F419984
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 355 | 230 | 710 | 212 |
Family's Representative Sequence
| Representative Sequence | 3300003322|rootL2_10213808|rootL2_102138083 |
| Length | 238 |
| Sequence | MLMPMARGNPDILLLRRIFLTFDCTFILHPMNIETVFRNNEQWIKARLEADPAYFEHLAQGQTPELLYIGCSDSRVTAEDIMGLQPGEAFVHRNIANLVNNVDLSVMSVLNYAVRHLKVNHVVVCGHYNCGGVKAAMQPADMGILNPWLRNIRDVYRLHKDELNAITDEGKRYDRLVELNVQEQCVNLIKTAAVQEAYKERGLRVHGWVFDIRTGKLIDLKIDFDKILKDIREIYNLY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 2 | 3300000531 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 5 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 6 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 7 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 8 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 9 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 10 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 11 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 12 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 48 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 49 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 50 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 53 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 54 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 55 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 56 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 57 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 58 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 59 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 60 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 61 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 89 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 90 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 91 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 92 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 95 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 97 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 134 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 136 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 137 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 138 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 139 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 140 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 141 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 142 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 143 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 144 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 145 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 146 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 147 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 148 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 149 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 150 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 151 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 152 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 153 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 154 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 166 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 167 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 168 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 169 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 170 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 171 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 172 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 173 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 174 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 175 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 176 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 177 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 178 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 179 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 180 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 181 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 182 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 183 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 184 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 185 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 186 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 187 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 189 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 190 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 191 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 192 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 193 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 194 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 195 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 196 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 197 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 198 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 199 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 200 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 201 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 202 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 203 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 204 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 205 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 206 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 207 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 208 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 209 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 210 | 2511231000 | Chryseobacterium populi CF314 | Isolate | Rhizosphere |
| 211 | 2582581281 | Chryseobacterium sp. CF284 | Isolate | Rhizosphere |
| 212 | 2582581282 | Chryseobacterium sp. CF299 | Isolate | Rhizosphere |
| 213 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 214 | 2585428115 | Chryseobacterium sp. YR561 | Isolate | Rhizosphere |
| 215 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 216 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 217 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 218 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 219 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 220 | 2833640130 | Mariniflexile sp. TRM1-10 | Isolate | Rhizosphere |
| 221 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 222 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 223 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 224 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 225 | 2881247448 | Flavobacterium beibuense RSKm HC5 | Isolate | Rhizosphere |
| 226 | 2881955468 | Edaphocola flava HME-24 | Isolate | Rhizosphere |
| 227 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 228 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 229 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 230 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.08 |
| Metatranscriptomes | 0 |
| Isolates | 5.92 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.3 |
| Nodule | 0 |
| Rhizoplane | 1.13 |
| Rhizosphere | 83.66 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.76 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootL2_10213808 | 3300003322 | Bacteria | 2104 |
| 2 | CNBas_1000622 | 3300000531 | Bacteria | 1624 |
| 3 | CNAas_1000866 | 3300000532 | Unclassified | 2853 |
| 4 | JGI24751J29686_10000085 | 3300002459 | Bacteria | 52356 |
| 5 | JGI25152J39213_1000173 | 3300002773 | Bacteria | 43619 |
| 6 | JGI25150J39212_1000015 | 3300002774 | Bacteria | 170613 |
| 7 | JGI25151J46595_10000043 | 3300003187 | Bacteria | 170613 |
| 8 | JGI25406J46586_10014069 | 3300003203 | Bacteria | 3411 |
| 9 | JGI25153J46596_10000009 | 3300003215 | Bacteria | 340925 |
| 10 | rootH1_10069206 | 3300003316 | Bacteria | 4133 |
| 11 | rootH1_10085030 | 3300003316 | Bacteria | 1150 |
| 12 | rootH1_10117961 | 3300003316 | Bacteria | 1798 |
| 13 | rootH2_10178981 | 3300003320 | Bacteria | 2194 |
| 14 | rootL2_10043609 | 3300003322 | Bacteria | 3576 |
| 15 | rootL2_10161806 | 3300003322 | Bacteria | 2285 |
| 16 | Ga0055536_1000038 | 3300003781 | Bacteria | 133102 |
| 17 | Ga0055530_10004665 | 3300003791 | Bacteria | 6950 |
| 18 | Ga0065714_10064423 | 3300005288 | Bacteria | 257266 |
| 19 | Ga0065714_10077479 | 3300005288 | Bacteria | 2672 |
| 20 | Ga0065714_10091394 | 3300005288 | Bacteria | 1911 |
| 21 | Ga0065714_10111169 | 3300005288 | Bacteria | 1474 |
| 22 | Ga0065704_10086192 | 3300005289 | Bacteria | 3145 |
| 23 | Ga0065704_10350609 | 3300005289 | Bacteria | 810 |
| 24 | Ga0065704_10383512 | 3300005289 | Bacteria | 770 |
| 25 | Ga0065707_10004569 | 3300005295 | Bacteria | 7877 |
| 26 | Ga0065707_10005370 | 3300005295 | Bacteria | 5312 |
| 27 | Ga0070676_10089518 | 3300005328 | Unclassified | 1883 |
| 28 | Ga0070690_100390922 | 3300005330 | Bacteria | 1019 |
| 29 | Ga0070670_100000057 | 3300005331 | Bacteria | 118540 |
| 30 | Ga0070670_100226403 | 3300005331 | Bacteria | 1627 |
| 31 | Ga0070677_10004320 | 3300005333 | Bacteria | 4629 |
| 32 | Ga0068868_100077375 | 3300005338 | Bacteria | 2661 |
| 33 | Ga0070687_100041178 | 3300005343 | Unclassified | 2333 |
| 34 | Ga0070692_10035567 | 3300005345 | Bacteria | 2522 |
| 35 | Ga0070675_100066899 | 3300005354 | Bacteria | 2972 |
| 36 | Ga0070671_100017952 | 3300005355 | Bacteria | 5740 |
| 37 | Ga0070674_100030866 | 3300005356 | Bacteria | 3546 |
| 38 | Ga0070673_100215380 | 3300005364 | Bacteria | 1660 |
| 39 | Ga0070673_100518074 | 3300005364 | Bacteria | 1080 |
| 40 | Ga0070659_100362329 | 3300005366 | Bacteria | 1218 |
| 41 | Ga0070659_100566304 | 3300005366 | Bacteria | 974 |
| 42 | Ga0070705_100059963 | 3300005440 | Bacteria | 2255 |
| 43 | Ga0070705_100849452 | 3300005440 | Bacteria | 730 |
| 44 | Ga0070700_100001165 | 3300005441 | Bacteria | 12994 |
| 45 | Ga0070694_100011491 | 3300005444 | Bacteria | 5484 |
| 46 | Ga0070694_100125271 | 3300005444 | Unclassified | 1849 |
| 47 | Ga0070694_100184730 | 3300005444 | Bacteria | 1544 |
| 48 | Ga0070681_10035651 | 3300005458 | Bacteria | 4997 |
| 49 | Ga0070681_10080988 | 3300005458 | Bacteria | 3202 |
| 50 | Ga0068867_100093951 | 3300005459 | Bacteria | 2280 |
| 51 | Ga0068867_100180251 | 3300005459 | Bacteria | 1679 |
| 52 | Ga0070706_100420863 | 3300005467 | Bacteria | 1243 |
| 53 | Ga0070707_100221259 | 3300005468 | Bacteria | 1844 |
| 54 | Ga0070698_100064688 | 3300005471 | Bacteria | 3684 |
| 55 | Ga0070699_100295318 | 3300005518 | Bacteria | 1453 |
| 56 | Ga0070697_100271750 | 3300005536 | Bacteria | 1453 |
| 57 | Ga0070672_100015950 | 3300005543 | Bacteria | 5366 |
| 58 | Ga0070672_100237428 | 3300005543 | Unclassified | 1532 |
| 59 | Ga0070672_100555386 | 3300005543 | Bacteria | 997 |
| 60 | Ga0070695_100489267 | 3300005545 | Unclassified | 949 |
| 61 | Ga0070696_100050262 | 3300005546 | Unclassified | 2898 |
| 62 | Ga0070696_100222302 | 3300005546 | Bacteria | 1417 |
| 63 | Ga0070696_100278596 | 3300005546 | Unclassified | 1274 |
| 64 | Ga0070693_100049937 | 3300005547 | Unclassified | 2389 |
| 65 | Ga0070704_100160165 | 3300005549 | Bacteria | 1779 |
| 66 | Ga0068855_100309480 | 3300005563 | Bacteria | 1748 |
| 67 | Ga0070664_100005272 | 3300005564 | Bacteria | 10372 |
| 68 | Ga0070664_101159948 | 3300005564 | Bacteria | 728 |
| 69 | Ga0068857_100131687 | 3300005577 | Bacteria | 2256 |
| 70 | Ga0068857_100647108 | 3300005577 | Bacteria | 1002 |
| 71 | Ga0068859_100168146 | 3300005617 | Bacteria | 2273 |
| 72 | Ga0068864_100060246 | 3300005618 | Bacteria | 3287 |
| 73 | Ga0068864_100208122 | 3300005618 | Bacteria | 1800 |
| 74 | Ga0068864_100498468 | 3300005618 | Bacteria | 1171 |
| 75 | Ga0068861_100000717 | 3300005719 | Bacteria | 19814 |
| 76 | Ga0068861_100012649 | 3300005719 | Bacteria | 5890 |
| 77 | Ga0068861_100116126 | 3300005719 | Bacteria | 2151 |
| 78 | Ga0068861_100209494 | 3300005719 | Bacteria | 1641 |
| 79 | Ga0068851_10151402 | 3300005834 | Unclassified | 1268 |
| 80 | Ga0068863_100111949 | 3300005841 | Bacteria | 2600 |
| 81 | Ga0068860_100365267 | 3300005843 | Bacteria | 1423 |
| 82 | Ga0068862_100019246 | 3300005844 | Bacteria | 5693 |
| 83 | Ga0068862_100463274 | 3300005844 | Bacteria | 1197 |
| 84 | Ga0081539_10000931 | 3300005985 | Bacteria | 54965 |
| 85 | Ga0081539_10191882 | 3300005985 | Bacteria | 950 |
| 86 | Ga0075430_100085070 | 3300006846 | Bacteria | 2648 |
| 87 | Ga0075431_100022871 | 3300006847 | Bacteria | 6390 |
| 88 | Ga0075433_10199592 | 3300006852 | Bacteria | 1779 |
| 89 | Ga0075433_10912600 | 3300006852 | Bacteria | 766 |
| 90 | Ga0075434_100233061 | 3300006871 | Bacteria | 1861 |
| 91 | Ga0075429_100052472 | 3300006880 | Bacteria | 3548 |
| 92 | Ga0075429_100153597 | 3300006880 | Bacteria | 2016 |
| 93 | Ga0068865_100030006 | 3300006881 | Bacteria | 3613 |
| 94 | Ga0097620_100168149 | 3300006931 | Bacteria | 2273 |
| 95 | Ga0105251_10112133 | 3300009011 | Bacteria | 1242 |
| 96 | Ga0105244_10012248 | 3300009036 | Bacteria | 5080 |
| 97 | Ga0105240_10249507 | 3300009093 | Unclassified | 2053 |
| 98 | Ga0111539_10001784 | 3300009094 | Bacteria | 28601 |
| 99 | Ga0111539_10028899 | 3300009094 | Bacteria | 6760 |
| 100 | Ga0111539_10047971 | 3300009094 | Bacteria | 5101 |
| 101 | Ga0111539_10098256 | 3300009094 | Bacteria | 3439 |
| 102 | Ga0111539_10219460 | 3300009094 | Bacteria | 2215 |
| 103 | Ga0105245_10558009 | 3300009098 | Bacteria | 1168 |
| 104 | Ga0105247_10041765 | 3300009101 | Bacteria | 2807 |
| 105 | Ga0114129_10035729 | 3300009147 | Bacteria | 7019 |
| 106 | Ga0114129_10091679 | 3300009147 | Bacteria | 4209 |
| 107 | Ga0105243_10206510 | 3300009148 | Bacteria | 1726 |
| 108 | Ga0105243_10605791 | 3300009148 | Bacteria | 1055 |
| 109 | Ga0105241_10632766 | 3300009174 | Bacteria | 970 |
| 110 | Ga0105242_10117394 | 3300009176 | Bacteria | 2278 |
| 111 | Ga0105248_10004355 | 3300009177 | Bacteria | 15659 |
| 112 | Ga0105248_10278866 | 3300009177 | Bacteria | 1882 |
| 113 | Ga0105248_10601702 | 3300009177 | Bacteria | 1240 |
| 114 | Ga0105248_10910823 | 3300009177 | Bacteria | 993 |
| 115 | Ga0105237_10046966 | 3300009545 | Unclassified | 4341 |
| 116 | Ga0105238_10003979 | 3300009551 | Bacteria | 14660 |
| 117 | Ga0105249_10725368 | 3300009553 | Bacteria | 1055 |
| 118 | Ga0105249_10803840 | 3300009553 | Bacteria | 1004 |
| 119 | Ga0105239_10344341 | 3300010375 | Bacteria | 1683 |
| 120 | Ga0105239_11256411 | 3300010375 | Bacteria | 854 |
| 121 | Ga0105246_10133097 | 3300011119 | Bacteria | 1860 |
| 122 | Ga0157373_10035619 | 3300013100 | Bacteria | 3573 |
| 123 | Ga0157373_10308994 | 3300013100 | Bacteria | 1123 |
| 124 | Ga0157371_10000076 | 3300013102 | Bacteria | 161805 |
| 125 | Ga0157371_10165292 | 3300013102 | Bacteria | 1580 |
| 126 | Ga0157370_10003006 | 3300013104 | Bacteria | 20011 |
| 127 | Ga0157370_10003873 | 3300013104 | Bacteria | 17430 |
| 128 | Ga0157370_10013679 | 3300013104 | Bacteria | 8342 |
| 129 | Ga0157370_10168289 | 3300013104 | Bacteria | 2038 |
| 130 | Ga0157370_10956751 | 3300013104 | Bacteria | 776 |
| 131 | Ga0157369_10000007 | 3300013105 | Bacteria | 402562 |
| 132 | Ga0157378_10098974 | 3300013297 | Bacteria | 2660 |
| 133 | Ga0163162_10000035 | 3300013306 | Bacteria | 147102 |
| 134 | Ga0163162_10412799 | 3300013306 | Unclassified | 1482 |
| 135 | Ga0163162_10948211 | 3300013306 | Bacteria | 972 |
| 136 | Ga0163162_10990620 | 3300013306 | Bacteria | 950 |
| 137 | Ga0157372_10154751 | 3300013307 | Bacteria | 2648 |
| 138 | Ga0157372_10718721 | 3300013307 | Bacteria | 1162 |
| 139 | Ga0157375_10005467 | 3300013308 | Bacteria | 11047 |
| 140 | Ga0157375_10006063 | 3300013308 | Bacteria | 10541 |
| 141 | Ga0157375_10453309 | 3300013308 | Bacteria | 1448 |
| 142 | Ga0163163_10000184 | 3300014325 | Bacteria | 64203 |
| 143 | Ga0163163_10131066 | 3300014325 | Bacteria | 2547 |
| 144 | Ga0163163_10198506 | 3300014325 | Bacteria | 2054 |
| 145 | Ga0163163_10255570 | 3300014325 | Bacteria | 1803 |
| 146 | Ga0157380_10000008 | 3300014326 | Bacteria | 154993 |
| 147 | Ga0157380_10001861 | 3300014326 | Bacteria | 13957 |
| 148 | Ga0157380_10276040 | 3300014326 | Bacteria | 1535 |
| 149 | Ga0157380_10501151 | 3300014326 | Bacteria | 1179 |
| 150 | Ga0182008_10000222 | 3300014497 | Bacteria | 44722 |
| 151 | Ga0182006_1000220 | 3300015261 | Bacteria | 55777 |
| 152 | Ga0182006_1000233 | 3300015261 | Bacteria | 52709 |
| 153 | Ga0182007_10000007 | 3300015262 | Bacteria | 376596 |
| 154 | Ga0183373_1001 | 3300015682 | Bacteria | 1410374 |
| 155 | Ga0163161_10000129 | 3300017792 | Bacteria | 70623 |
| 156 | Ga0163161_10000130 | 3300017792 | Bacteria | 70533 |
| 157 | Ga0163161_10002968 | 3300017792 | Bacteria | 12021 |
| 158 | Ga0163161_10003393 | 3300017792 | Bacteria | 11184 |
| 159 | Ga0163161_10004473 | 3300017792 | Bacteria | 9726 |
| 160 | Ga0163161_10018415 | 3300017792 | Bacteria | 4896 |
| 161 | Ga0209258_100068 | 3300025242 | Bacteria | 286288 |
| 162 | Ga0207425_1000023 | 3300025245 | Bacteria | 341339 |
| 163 | Ga0209148_1000182 | 3300025254 | Bacteria | 123558 |
| 164 | Ga0209129_1000032 | 3300025258 | Bacteria | 341150 |
| 165 | Ga0209676_1000201 | 3300025292 | Bacteria | 133195 |
| 166 | Ga0209025_1000047 | 3300025294 | Bacteria | 341150 |
| 167 | Ga0209758_1000144 | 3300025297 | Bacteria | 170724 |
| 168 | Ga0209050_1000203 | 3300025298 | Bacteria | 133156 |
| 169 | Ga0207682_10007631 | 3300025893 | Bacteria | 4304 |
| 170 | Ga0207710_10429227 | 3300025900 | Bacteria | 681 |
| 171 | Ga0207645_10093736 | 3300025907 | Unclassified | 1932 |
| 172 | Ga0207654_10093961 | 3300025911 | Bacteria | 1834 |
| 173 | Ga0207695_10217179 | 3300025913 | Bacteria | 1820 |
| 174 | Ga0207660_10241682 | 3300025917 | Bacteria | 1423 |
| 175 | Ga0207662_10056772 | 3300025918 | Unclassified | 2339 |
| 176 | Ga0207662_10110425 | 3300025918 | Bacteria | 1714 |
| 177 | Ga0207646_10119090 | 3300025922 | Bacteria | 2372 |
| 178 | Ga0207681_10291186 | 3300025923 | Bacteria | 1289 |
| 179 | Ga0207681_10742956 | 3300025923 | Bacteria | 817 |
| 180 | Ga0207681_10920460 | 3300025923 | Bacteria | 732 |
| 181 | Ga0207650_10000027 | 3300025925 | Bacteria | 257466 |
| 182 | Ga0207650_10269972 | 3300025925 | Bacteria | 1382 |
| 183 | Ga0207659_10084094 | 3300025926 | Bacteria | 2361 |
| 184 | Ga0207644_10428481 | 3300025931 | Bacteria | 1084 |
| 185 | Ga0207686_10114467 | 3300025934 | Bacteria | 1825 |
| 186 | Ga0207709_10131502 | 3300025935 | Bacteria | 1706 |
| 187 | Ga0207709_10854705 | 3300025935 | Bacteria | 737 |
| 188 | Ga0207670_10496330 | 3300025936 | Bacteria | 990 |
| 189 | Ga0207669_10174776 | 3300025937 | Bacteria | 1533 |
| 190 | Ga0207704_10151512 | 3300025938 | Bacteria | 1637 |
| 191 | Ga0207691_10008234 | 3300025940 | Bacteria | 10011 |
| 192 | Ga0207691_10246090 | 3300025940 | Unclassified | 1545 |
| 193 | Ga0207711_10394455 | 3300025941 | Bacteria | 1285 |
| 194 | Ga0207679_10019515 | 3300025945 | Unclassified | 4555 |
| 195 | Ga0207679_10297621 | 3300025945 | Bacteria | 1390 |
| 196 | Ga0207679_10566343 | 3300025945 | Bacteria | 1021 |
| 197 | Ga0207667_10256732 | 3300025949 | Bacteria | 1788 |
| 198 | Ga0207667_10419375 | 3300025949 | Bacteria | 1362 |
| 199 | Ga0207651_10022857 | 3300025960 | Bacteria | 3834 |
| 200 | Ga0207651_10187305 | 3300025960 | Bacteria | 1648 |
| 201 | Ga0207712_10444424 | 3300025961 | Bacteria | 1098 |
| 202 | Ga0207668_10167436 | 3300025972 | Bacteria | 1720 |
| 203 | Ga0207668_10782840 | 3300025972 | Bacteria | 843 |
| 204 | Ga0207640_10676781 | 3300025981 | Bacteria | 882 |
| 205 | Ga0207640_10678409 | 3300025981 | Bacteria | 881 |
| 206 | Ga0207677_10448936 | 3300026023 | Bacteria | 1104 |
| 207 | Ga0207708_10001124 | 3300026075 | Bacteria | 20108 |
| 208 | Ga0207708_10521676 | 3300026075 | Bacteria | 998 |
| 209 | Ga0207641_10099475 | 3300026088 | Bacteria | 2559 |
| 210 | Ga0207641_10208529 | 3300026088 | Bacteria | 1806 |
| 211 | Ga0207641_10277890 | 3300026088 | Bacteria | 1574 |
| 212 | Ga0207648_10038301 | 3300026089 | Bacteria | 4220 |
| 213 | Ga0207648_10057489 | 3300026089 | Bacteria | 3394 |
| 214 | Ga0207648_10158907 | 3300026089 | Bacteria | 1996 |
| 215 | Ga0207676_10025531 | 3300026095 | Bacteria | 4383 |
| 216 | Ga0207676_10045421 | 3300026095 | Bacteria | 3394 |
| 217 | Ga0207676_10169176 | 3300026095 | Bacteria | 1902 |
| 218 | Ga0207676_10191318 | 3300026095 | Bacteria | 1801 |
| 219 | Ga0207674_10057280 | 3300026116 | Bacteria | 3950 |
| 220 | Ga0207674_10075976 | 3300026116 | Bacteria | 3368 |
| 221 | Ga0207674_10567497 | 3300026116 | Bacteria | 1096 |
| 222 | Ga0207674_10580973 | 3300026116 | Bacteria | 1082 |
| 223 | Ga0207675_100008057 | 3300026118 | Bacteria | 9928 |
| 224 | Ga0207675_100015795 | 3300026118 | Bacteria | 7041 |
| 225 | Ga0207675_100504549 | 3300026118 | Bacteria | 1205 |
| 226 | Ga0207428_10081400 | 3300027907 | Unclassified | 2528 |
| 227 | Ga0268265_10010947 | 3300028380 | Bacteria | 6124 |
| 228 | Ga0316177_1134613 | 3300030731 | Bacteria | 921 |
| 229 | Ga0265327_10008181 | 3300031251 | Bacteria | 7850 |
| 230 | Ga0307405_10000037 | 3300031731 | Bacteria | 91045 |
| 231 | Ga0307406_10098457 | 3300031901 | Bacteria | 1986 |
| 232 | Ga0307407_10000025 | 3300031903 | Bacteria | 112811 |
| 233 | Ga0307412_10606838 | 3300031911 | Bacteria | 928 |
| 234 | Ga0307409_100005817 | 3300031995 | Bacteria | 7154 |
| 235 | Ga0307416_100000068 | 3300032002 | Bacteria | 86974 |
| 236 | Ga0307416_100659021 | 3300032002 | Bacteria | 1132 |
| 237 | Ga0307416_100996184 | 3300032002 | Bacteria | 941 |
| 238 | Ga0307414_10001935 | 3300032004 | Bacteria | 10717 |
| 239 | Ga0307414_10006440 | 3300032004 | Bacteria | 6548 |
| 240 | Ga0307414_10033959 | 3300032004 | Bacteria | 3376 |
| 241 | Ga0307414_10043955 | 3300032004 | Unclassified | 3046 |
| 242 | Ga0307414_10047818 | 3300032004 | Bacteria | 2947 |
| 243 | Ga0307414_10095703 | 3300032004 | Bacteria | 2220 |
| 244 | Ga0307414_10575404 | 3300032004 | Bacteria | 1007 |
| 245 | Ga0307415_100124661 | 3300032126 | Bacteria | 1939 |
| 246 | Ga0316574_0060724 | 3300035398 | Bacteria | 2373 |
| 247 | Ga0316574_0317154 | 3300035398 | Bacteria | 990 |
| 248 | Ga0395898_0061645 | 3300037466 | Bacteria | 3644 |
| 249 | Ga0451806_360421 | 3300041462 | Bacteria | 733 |
| 250 | Ga0451837_1233849 | 3300041494 | Bacteria | 1957 |
| 251 | Ga0439431_0005913 | 3300041997 | Bacteria | 2704 |
| 252 | Ga0439434_0111275 | 3300042435 | Bacteria | 887 |
| 253 | Ga0451577_0014962 | 3300042876 | Bacteria | 7221 |
| 254 | Ga0451577_0047993 | 3300042876 | Unclassified | 3816 |
| 255 | Ga0451577_0106898 | 3300042876 | Bacteria | 2501 |
| 256 | Ga0451577_0172530 | 3300042876 | Bacteria | 1949 |
| 257 | Ga0453684_0010245 | 3300044712 | Bacteria | 16057 |
| 258 | Ga0453684_0013738 | 3300044712 | Bacteria | 13099 |
| 259 | Ga0453684_0458258 | 3300044712 | Unclassified | 1418 |
| 260 | Ga0451576_0000022 | 3300045051 | Bacteria | 495037 |
| 261 | Ga0451576_0069405 | 3300045051 | Unclassified | 3667 |
| 262 | Ga0451576_0126853 | 3300045051 | Bacteria | 2659 |
| 263 | Ga0495627_000022 | 3300046453 | Bacteria | 254672 |
| 264 | Ga0495627_002917 | 3300046453 | Bacteria | 7866 |
| 265 | Ga0495627_006462 | 3300046453 | Bacteria | 4591 |
| 266 | Ga0495607_0019477 | 3300046501 | Bacteria | 4310 |
| 267 | Ga0495606_0033429 | 3300046507 | Bacteria | 3547 |
| 268 | Ga0495610_0002219 | 3300046512 | Bacteria | 16439 |
| 269 | Ga0495610_0004850 | 3300046512 | Bacteria | 9786 |
| 270 | Ga0495616_0002791 | 3300046513 | Bacteria | 11405 |
| 271 | Ga0495643_0036723 | 3300046522 | Bacteria | 2690 |
| 272 | Ga0495654_0000003 | 3300046530 | Bacteria | 863485 |
| 273 | Ga0495633_0000001 | 3300046558 | Bacteria | 801972 |
| 274 | Ga0495633_0000058 | 3300046558 | Bacteria | 147584 |
| 275 | Ga0495633_0012073 | 3300046558 | Bacteria | 4613 |
| 276 | Ga0495668_0000451 | 3300046616 | Bacteria | 52539 |
| 277 | Ga0495625_0042068 | 3300046660 | Bacteria | 3322 |
| 278 | Ga0495686_0000256 | 3300047472 | Bacteria | 95552 |
| 279 | Ga0495686_0032254 | 3300047472 | Bacteria | 3391 |
| 280 | Ga0496104_0133017 | 3300048907 | Bacteria | 2390 |
| 281 | Ga0496107_0173957 | 3300048910 | Bacteria | 1598 |
| 282 | Ga0496112_0472056 | 3300048915 | Bacteria | 1192 |
| 283 | Ga0496116_0229226 | 3300048919 | Bacteria | 944 |
| 284 | Ga0496121_0000343 | 3300048924 | Bacteria | 96972 |
| 285 | Ga0496125_0010171 | 3300048928 | Bacteria | 9535 |
| 286 | Ga0496126_0027853 | 3300048929 | Bacteria | 5390 |
| 287 | Ga0501291_001169 | 3300049514 | Bacteria | 3027 |
| 288 | Ga0501292_032328 | 3300049515 | Bacteria | 883 |
| 289 | Ga0501296_009021 | 3300049519 | Bacteria | 1164 |
| 290 | Ga0501298_003380 | 3300049521 | Bacteria | 2473 |
| 291 | Ga0501299_001227 | 3300049522 | Bacteria | 3242 |
| 292 | Ga0501201_003882 | 3300049651 | Bacteria | 1379 |
| 293 | Ga0501202_010633 | 3300049652 | Bacteria | 1711 |
| 294 | Ga0501207_014283 | 3300049654 | Bacteria | 1211 |
| 295 | Ga0501216_001603 | 3300049660 | Bacteria | 3090 |
| 296 | Ga0501217_026638 | 3300049661 | Bacteria | 1398 |
| 297 | Ga0501235_035666 | 3300049669 | Bacteria | 1130 |
| 298 | Ga0501249_024544 | 3300049679 | Bacteria | 1328 |
| 299 | Ga0501234_005600 | 3300049707 | Bacteria | 1965 |
| 300 | Ga0501270_004552 | 3300049767 | Bacteria | 1563 |
| 301 | Ga0501280_009810 | 3300049776 | Bacteria | 1333 |
| 302 | nmdc:mga05p37_224513_c1 | 3300050507 | Unclassified | 2265 |
| 303 | nmdc:mga05p37_78968_c1 | 3300050507 | Bacteria | 4052 |
| 304 | nmdc:mga0qj67_255118_c1 | 3300050509 | Bacteria | 1423 |
| 305 | nmdc:mga06r32_138951_c1 | 3300050510 | Unclassified | 2405 |
| 306 | nmdc:mga06r32_244222_c1 | 3300050510 | Bacteria | 1783 |
| 307 | nmdc:mga08y16_12276_c1 | 3300050511 | Bacteria | 9005 |
| 308 | nmdc:mga08y16_265361_c1 | 3300050511 | Bacteria | 1773 |
| 309 | nmdc:mga08y16_55975_c1 | 3300050511 | Bacteria | 4122 |
| 310 | nmdc:mga0n895_156653_c1 | 3300050512 | Bacteria | 2308 |
| 311 | nmdc:mga0n895_369574_c1 | 3300050512 | Bacteria | 1452 |
| 312 | nmdc:mga0n895_874372_c1 | 3300050512 | Bacteria | 885 |
| 313 | nmdc:mga08x19_66524_c1 | 3300050514 | Bacteria | 2342 |
| 314 | nmdc:mga0a205_366456_c1 | 3300050515 | Bacteria | 1307 |
| 315 | nmdc:mga0a205_57542_c1 | 3300050515 | Bacteria | 3754 |
| 316 | Ga0500644_0000420 | 3300053088 | Bacteria | 19919 |
| 317 | Ga0500646_0005078 | 3300053090 | Bacteria | 3337 |
| 318 | Ga0500651_0057253 | 3300053093 | Bacteria | 2440 |
| 319 | Ga0500651_0240954 | 3300053093 | Bacteria | 1054 |
| 320 | Ga0500641_0093334 | 3300053096 | Bacteria | 1286 |
| 321 | Ga0500556_0063362 | 3300053104 | Bacteria | 1366 |
| 322 | Ga0500569_000151 | 3300053109 | Bacteria | 11053 |
| 323 | Ga0500658_0001430 | 3300053134 | Bacteria | 9602 |
| 324 | Ga0500559_0015611 | 3300053136 | Bacteria | 3207 |
| 325 | Ga0500577_0000568 | 3300053142 | Bacteria | 9552 |
| 326 | Ga0500589_026931 | 3300053147 | Bacteria | 2667 |
| 327 | Ga0500590_034091 | 3300053148 | Bacteria | 2636 |
| 328 | Ga0500616_0002337 | 3300053153 | Bacteria | 15977 |
| 329 | Ga0500616_0007054 | 3300053153 | Bacteria | 7213 |
| 330 | Ga0500622_0000258 | 3300053156 | Bacteria | 53957 |
| 331 | Ga0500622_0031277 | 3300053156 | Bacteria | 2793 |
| 332 | Ga0500633_0015214 | 3300053160 | Bacteria | 2202 |
| 333 | Ga0500636_0009767 | 3300053177 | Bacteria | 5589 |
| 334 | Ga0500656_014586 | 3300053732 | Bacteria | 911 |
| 335 | 2511232993 | 2511231000 | Bacteria | 4488346 |
| 336 | 2585159587 | 2582581281 | Bacteria | 4487904 |
| 337 | 2585163844 | 2582581282 | Bacteria | 4495830 |
| 338 | 2586211133 | 2585427687 | Bacteria | 5544917 |
| 339 | 2587944674 | 2585428115 | Bacteria | 4420269 |
| 340 | 2738856422 | 2738541302 | Bacteria | 5944758 |
| 341 | 2739589258 | 2739367651 | Bacteria | 6359826 |
| 342 | 2739614284 | 2739367656 | Bacteria | 5152243 |
| 343 | 2739647010 | 2739367663 | Bacteria | 5040914 |
| 344 | 2819546830 | 2818991437 | Bacteria | 5805520 |
| 345 | 2833641855 | 2833640130 | Bacteria | 4858325 |
| 346 | 2842725534 | 2842722452 | Bacteria | 6263924 |
| 347 | 2842914681 | 2842909656 | Bacteria | 6185908 |
| 348 | 2849283240 | 2849281842 | Bacteria | 6065644 |
| 349 | 2857631427 | 2857627736 | Bacteria | 5625397 |
| 350 | 2881250052 | 2881247448 | Bacteria | 3717788 |
| 351 | 2881955558 | 2881955468 | Bacteria | 3545609 |
| 352 | 2904447001 | 2904445276 | Bacteria | 5310396 |
| 353 | 2929244946 | 2929239360 | Bacteria | 7745570 |
| 354 | 2946002557 | 2945997725 | Bacteria | 6404843 |
| 355 | 2954019395 | 2954016120 | Bacteria | 6446024 |
| 356 | rootL2_10213808 | |||
| 357 | CNBas_1000622 | |||
| 358 | CNAas_1000866 | |||
| 359 | JGI24751J29686_10000085 | |||
| 360 | JGI25152J39213_1000173 | |||
| 361 | JGI25150J39212_1000015 | |||
| 362 | JGI25151J46595_10000043 | |||
| 363 | JGI25406J46586_10014069 | |||
| 364 | JGI25153J46596_10000009 | |||
| 365 | rootH1_10069206 | |||
| 366 | rootH1_10085030 | |||
| 367 | rootH1_10117961 | |||
| 368 | rootH2_10178981 | |||
| 369 | rootL2_10043609 | |||
| 370 | rootL2_10161806 | |||
| 371 | Ga0055536_1000038 | |||
| 372 | Ga0055530_10004665 | |||
| 373 | Ga0065714_10064423 | |||
| 374 | Ga0065714_10077479 | |||
| 375 | Ga0065714_10091394 | |||
| 376 | Ga0065714_10111169 | |||
| 377 | Ga0065704_10086192 | |||
| 378 | Ga0065704_10350609 | |||
| 379 | Ga0065704_10383512 | |||
| 380 | Ga0065707_10004569 | |||
| 381 | Ga0065707_10005370 | |||
| 382 | Ga0070676_10089518 | |||
| 383 | Ga0070690_100390922 | |||
| 384 | Ga0070670_100000057 | |||
| 385 | Ga0070670_100226403 | |||
| 386 | Ga0070677_10004320 | |||
| 387 | Ga0068868_100077375 | |||
| 388 | Ga0070687_100041178 | |||
| 389 | Ga0070692_10035567 | |||
| 390 | Ga0070675_100066899 | |||
| 391 | Ga0070671_100017952 | |||
| 392 | Ga0070674_100030866 | |||
| 393 | Ga0070673_100215380 | |||
| 394 | Ga0070673_100518074 | |||
| 395 | Ga0070659_100362329 | |||
| 396 | Ga0070659_100566304 | |||
| 397 | Ga0070705_100059963 | |||
| 398 | Ga0070705_100849452 | |||
| 399 | Ga0070700_100001165 | |||
| 400 | Ga0070694_100011491 | |||
| 401 | Ga0070694_100125271 | |||
| 402 | Ga0070694_100184730 | |||
| 403 | Ga0070681_10035651 | |||
| 404 | Ga0070681_10080988 | |||
| 405 | Ga0068867_100093951 | |||
| 406 | Ga0068867_100180251 | |||
| 407 | Ga0070706_100420863 | |||
| 408 | Ga0070707_100221259 | |||
| 409 | Ga0070698_100064688 | |||
| 410 | Ga0070699_100295318 | |||
| 411 | Ga0070697_100271750 | |||
| 412 | Ga0070672_100015950 | |||
| 413 | Ga0070672_100237428 | |||
| 414 | Ga0070672_100555386 | |||
| 415 | Ga0070695_100489267 | |||
| 416 | Ga0070696_100050262 | |||
| 417 | Ga0070696_100222302 | |||
| 418 | Ga0070696_100278596 | |||
| 419 | Ga0070693_100049937 | |||
| 420 | Ga0070704_100160165 | |||
| 421 | Ga0068855_100309480 | |||
| 422 | Ga0070664_100005272 | |||
| 423 | Ga0070664_101159948 | |||
| 424 | Ga0068857_100131687 | |||
| 425 | Ga0068857_100647108 | |||
| 426 | Ga0068859_100168146 | |||
| 427 | Ga0068864_100060246 | |||
| 428 | Ga0068864_100208122 | |||
| 429 | Ga0068864_100498468 | |||
| 430 | Ga0068861_100000717 | |||
| 431 | Ga0068861_100012649 | |||
| 432 | Ga0068861_100116126 | |||
| 433 | Ga0068861_100209494 | |||
| 434 | Ga0068851_10151402 | |||
| 435 | Ga0068863_100111949 | |||
| 436 | Ga0068860_100365267 | |||
| 437 | Ga0068862_100019246 | |||
| 438 | Ga0068862_100463274 | |||
| 439 | Ga0081539_10000931 | |||
| 440 | Ga0081539_10191882 | |||
| 441 | Ga0075430_100085070 | |||
| 442 | Ga0075431_100022871 | |||
| 443 | Ga0075433_10199592 | |||
| 444 | Ga0075433_10912600 | |||
| 445 | Ga0075434_100233061 | |||
| 446 | Ga0075429_100052472 | |||
| 447 | Ga0075429_100153597 | |||
| 448 | Ga0068865_100030006 | |||
| 449 | Ga0097620_100168149 | |||
| 450 | Ga0105251_10112133 | |||
| 451 | Ga0105244_10012248 | |||
| 452 | Ga0105240_10249507 | |||
| 453 | Ga0111539_10001784 | |||
| 454 | Ga0111539_10028899 | |||
| 455 | Ga0111539_10047971 | |||
| 456 | Ga0111539_10098256 | |||
| 457 | Ga0111539_10219460 | |||
| 458 | Ga0105245_10558009 | |||
| 459 | Ga0105247_10041765 | |||
| 460 | Ga0114129_10035729 | |||
| 461 | Ga0114129_10091679 | |||
| 462 | Ga0105243_10206510 | |||
| 463 | Ga0105243_10605791 | |||
| 464 | Ga0105241_10632766 | |||
| 465 | Ga0105242_10117394 | |||
| 466 | Ga0105248_10004355 | |||
| 467 | Ga0105248_10278866 | |||
| 468 | Ga0105248_10601702 | |||
| 469 | Ga0105248_10910823 | |||
| 470 | Ga0105237_10046966 | |||
| 471 | Ga0105238_10003979 | |||
| 472 | Ga0105249_10725368 | |||
| 473 | Ga0105249_10803840 | |||
| 474 | Ga0105239_10344341 | |||
| 475 | Ga0105239_11256411 | |||
| 476 | Ga0105246_10133097 | |||
| 477 | Ga0157373_10035619 | |||
| 478 | Ga0157373_10308994 | |||
| 479 | Ga0157371_10000076 | |||
| 480 | Ga0157371_10165292 | |||
| 481 | Ga0157370_10003006 | |||
| 482 | Ga0157370_10003873 | |||
| 483 | Ga0157370_10013679 | |||
| 484 | Ga0157370_10168289 | |||
| 485 | Ga0157370_10956751 | |||
| 486 | Ga0157369_10000007 | |||
| 487 | Ga0157378_10098974 | |||
| 488 | Ga0163162_10000035 | |||
| 489 | Ga0163162_10412799 | |||
| 490 | Ga0163162_10948211 | |||
| 491 | Ga0163162_10990620 | |||
| 492 | Ga0157372_10154751 | |||
| 493 | Ga0157372_10718721 | |||
| 494 | Ga0157375_10005467 | |||
| 495 | Ga0157375_10006063 | |||
| 496 | Ga0157375_10453309 | |||
| 497 | Ga0163163_10000184 | |||
| 498 | Ga0163163_10131066 | |||
| 499 | Ga0163163_10198506 | |||
| 500 | Ga0163163_10255570 | |||
| 501 | Ga0157380_10000008 | |||
| 502 | Ga0157380_10001861 | |||
| 503 | Ga0157380_10276040 | |||
| 504 | Ga0157380_10501151 | |||
| 505 | Ga0182008_10000222 | |||
| 506 | Ga0182006_1000220 | |||
| 507 | Ga0182006_1000233 | |||
| 508 | Ga0182007_10000007 | |||
| 509 | Ga0183373_1001 | |||
| 510 | Ga0163161_10000129 | |||
| 511 | Ga0163161_10000130 | |||
| 512 | Ga0163161_10002968 | |||
| 513 | Ga0163161_10003393 | |||
| 514 | Ga0163161_10004473 | |||
| 515 | Ga0163161_10018415 | |||
| 516 | Ga0209258_100068 | |||
| 517 | Ga0207425_1000023 | |||
| 518 | Ga0209148_1000182 | |||
| 519 | Ga0209129_1000032 | |||
| 520 | Ga0209676_1000201 | |||
| 521 | Ga0209025_1000047 | |||
| 522 | Ga0209758_1000144 | |||
| 523 | Ga0209050_1000203 | |||
| 524 | Ga0207682_10007631 | |||
| 525 | Ga0207710_10429227 | |||
| 526 | Ga0207645_10093736 | |||
| 527 | Ga0207654_10093961 | |||
| 528 | Ga0207695_10217179 | |||
| 529 | Ga0207660_10241682 | |||
| 530 | Ga0207662_10056772 | |||
| 531 | Ga0207662_10110425 | |||
| 532 | Ga0207646_10119090 | |||
| 533 | Ga0207681_10291186 | |||
| 534 | Ga0207681_10742956 | |||
| 535 | Ga0207681_10920460 | |||
| 536 | Ga0207650_10000027 | |||
| 537 | Ga0207650_10269972 | |||
| 538 | Ga0207659_10084094 | |||
| 539 | Ga0207644_10428481 | |||
| 540 | Ga0207686_10114467 | |||
| 541 | Ga0207709_10131502 | |||
| 542 | Ga0207709_10854705 | |||
| 543 | Ga0207670_10496330 | |||
| 544 | Ga0207669_10174776 | |||
| 545 | Ga0207704_10151512 | |||
| 546 | Ga0207691_10008234 | |||
| 547 | Ga0207691_10246090 | |||
| 548 | Ga0207711_10394455 | |||
| 549 | Ga0207679_10019515 | |||
| 550 | Ga0207679_10297621 | |||
| 551 | Ga0207679_10566343 | |||
| 552 | Ga0207667_10256732 | |||
| 553 | Ga0207667_10419375 | |||
| 554 | Ga0207651_10022857 | |||
| 555 | Ga0207651_10187305 | |||
| 556 | Ga0207712_10444424 | |||
| 557 | Ga0207668_10167436 | |||
| 558 | Ga0207668_10782840 | |||
| 559 | Ga0207640_10676781 | |||
| 560 | Ga0207640_10678409 | |||
| 561 | Ga0207677_10448936 | |||
| 562 | Ga0207708_10001124 | |||
| 563 | Ga0207708_10521676 | |||
| 564 | Ga0207641_10099475 | |||
| 565 | Ga0207641_10208529 | |||
| 566 | Ga0207641_10277890 | |||
| 567 | Ga0207648_10038301 | |||
| 568 | Ga0207648_10057489 | |||
| 569 | Ga0207648_10158907 | |||
| 570 | Ga0207676_10025531 | |||
| 571 | Ga0207676_10045421 | |||
| 572 | Ga0207676_10169176 | |||
| 573 | Ga0207676_10191318 | |||
| 574 | Ga0207674_10057280 | |||
| 575 | Ga0207674_10075976 | |||
| 576 | Ga0207674_10567497 | |||
| 577 | Ga0207674_10580973 | |||
| 578 | Ga0207675_100008057 | |||
| 579 | Ga0207675_100015795 | |||
| 580 | Ga0207675_100504549 | |||
| 581 | Ga0207428_10081400 | |||
| 582 | Ga0268265_10010947 | |||
| 583 | Ga0316177_1134613 | |||
| 584 | Ga0265327_10008181 | |||
| 585 | Ga0307405_10000037 | |||
| 586 | Ga0307406_10098457 | |||
| 587 | Ga0307407_10000025 | |||
| 588 | Ga0307412_10606838 | |||
| 589 | Ga0307409_100005817 | |||
| 590 | Ga0307416_100000068 | |||
| 591 | Ga0307416_100659021 | |||
| 592 | Ga0307416_100996184 | |||
| 593 | Ga0307414_10001935 | |||
| 594 | Ga0307414_10006440 | |||
| 595 | Ga0307414_10033959 | |||
| 596 | Ga0307414_10043955 | |||
| 597 | Ga0307414_10047818 | |||
| 598 | Ga0307414_10095703 | |||
| 599 | Ga0307414_10575404 | |||
| 600 | Ga0307415_100124661 | |||
| 601 | Ga0316574_0060724 | |||
| 602 | Ga0316574_0317154 | |||
| 603 | Ga0395898_0061645 | |||
| 604 | Ga0451806_360421 | |||
| 605 | Ga0451837_1233849 | |||
| 606 | Ga0439431_0005913 | |||
| 607 | Ga0439434_0111275 | |||
| 608 | Ga0451577_0014962 | |||
| 609 | Ga0451577_0047993 | |||
| 610 | Ga0451577_0106898 | |||
| 611 | Ga0451577_0172530 | |||
| 612 | Ga0453684_0010245 | |||
| 613 | Ga0453684_0013738 | |||
| 614 | Ga0453684_0458258 | |||
| 615 | Ga0451576_0000022 | |||
| 616 | Ga0451576_0069405 | |||
| 617 | Ga0451576_0126853 | |||
| 618 | Ga0495627_000022 | |||
| 619 | Ga0495627_002917 | |||
| 620 | Ga0495627_006462 | |||
| 621 | Ga0495607_0019477 | |||
| 622 | Ga0495606_0033429 | |||
| 623 | Ga0495610_0002219 | |||
| 624 | Ga0495610_0004850 | |||
| 625 | Ga0495616_0002791 | |||
| 626 | Ga0495643_0036723 | |||
| 627 | Ga0495654_0000003 | |||
| 628 | Ga0495633_0000001 | |||
| 629 | Ga0495633_0000058 | |||
| 630 | Ga0495633_0012073 | |||
| 631 | Ga0495668_0000451 | |||
| 632 | Ga0495625_0042068 | |||
| 633 | Ga0495686_0000256 | |||
| 634 | Ga0495686_0032254 | |||
| 635 | Ga0496104_0133017 | |||
| 636 | Ga0496107_0173957 | |||
| 637 | Ga0496112_0472056 | |||
| 638 | Ga0496116_0229226 | |||
| 639 | Ga0496121_0000343 | |||
| 640 | Ga0496125_0010171 | |||
| 641 | Ga0496126_0027853 | |||
| 642 | Ga0501291_001169 | |||
| 643 | Ga0501292_032328 | |||
| 644 | Ga0501296_009021 | |||
| 645 | Ga0501298_003380 | |||
| 646 | Ga0501299_001227 | |||
| 647 | Ga0501201_003882 | |||
| 648 | Ga0501202_010633 | |||
| 649 | Ga0501207_014283 | |||
| 650 | Ga0501216_001603 | |||
| 651 | Ga0501217_026638 | |||
| 652 | Ga0501235_035666 | |||
| 653 | Ga0501249_024544 | |||
| 654 | Ga0501234_005600 | |||
| 655 | Ga0501270_004552 | |||
| 656 | Ga0501280_009810 | |||
| 657 | nmdc:mga05p37_224513_c1 | |||
| 658 | nmdc:mga05p37_78968_c1 | |||
| 659 | nmdc:mga0qj67_255118_c1 | |||
| 660 | nmdc:mga06r32_138951_c1 | |||
| 661 | nmdc:mga06r32_244222_c1 | |||
| 662 | nmdc:mga08y16_12276_c1 | |||
| 663 | nmdc:mga08y16_265361_c1 | |||
| 664 | nmdc:mga08y16_55975_c1 | |||
| 665 | nmdc:mga0n895_156653_c1 | |||
| 666 | nmdc:mga0n895_369574_c1 | |||
| 667 | nmdc:mga0n895_874372_c1 | |||
| 668 | nmdc:mga08x19_66524_c1 | |||
| 669 | nmdc:mga0a205_366456_c1 | |||
| 670 | nmdc:mga0a205_57542_c1 | |||
| 671 | Ga0500644_0000420 | |||
| 672 | Ga0500646_0005078 | |||
| 673 | Ga0500651_0057253 | |||
| 674 | Ga0500651_0240954 | |||
| 675 | Ga0500641_0093334 | |||
| 676 | Ga0500556_0063362 | |||
| 677 | Ga0500569_000151 | |||
| 678 | Ga0500658_0001430 | |||
| 679 | Ga0500559_0015611 | |||
| 680 | Ga0500577_0000568 | |||
| 681 | Ga0500589_026931 | |||
| 682 | Ga0500590_034091 | |||
| 683 | Ga0500616_0002337 | |||
| 684 | Ga0500616_0007054 | |||
| 685 | Ga0500622_0000258 | |||
| 686 | Ga0500622_0031277 | |||
| 687 | Ga0500633_0015214 | |||
| 688 | Ga0500636_0009767 | |||
| 689 | Ga0500656_014586 | |||
| 690 | 2511232993 | |||
| 691 | 2585159587 | |||
| 692 | 2585163844 | |||
| 693 | 2586211133 | |||
| 694 | 2587944674 | |||
| 695 | 2738856422 | |||
| 696 | 2739589258 | |||
| 697 | 2739614284 | |||
| 698 | 2739647010 | |||
| 699 | 2819546830 | |||
| 700 | 2833641855 | |||
| 701 | 2842725534 | |||
| 702 | 2842914681 | |||
| 703 | 2849283240 | |||
| 704 | 2857631427 | |||
| 705 | 2881250052 | |||
| 706 | 2881955558 | |||
| 707 | 2904447001 | |||
| 708 | 2929244946 | |||
| 709 | 2946002557 | |||
| 710 | 2954019395 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4waj-assembly1.cif.gz_A-2 | h. influenzae beta-carbonic anhydase variant p48s/a49p | 0.971 | 33 | 213 |
| 3e2x-assembly1.cif.gz_B-2 | h. influenzae beta-carbonic anhydrase, variant v47a | 0.9694 | 35 | 213 |
| 3e24-assembly1.cif.gz_A | h. influenzae beta-carbonic anhydrase, variant w39f | 0.9693 | 35 | 213 |
| 5jj8-assembly1.cif.gz_A | crystal structure of the beta carbonic anhydrase psca3 isolated from pseudomonas aeruginosa - alternate crystal packing form | 0.9672 | 4 | 200 |
| 6d2j-assembly1.cif.gz_A | beta carbonic anhydrase in complex with thiocyanate | 0.967 | 4 | 200 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4wamA00 | Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase | 0.9663 | 35 | 213 | 3.40.1050.10 |
| 1ddzB02 | Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase | 0.9557 | 33 | 211 | 3.40.1050.10 |
| 2a8cA00 | Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase | 0.9464 | 1 | 213 | 3.40.1050.10 |
| 2a8cA00 | Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase | 0.9337 | 1 | 213 | 3.40.1050.10 |
| 4o1jB00 | Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase | 0.9292 | 3 | 196 | 3.40.1050.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-U1YV03-F1-model_v4 | deleted | 0.9856 | 4 | 199 |
|
| AF-A0A078BG03-F1-model_v4 | carbonic anhydrase (EC 4.2.1.1) | 0.9845 | 5 | 213 |
GO:0004089
GO:0008270 GO:0015976 |
| AF-A0A370XBA7-F1-model_v4 | Carbonic anhydrase (EC 4.2.1.1) (Carbonate dehydratase) | 0.9843 | 4 | 213 |
GO:0004089
GO:0008270 GO:0015976 |
| AF-A0A2A4R8G1-F1-model_v4 | Carbonic anhydrase (EC 4.2.1.1) (Carbonate dehydratase) | 0.9843 | 3 | 197 |
GO:0004089
GO:0008270 GO:0015976 |
| AF-A0A3S0PAZ1-F1-model_v4 | Carbonic anhydrase (EC 4.2.1.1) (Carbonate dehydratase) | 0.9839 | 4 | 211 |
GO:0004089
GO:0008270 GO:0015976 |