Bacteria 2372
178 Ga0207681_10291186 3300025923 Bacteria 1289
179 Ga0207681_10742956 3300025923 Bacteria 817
180 Ga0207681_10920460 3300025923 Bacteria 732
181 Ga0207650_10000027 3300025925 Bacteria 257466
182 Ga0207650_10269972 3300025925 Bacteria 1382
183 Ga0207659_10084094 3300025926 Bacteria 2361
184 Ga0207644_10428481 3300025931 Bacteria 1084
185 Ga0207686_10114467 3300025934 Bacteria 1825
186 Ga0207709_10131502 3300025935 Bacteria 1706
187 Ga0207709_10854705 3300025935 Bacteria 737
188 Ga0207670_10496330 3300025936 Bacteria 990
189 Ga0207669_10174776 3300025937 Bacteria 1533
190 Ga0207704_10151512 3300025938 Bacteria 1637
191 Ga0207691_10008234 3300025940 Bacteria 10011
192 Ga0207691_10246090 3300025940 Unclassified 1545
193 Ga0207711_10394455 3300025941 Bacteria 1285
194 Ga0207679_10019515 3300025945 Unclassified 4555
195 Ga0207679_10297621 3300025945 Bacteria 1390
196 Ga0207679_10566343 3300025945 Bacteria 1021
197 Ga0207667_10256732 3300025949 Bacteria 1788
198 Ga0207667_10419375 3300025949 Bacteria 1362
199 Ga0207651_10022857 3300025960 Bacteria 3834
200 Ga0207651_10187305 3300025960 Bacteria 1648
201 Ga0207712_10444424 3300025961 Bacteria 1098
202 Ga0207668_10167436 3300025972 Bacteria 1720
203 Ga0207668_10782840 3300025972 Bacteria 843
204 Ga0207640_10676781 3300025981 Bacteria 882
205 Ga0207640_10678409 3300025981 Bacteria 881
206 Ga0207677_10448936 3300026023 Bacteria 1104
207 Ga0207708_10001124 3300026075 Bacteria 20108
208 Ga0207708_10521676 3300026075 Bacteria 998
209 Ga0207641_10099475 3300026088 Bacteria 2559
210 Ga0207641_10208529 3300026088 Bacteria 1806
211 Ga0207641_10277890 3300026088 Bacteria 1574
212 Ga0207648_10038301 3300026089 Bacteria 4220
213 Ga0207648_10057489 3300026089 Bacteria 3394
214 Ga0207648_10158907 3300026089 Bacteria 1996
215 Ga0207676_10025531 3300026095 Bacteria 4383
216 Ga0207676_10045421 3300026095 Bacteria 3394
217 Ga0207676_10169176 3300026095 Bacteria 1902
218 Ga0207676_10191318 3300026095 Bacteria 1801
219 Ga0207674_10057280 3300026116 Bacteria 3950
220 Ga0207674_10075976 3300026116 Bacteria 3368
221 Ga0207674_10567497 3300026116 Bacteria 1096
222 Ga0207674_10580973 3300026116 Bacteria 1082
223 Ga0207675_100008057 3300026118 Bacteria 9928
224 Ga0207675_100015795 3300026118 Bacteria 7041
225 Ga0207675_100504549 3300026118 Bacteria 1205
226 Ga0207428_10081400 3300027907 Unclassified 2528
227 Ga0268265_10010947 3300028380 Bacteria 6124
228 Ga0316177_1134613 3300030731 Bacteria 921
229 Ga0265327_10008181 3300031251 Bacteria 7850
230 Ga0307405_10000037 3300031731 Bacteria 91045
231 Ga0307406_10098457 3300031901 Bacteria 1986
232 Ga0307407_10000025 3300031903 Bacteria 112811
233 Ga0307412_10606838 3300031911 Bacteria 928
234 Ga0307409_100005817 3300031995 Bacteria 7154
235 Ga0307416_100000068 3300032002 Bacteria 86974
236 Ga0307416_100659021 3300032002 Bacteria 1132
237 Ga0307416_100996184 3300032002 Bacteria 941
238 Ga0307414_10001935 3300032004 Bacteria 10717
239 Ga0307414_10006440 3300032004 Bacteria 6548
240 Ga0307414_10033959 3300032004 Bacteria 3376
241 Ga0307414_10043955 3300032004 Unclassified 3046
242 Ga0307414_10047818 3300032004 Bacteria 2947
243 Ga0307414_10095703 3300032004 Bacteria 2220
244 Ga0307414_10575404 3300032004 Bacteria 1007
245 Ga0307415_100124661 3300032126 Bacteria 1939
246 Ga0316574_0060724 3300035398 Bacteria 2373
247 Ga0316574_0317154 3300035398 Bacteria 990
248 Ga0395898_0061645 3300037466 Bacteria 3644
249 Ga0451806_360421 3300041462 Bacteria 733
250 Ga0451837_1233849 3300041494 Bacteria 1957
251 Ga0439431_0005913 3300041997 Bacteria 2704
252 Ga0439434_0111275 3300042435 Bacteria 887
253 Ga0451577_0014962 3300042876 Bacteria 7221
254 Ga0451577_0047993 3300042876 Unclassified 3816
255 Ga0451577_0106898 3300042876 Bacteria 2501
256 Ga0451577_0172530 3300042876 Bacteria 1949
257 Ga0453684_0010245 3300044712 Bacteria 16057
258 Ga0453684_0013738 3300044712 Bacteria 13099
259 Ga0453684_0458258 3300044712 Unclassified 1418
260 Ga0451576_0000022 3300045051 Bacteria 495037
261 Ga0451576_0069405 3300045051 Unclassified 3667
262 Ga0451576_0126853 3300045051 Bacteria 2659
263 Ga0495627_000022 3300046453 Bacteria 254672
264 Ga0495627_002917 3300046453 Bacteria 7866
265 Ga0495627_006462 3300046453 Bacteria 4591
266 Ga0495607_0019477 3300046501 Bacteria 4310
267 Ga0495606_0033429 3300046507 Bacteria 3547
268 Ga0495610_0002219 3300046512 Bacteria 16439
269 Ga0495610_0004850 3300046512 Bacteria 9786
270 Ga0495616_0002791 3300046513 Bacteria 11405
271 Ga0495643_0036723 3300046522 Bacteria 2690
272 Ga0495654_0000003 3300046530 Bacteria 863485
273 Ga0495633_0000001 3300046558 Bacteria 801972
274 Ga0495633_0000058 3300046558 Bacteria 147584
275 Ga0495633_0012073 3300046558 Bacteria 4613
276 Ga0495668_0000451 3300046616 Bacteria 52539
277 Ga0495625_0042068 3300046660 Bacteria 3322
278 Ga0495686_0000256 3300047472 Bacteria 95552
279 Ga0495686_0032254 3300047472 Bacteria 3391
280 Ga0496104_0133017 3300048907 Bacteria 2390
281 Ga0496107_0173957 3300048910 Bacteria 1598
282 Ga0496112_0472056 3300048915 Bacteria 1192
283 Ga0496116_0229226 3300048919 Bacteria 944
284 Ga0496121_0000343 3300048924 Bacteria 96972
285 Ga0496125_0010171 3300048928 Bacteria 9535
286 Ga0496126_0027853 3300048929 Bacteria 5390
287 Ga0501291_001169 3300049514 Bacteria 3027
288 Ga0501292_032328 3300049515 Bacteria 883
289 Ga0501296_009021 3300049519 Bacteria 1164
290 Ga0501298_003380 3300049521 Bacteria 2473
291 Ga0501299_001227 3300049522 Bacteria 3242
292 Ga0501201_003882 3300049651 Bacteria 1379
293 Ga0501202_010633 3300049652 Bacteria 1711
294 Ga0501207_014283 3300049654 Bacteria 1211
295 Ga0501216_001603 3300049660 Bacteria 3090
296 Ga0501217_026638 3300049661 Bacteria 1398
297 Ga0501235_035666 3300049669 Bacteria 1130
298 Ga0501249_024544 3300049679 Bacteria 1328
299 Ga0501234_005600 3300049707 Bacteria 1965
300 Ga0501270_004552 3300049767 Bacteria 1563
301 Ga0501280_009810 3300049776 Bacteria 1333
302 nmdc:mga05p37_224513_c1 3300050507 Unclassified 2265
303 nmdc:mga05p37_78968_c1 3300050507 Bacteria 4052
304 nmdc:mga0qj67_255118_c1 3300050509 Bacteria 1423
305 nmdc:mga06r32_138951_c1 3300050510 Unclassified 2405
306 nmdc:mga06r32_244222_c1 3300050510 Bacteria 1783
307 nmdc:mga08y16_12276_c1 3300050511 Bacteria 9005
308 nmdc:mga08y16_265361_c1 3300050511 Bacteria 1773
309 nmdc:mga08y16_55975_c1 3300050511 Bacteria 4122
310 nmdc:mga0n895_156653_c1 3300050512 Bacteria 2308
311 nmdc:mga0n895_369574_c1 3300050512 Bacteria 1452
312 nmdc:mga0n895_874372_c1 3300050512 Bacteria 885
313 nmdc:mga08x19_66524_c1 3300050514 Bacteria 2342
314 nmdc:mga0a205_366456_c1 3300050515 Bacteria 1307
315 nmdc:mga0a205_57542_c1 3300050515 Bacteria 3754
316 Ga0500644_0000420 3300053088 Bacteria 19919
317 Ga0500646_0005078 3300053090 Bacteria 3337
318 Ga0500651_0057253 3300053093 Bacteria 2440
319 Ga0500651_0240954 3300053093 Bacteria 1054
320 Ga0500641_0093334 3300053096 Bacteria 1286
321 Ga0500556_0063362 3300053104 Bacteria 1366
322 Ga0500569_000151 3300053109 Bacteria 11053
323 Ga0500658_0001430 3300053134 Bacteria 9602
324 Ga0500559_0015611 3300053136 Bacteria 3207
325 Ga0500577_0000568 3300053142 Bacteria 9552
326 Ga0500589_026931 3300053147 Bacteria 2667
327 Ga0500590_034091 3300053148 Bacteria 2636
328 Ga0500616_0002337 3300053153 Bacteria 15977
329 Ga0500616_0007054 3300053153 Bacteria 7213
330 Ga0500622_0000258 3300053156 Bacteria 53957
331 Ga0500622_0031277 3300053156 Bacteria 2793
332 Ga0500633_0015214 3300053160 Bacteria 2202
333 Ga0500636_0009767 3300053177 Bacteria 5589
334 Ga0500656_014586 3300053732 Bacteria 911
335 2511232993 2511231000 Bacteria 4488346
336 2585159587 2582581281 Bacteria 4487904
337 2585163844 2582581282 Bacteria 4495830
338 2586211133 2585427687 Bacteria 5544917
339 2587944674 2585428115 Bacteria 4420269
340 2738856422 2738541302 Bacteria 5944758
341 2739589258 2739367651 Bacteria 6359826
342 2739614284 2739367656 Bacteria 5152243
343 2739647010 2739367663 Bacteria 5040914
344 2819546830 2818991437 Bacteria 5805520
345 2833641855 2833640130 Bacteria 4858325
346 2842725534 2842722452 Bacteria 6263924
347 2842914681 2842909656 Bacteria 6185908
348 2849283240 2849281842 Bacteria 6065644
349 2857631427 2857627736 Bacteria 5625397
350 2881250052 2881247448 Bacteria 3717788
351 2881955558 2881955468 Bacteria 3545609
352 2904447001 2904445276 Bacteria 5310396
353 2929244946 2929239360 Bacteria 7745570
354 2946002557 2945997725 Bacteria 6404843
355 2954019395 2954016120 Bacteria 6446024
356 rootL2_10213808
357 CNBas_1000622
358 CNAas_1000866
359 JGI24751J29686_10000085
360 JGI25152J39213_1000173
361 JGI25150J39212_1000015
362 JGI25151J46595_10000043
363 JGI25406J46586_10014069
364 JGI25153J46596_10000009
365 rootH1_10069206
366 rootH1_10085030
367 rootH1_10117961
368 rootH2_10178981
369 rootL2_10043609
370 rootL2_10161806
371 Ga0055536_1000038
372 Ga0055530_10004665
373 Ga0065714_10064423
374 Ga0065714_10077479
375 Ga0065714_10091394
376 Ga0065714_10111169
377 Ga0065704_10086192
378 Ga0065704_10350609
379 Ga0065704_10383512
380 Ga0065707_10004569
381 Ga0065707_10005370
382 Ga0070676_10089518
383 Ga0070690_100390922
384 Ga0070670_100000057
385 Ga0070670_100226403
386 Ga0070677_10004320
387 Ga0068868_100077375
388 Ga0070687_100041178
389 Ga0070692_10035567
390 Ga0070675_100066899
391 Ga0070671_100017952
392 Ga0070674_100030866
393 Ga0070673_100215380
394 Ga0070673_100518074
395 Ga0070659_100362329
396 Ga0070659_100566304
397 Ga0070705_100059963
398 Ga0070705_100849452
399 Ga0070700_100001165
400 Ga0070694_100011491
401 Ga0070694_100125271
402 Ga0070694_100184730
403 Ga0070681_10035651
404 Ga0070681_10080988
405 Ga0068867_100093951
406 Ga0068867_100180251
407 Ga0070706_100420863
408 Ga0070707_100221259
409 Ga0070698_100064688
410 Ga0070699_100295318
411 Ga0070697_100271750
412 Ga0070672_100015950
413 Ga0070672_100237428
414 Ga0070672_100555386
415 Ga0070695_100489267
416 Ga0070696_100050262
417 Ga0070696_100222302
418 Ga0070696_100278596
419 Ga0070693_100049937
420 Ga0070704_100160165
421 Ga0068855_100309480
422 Ga0070664_100005272
423 Ga0070664_101159948
424 Ga0068857_100131687
425 Ga0068857_100647108
426 Ga0068859_100168146
427 Ga0068864_100060246
428 Ga0068864_100208122
429 Ga0068864_100498468
430 Ga0068861_100000717
431 Ga0068861_100012649
432 Ga0068861_100116126
433 Ga0068861_100209494
434 Ga0068851_10151402
435 Ga0068863_100111949
436 Ga0068860_100365267
437 Ga0068862_100019246
438 Ga0068862_100463274
439 Ga0081539_10000931
440 Ga0081539_10191882
441 Ga0075430_100085070
442 Ga0075431_100022871
443 Ga0075433_10199592
444 Ga0075433_10912600
445 Ga0075434_100233061
446 Ga0075429_100052472
447 Ga0075429_100153597
448 Ga0068865_100030006
449 Ga0097620_100168149
450 Ga0105251_10112133
451 Ga0105244_10012248
452 Ga0105240_10249507
453 Ga0111539_10001784
454 Ga0111539_10028899
455 Ga0111539_10047971
456 Ga0111539_10098256
457 Ga0111539_10219460
458 Ga0105245_10558009
459 Ga0105247_10041765
460 Ga0114129_10035729
461 Ga0114129_10091679
462 Ga0105243_10206510
463 Ga0105243_10605791
464 Ga0105241_10632766
465 Ga0105242_10117394
466 Ga0105248_10004355
467 Ga0105248_10278866
468 Ga0105248_10601702
469 Ga0105248_10910823
470 Ga0105237_10046966
471 Ga0105238_10003979
472 Ga0105249_10725368
473 Ga0105249_10803840
474 Ga0105239_10344341
475 Ga0105239_11256411
476 Ga0105246_10133097
477 Ga0157373_10035619
478 Ga0157373_10308994
479 Ga0157371_10000076
480 Ga0157371_10165292
481 Ga0157370_10003006
482 Ga0157370_10003873
483 Ga0157370_10013679
484 Ga0157370_10168289
485 Ga0157370_10956751
486 Ga0157369_10000007
487 Ga0157378_10098974
488 Ga0163162_10000035
489 Ga0163162_10412799
490 Ga0163162_10948211
491 Ga0163162_10990620
492 Ga0157372_10154751
493 Ga0157372_10718721
494 Ga0157375_10005467
495 Ga0157375_10006063
496 Ga0157375_10453309
497 Ga0163163_10000184
498 Ga0163163_10131066
499 Ga0163163_10198506
500 Ga0163163_10255570
501 Ga0157380_10000008
502 Ga0157380_10001861
503 Ga0157380_10276040
504 Ga0157380_10501151
505 Ga0182008_10000222
506 Ga0182006_1000220
507 Ga0182006_1000233
508 Ga0182007_10000007
509 Ga0183373_1001
510 Ga0163161_10000129
511 Ga0163161_10000130
512 Ga0163161_10002968
513 Ga0163161_10003393
514 Ga0163161_10004473
515 Ga0163161_10018415
516 Ga0209258_100068
517 Ga0207425_1000023
518 Ga0209148_1000182
519 Ga0209129_1000032
520 Ga0209676_1000201
521 Ga0209025_1000047
522 Ga0209758_1000144
523 Ga0209050_1000203
524 Ga0207682_10007631
525 Ga0207710_10429227
526 Ga0207645_10093736
527 Ga0207654_10093961
528 Ga0207695_10217179
529 Ga0207660_10241682
530 Ga0207662_10056772
531 Ga0207662_10110425
532 Ga0207646_10119090
533 Ga0207681_10291186
534 Ga0207681_10742956
535 Ga0207681_10920460
536 Ga0207650_10000027
537 Ga0207650_10269972
538 Ga0207659_10084094
539 Ga0207644_10428481
540 Ga0207686_10114467
541 Ga0207709_10131502
542 Ga0207709_10854705
543 Ga0207670_10496330
544 Ga0207669_10174776
545 Ga0207704_10151512
546 Ga0207691_10008234
547 Ga0207691_10246090
548 Ga0207711_10394455
549 Ga0207679_10019515
550 Ga0207679_10297621
551 Ga0207679_10566343
552 Ga0207667_10256732
553 Ga0207667_10419375
554 Ga0207651_10022857
555 Ga0207651_10187305
556 Ga0207712_10444424
557 Ga0207668_10167436
558 Ga0207668_10782840
559 Ga0207640_10676781
560 Ga0207640_10678409
561 Ga0207677_10448936
562 Ga0207708_10001124
563 Ga0207708_10521676
564 Ga0207641_10099475
565 Ga0207641_10208529
566 Ga0207641_10277890
567 Ga0207648_10038301
568 Ga0207648_10057489
569 Ga0207648_10158907
570 Ga0207676_10025531
571 Ga0207676_10045421
572 Ga0207676_10169176
573 Ga0207676_10191318
574 Ga0207674_10057280
575 Ga0207674_10075976
576 Ga0207674_10567497
577 Ga0207674_10580973
578 Ga0207675_100008057
579 Ga0207675_100015795
580 Ga0207675_100504549
581 Ga0207428_10081400
582 Ga0268265_10010947
583 Ga0316177_1134613
584 Ga0265327_10008181
585 Ga0307405_10000037
586 Ga0307406_10098457
587 Ga0307407_10000025
588 Ga0307412_10606838
589 Ga0307409_100005817
590 Ga0307416_100000068
591 Ga0307416_100659021
592 Ga0307416_100996184
593 Ga0307414_10001935
594 Ga0307414_10006440
595 Ga0307414_10033959
596 Ga0307414_10043955
597 Ga0307414_10047818
598 Ga0307414_10095703
599 Ga0307414_10575404
600 Ga0307415_100124661
601 Ga0316574_0060724
602 Ga0316574_0317154
603 Ga0395898_0061645
604 Ga0451806_360421
605 Ga0451837_1233849
606 Ga0439431_0005913
607 Ga0439434_0111275
608 Ga0451577_0014962
609 Ga0451577_0047993
610 Ga0451577_0106898
611 Ga0451577_0172530
612 Ga0453684_0010245
613 Ga0453684_0013738
614 Ga0453684_0458258
615 Ga0451576_0000022
616 Ga0451576_0069405
617 Ga0451576_0126853
618 Ga0495627_000022
619 Ga0495627_002917
620 Ga0495627_006462
621 Ga0495607_0019477
622 Ga0495606_0033429
623 Ga0495610_0002219
624 Ga0495610_0004850
625 Ga0495616_0002791
626 Ga0495643_0036723
627 Ga0495654_0000003
628 Ga0495633_0000001
629 Ga0495633_0000058
630 Ga0495633_0012073
631 Ga0495668_0000451
632 Ga0495625_0042068
633 Ga0495686_0000256
634 Ga0495686_0032254
635 Ga0496104_0133017
636 Ga0496107_0173957
637 Ga0496112_0472056
638 Ga0496116_0229226
639 Ga0496121_0000343
640 Ga0496125_0010171
641 Ga0496126_0027853
642 Ga0501291_001169
643 Ga0501292_032328
644 Ga0501296_009021
645 Ga0501298_003380
646 Ga0501299_001227
647 Ga0501201_003882
648 Ga0501202_010633
649 Ga0501207_014283
650 Ga0501216_001603
651 Ga0501217_026638
652 Ga0501235_035666
653 Ga0501249_024544
654 Ga0501234_005600
655 Ga0501270_004552
656 Ga0501280_009810
657 nmdc:mga05p37_224513_c1
658 nmdc:mga05p37_78968_c1
659 nmdc:mga0qj67_255118_c1
660 nmdc:mga06r32_138951_c1
661 nmdc:mga06r32_244222_c1
662 nmdc:mga08y16_12276_c1
663 nmdc:mga08y16_265361_c1
664 nmdc:mga08y16_55975_c1
665 nmdc:mga0n895_156653_c1
666 nmdc:mga0n895_369574_c1
667 nmdc:mga0n895_874372_c1
668 nmdc:mga08x19_66524_c1
669 nmdc:mga0a205_366456_c1
670 nmdc:mga0a205_57542_c1
671 Ga0500644_0000420
672 Ga0500646_0005078
673 Ga0500651_0057253
674 Ga0500651_0240954
675 Ga0500641_0093334
676 Ga0500556_0063362
677 Ga0500569_000151
678 Ga0500658_0001430
679 Ga0500559_0015611
680 Ga0500577_0000568
681 Ga0500589_026931
682 Ga0500590_034091
683 Ga0500616_0002337
684 Ga0500616_0007054
685 Ga0500622_0000258
686 Ga0500622_0031277
687 Ga0500633_0015214
688 Ga0500636_0009767
689 Ga0500656_014586
690 2511232993
691 2585159587
692 2585163844
693 2586211133
694 2587944674
695 2738856422
696 2739589258
697 2739614284
698 2739647010
699 2819546830
700 2833641855
701 2842725534
702 2842914681
703 2849283240
704 2857631427
705 2881250052
706 2881955558
707 2904447001
708 2929244946
709 2946002557
710 2954019395

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00484

Pro_CA

Carbonic anhydrase

66

217

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4waj-assembly1.cif.gz_A-2 h. influenzae beta-carbonic anhydase variant p48s/a49p 0.971 33 213
3e2x-assembly1.cif.gz_B-2 h. influenzae beta-carbonic anhydrase, variant v47a 0.9694 35 213
3e24-assembly1.cif.gz_A h. influenzae beta-carbonic anhydrase, variant w39f 0.9693 35 213
5jj8-assembly1.cif.gz_A crystal structure of the beta carbonic anhydrase psca3 isolated from pseudomonas aeruginosa - alternate crystal packing form 0.9672 4 200
6d2j-assembly1.cif.gz_A beta carbonic anhydrase in complex with thiocyanate 0.967 4 200
ID Description Score Start End Superfamily
4wamA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9663 35 213 3.40.1050.10
1ddzB02 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9557 33 211 3.40.1050.10
2a8cA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9464 1 213 3.40.1050.10
2a8cA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9337 1 213 3.40.1050.10
4o1jB00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9292 3 196 3.40.1050.10
ID Description Score Start End GO Terms
AF-U1YV03-F1-model_v4 deleted 0.9856 4 199
AF-A0A078BG03-F1-model_v4 carbonic anhydrase (EC 4.2.1.1) 0.9845 5 213 GO:0004089
GO:0008270
GO:0015976
AF-A0A370XBA7-F1-model_v4 Carbonic anhydrase (EC 4.2.1.1) (Carbonate dehydratase) 0.9843 4 213 GO:0004089
GO:0008270
GO:0015976
AF-A0A2A4R8G1-F1-model_v4 Carbonic anhydrase (EC 4.2.1.1) (Carbonate dehydratase) 0.9843 3 197 GO:0004089
GO:0008270
GO:0015976
AF-A0A3S0PAZ1-F1-model_v4 Carbonic anhydrase (EC 4.2.1.1) (Carbonate dehydratase) 0.9839 4 211 GO:0004089
GO:0008270
GO:0015976

Map