F420004
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 355 | 165 | 355 | 157 |
Family's Representative Sequence
| Representative Sequence | 3300005330|Ga0070690_100033408|Ga0070690_1000334082 |
| Length | 178 |
| Sequence | MQIDPFPAGCYAFRPFSNGFMRHTISVLVENKFGVLTRVAGLFSGRGYNIDTLNVGPTNDPDLSRMTIVTHGDEATLEQIVKQLNKLPDVIKVQDFRDGSEYVDRELVLVKVGVDSKSRAEVMQITDIFRAKIVDVQPKSLTVEITGTDSKVEKFLDLMETFGVKEITRTGKAALPRK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 22 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 23 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 24 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 25 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 27 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 28 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 29 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 30 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 31 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 32 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 33 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 34 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 73 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 74 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 75 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 76 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 77 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 78 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 79 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 80 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 81 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 82 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 83 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 84 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 85 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 86 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 87 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 88 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 89 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 90 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 91 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 92 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 93 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 94 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 95 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 96 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 97 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 98 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 99 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 100 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 101 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 102 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 103 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 104 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 105 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 106 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 107 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 108 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 109 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 110 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 111 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 112 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 113 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 114 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 115 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 116 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 117 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 118 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 119 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 120 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 121 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 122 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 123 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 124 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 148 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 149 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 150 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 151 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 152 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 153 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 154 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 155 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 157 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 158 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 159 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 160 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 161 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 162 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 163 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 164 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 165 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.28 |
| Nodule | 0 |
| Rhizoplane | 1.41 |
| Rhizosphere | 96.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.69 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNXas_1001031 | 3300000545 | Bacteria | 1834 |
| 2 | rootH2_10184661 | 3300003320 | Bacteria | 4326 |
| 3 | rootH1_10049112 | 3300003323 | Bacteria | 11034 |
| 4 | rootH1_10132720 | 3300003323 | Bacteria | 1160 |
| 5 | Ga0065704_10319064 | 3300005289 | Bacteria | 856 |
| 6 | Ga0070683_100986411 | 3300005329 | Bacteria | 809 |
| 7 | Ga0070690_100033408 | 3300005330 | Bacteria | 3220 |
| 8 | Ga0070670_101131890 | 3300005331 | Unclassified | 714 |
| 9 | Ga0070666_10503322 | 3300005335 | Unclassified | 878 |
| 10 | Ga0070680_100309622 | 3300005336 | Bacteria | 1340 |
| 11 | Ga0070680_100347342 | 3300005336 | Bacteria | 1261 |
| 12 | Ga0070689_100056714 | 3300005340 | Bacteria | 3038 |
| 13 | Ga0070689_100092449 | 3300005340 | Bacteria | 2386 |
| 14 | Ga0070689_100343328 | 3300005340 | Bacteria | 1251 |
| 15 | Ga0070689_100555326 | 3300005340 | Bacteria | 990 |
| 16 | Ga0070691_10007247 | 3300005341 | Bacteria | 5076 |
| 17 | Ga0070687_100387032 | 3300005343 | Bacteria | 913 |
| 18 | Ga0070669_100659426 | 3300005353 | Bacteria | 881 |
| 19 | Ga0070675_100324417 | 3300005354 | Bacteria | 1361 |
| 20 | Ga0070688_100369024 | 3300005365 | Bacteria | 1055 |
| 21 | Ga0070688_101562685 | 3300005365 | Bacteria | 538 |
| 22 | Ga0070714_100060390 | 3300005435 | Bacteria | 3253 |
| 23 | Ga0070711_100001752 | 3300005439 | Bacteria | 12061 |
| 24 | Ga0070681_10016382 | 3300005458 | Bacteria | 7399 |
| 25 | Ga0070681_10020688 | 3300005458 | Bacteria | 6592 |
| 26 | Ga0070681_10368967 | 3300005458 | Bacteria | 1346 |
| 27 | Ga0070685_10037454 | 3300005466 | Bacteria | 2747 |
| 28 | Ga0070679_100144666 | 3300005530 | Bacteria | 2356 |
| 29 | Ga0070679_100213414 | 3300005530 | Bacteria | 1893 |
| 30 | Ga0070679_100542401 | 3300005530 | Unclassified | 1107 |
| 31 | Ga0068853_100615510 | 3300005539 | Bacteria | 1032 |
| 32 | Ga0068855_100018404 | 3300005563 | Bacteria | 8394 |
| 33 | Ga0068855_100044368 | 3300005563 | Bacteria | 5261 |
| 34 | Ga0068855_100196063 | 3300005563 | Bacteria | 2275 |
| 35 | Ga0068855_100208393 | 3300005563 | Bacteria | 2198 |
| 36 | Ga0068855_101451046 | 3300005563 | Bacteria | 706 |
| 37 | Ga0068857_100038433 | 3300005577 | Bacteria | 4239 |
| 38 | Ga0068857_100048454 | 3300005577 | Bacteria | 3772 |
| 39 | Ga0068857_100977860 | 3300005577 | Bacteria | 814 |
| 40 | Ga0068857_101153849 | 3300005577 | Bacteria | 749 |
| 41 | Ga0068856_100000080 | 3300005614 | Bacteria | 90679 |
| 42 | Ga0068856_100042437 | 3300005614 | Bacteria | 4474 |
| 43 | Ga0068856_100060613 | 3300005614 | Bacteria | 3738 |
| 44 | Ga0070702_100420870 | 3300005615 | Bacteria | 961 |
| 45 | Ga0068859_100335588 | 3300005617 | Bacteria | 1606 |
| 46 | Ga0068859_100430880 | 3300005617 | Bacteria | 1415 |
| 47 | Ga0068859_100668446 | 3300005617 | Unclassified | 1130 |
| 48 | Ga0068859_101545137 | 3300005617 | Unclassified | 733 |
| 49 | Ga0068859_101982838 | 3300005617 | Bacteria | 643 |
| 50 | Ga0068864_100301857 | 3300005618 | Bacteria | 1499 |
| 51 | Ga0068861_101321600 | 3300005719 | Bacteria | 702 |
| 52 | Ga0068863_100226548 | 3300005841 | Bacteria | 1802 |
| 53 | Ga0068863_100729281 | 3300005841 | Bacteria | 986 |
| 54 | Ga0068871_100729326 | 3300006358 | Bacteria | 910 |
| 55 | Ga0075428_100001269 | 3300006844 | Bacteria | 26915 |
| 56 | Ga0075428_100184832 | 3300006844 | Bacteria | 2255 |
| 57 | Ga0075431_100671886 | 3300006847 | Bacteria | 1015 |
| 58 | Ga0075429_100043300 | 3300006880 | Bacteria | 3918 |
| 59 | Ga0097620_100335610 | 3300006931 | Bacteria | 1606 |
| 60 | Ga0097620_100430836 | 3300006931 | Bacteria | 1415 |
| 61 | Ga0097620_100668533 | 3300006931 | Unclassified | 1130 |
| 62 | Ga0097620_101545130 | 3300006931 | Unclassified | 733 |
| 63 | Ga0097620_101982580 | 3300006931 | Bacteria | 643 |
| 64 | Ga0105240_10020292 | 3300009093 | Bacteria | 8870 |
| 65 | Ga0105240_10043586 | 3300009093 | Bacteria | 5707 |
| 66 | Ga0105240_10095225 | 3300009093 | Bacteria | 3630 |
| 67 | Ga0105240_10702297 | 3300009093 | Bacteria | 1104 |
| 68 | Ga0111539_10004377 | 3300009094 | Bacteria | 18480 |
| 69 | Ga0111539_10168584 | 3300009094 | Bacteria | 2559 |
| 70 | Ga0105245_10644319 | 3300009098 | Bacteria | 1089 |
| 71 | Ga0105242_12622927 | 3300009176 | Bacteria | 553 |
| 72 | Ga0105248_11156969 | 3300009177 | Bacteria | 875 |
| 73 | Ga0105248_11591595 | 3300009177 | Bacteria | 740 |
| 74 | Ga0105248_11601955 | 3300009177 | Unclassified | 738 |
| 75 | Ga0105238_10037077 | 3300009551 | Bacteria | 4957 |
| 76 | Ga0105238_10044915 | 3300009551 | Bacteria | 4465 |
| 77 | Ga0105238_10957254 | 3300009551 | Bacteria | 876 |
| 78 | Ga0105238_11515806 | 3300009551 | Bacteria | 699 |
| 79 | Ga0105238_11615117 | 3300009551 | Bacteria | 678 |
| 80 | Ga0157370_10027492 | 3300013104 | Bacteria | 5609 |
| 81 | Ga0157370_10125229 | 3300013104 | Bacteria | 2399 |
| 82 | Ga0157370_10243007 | 3300013104 | Unclassified | 1665 |
| 83 | Ga0157374_11494653 | 3300013296 | Bacteria | 699 |
| 84 | Ga0157378_10883160 | 3300013297 | Bacteria | 924 |
| 85 | Ga0157378_12363098 | 3300013297 | Bacteria | 583 |
| 86 | Ga0163162_10388213 | 3300013306 | Bacteria | 1529 |
| 87 | Ga0157372_10100449 | 3300013307 | Bacteria | 3301 |
| 88 | Ga0157372_10457264 | 3300013307 | Bacteria | 1488 |
| 89 | Ga0157372_10582330 | 3300013307 | Bacteria | 1304 |
| 90 | Ga0157375_10384247 | 3300013308 | Bacteria | 1571 |
| 91 | Ga0157375_10778602 | 3300013308 | Bacteria | 1106 |
| 92 | Ga0163163_10000211 | 3300014325 | Bacteria | 60430 |
| 93 | Ga0157380_11244829 | 3300014326 | Unclassified | 789 |
| 94 | Ga0157379_10438565 | 3300014968 | Bacteria | 1204 |
| 95 | Ga0157376_11387179 | 3300014969 | Unclassified | 734 |
| 96 | Ga0207653_10329407 | 3300025885 | Bacteria | 595 |
| 97 | Ga0207705_10162688 | 3300025909 | Bacteria | 1677 |
| 98 | Ga0207705_10491828 | 3300025909 | Bacteria | 952 |
| 99 | Ga0207707_10113748 | 3300025912 | Bacteria | 2365 |
| 100 | Ga0207707_10511603 | 3300025912 | Bacteria | 1023 |
| 101 | Ga0207695_10082251 | 3300025913 | Unclassified | 3257 |
| 102 | Ga0207695_10235642 | 3300025913 | Bacteria | 1733 |
| 103 | Ga0207663_10137163 | 3300025916 | Bacteria | 1699 |
| 104 | Ga0207663_10353061 | 3300025916 | Bacteria | 1114 |
| 105 | Ga0207660_10079532 | 3300025917 | Bacteria | 2405 |
| 106 | Ga0207662_10270427 | 3300025918 | Bacteria | 1121 |
| 107 | Ga0207652_10105303 | 3300025921 | Bacteria | 2496 |
| 108 | Ga0207652_10127153 | 3300025921 | Bacteria | 2270 |
| 109 | Ga0207652_10661815 | 3300025921 | Bacteria | 933 |
| 110 | Ga0207694_10057318 | 3300025924 | Bacteria | 3028 |
| 111 | Ga0207694_10107620 | 3300025924 | Bacteria | 2215 |
| 112 | Ga0207694_10719700 | 3300025924 | Bacteria | 842 |
| 113 | Ga0207650_10731963 | 3300025925 | Unclassified | 836 |
| 114 | Ga0207664_10048918 | 3300025929 | Bacteria | 3327 |
| 115 | Ga0207670_10236652 | 3300025936 | Bacteria | 1405 |
| 116 | Ga0207670_10921800 | 3300025936 | Bacteria | 732 |
| 117 | Ga0207704_11416125 | 3300025938 | Bacteria | 596 |
| 118 | Ga0207711_11084251 | 3300025941 | Bacteria | 742 |
| 119 | Ga0207667_10003649 | 3300025949 | Bacteria | 18978 |
| 120 | Ga0207667_10028120 | 3300025949 | Bacteria | 6108 |
| 121 | Ga0207667_11096682 | 3300025949 | Bacteria | 779 |
| 122 | Ga0207651_10772530 | 3300025960 | Bacteria | 850 |
| 123 | Ga0207703_10241506 | 3300026035 | Bacteria | 1624 |
| 124 | Ga0207639_11438901 | 3300026041 | Bacteria | 647 |
| 125 | Ga0207702_10000588 | 3300026078 | Bacteria | 40254 |
| 126 | Ga0207702_10001107 | 3300026078 | Bacteria | 27560 |
| 127 | Ga0207702_10018780 | 3300026078 | Bacteria | 5718 |
| 128 | Ga0207702_10134112 | 3300026078 | Bacteria | 2232 |
| 129 | Ga0207674_10043795 | 3300026116 | Bacteria | 4613 |
| 130 | Ga0207674_10125796 | 3300026116 | Bacteria | 2529 |
| 131 | Ga0207674_10980197 | 3300026116 | Bacteria | 814 |
| 132 | Ga0207675_100483221 | 3300026118 | Bacteria | 1231 |
| 133 | Ga0207675_101221604 | 3300026118 | Bacteria | 772 |
| 134 | Ga0265337_1000847 | 3300028556 | Bacteria | 16046 |
| 135 | Ga0265337_1002727 | 3300028556 | Bacteria | 7927 |
| 136 | Ga0265337_1003374 | 3300028556 | Bacteria | 6940 |
| 137 | Ga0265337_1011484 | 3300028556 | Bacteria | 3050 |
| 138 | Ga0265337_1015373 | 3300028556 | Bacteria | 2506 |
| 139 | Ga0265337_1022724 | 3300028556 | Bacteria | 1938 |
| 140 | Ga0265337_1032530 | 3300028556 | Bacteria | 1542 |
| 141 | Ga0265337_1038716 | 3300028556 | Bacteria | 1381 |
| 142 | Ga0265337_1065510 | 3300028556 | Unclassified | 1002 |
| 143 | Ga0265326_10001485 | 3300028558 | Bacteria | 8238 |
| 144 | Ga0265326_10026862 | 3300028558 | Bacteria | 1641 |
| 145 | Ga0265326_10038719 | 3300028558 | Bacteria | 1355 |
| 146 | Ga0265326_10135316 | 3300028558 | Bacteria | 703 |
| 147 | Ga0265326_10163124 | 3300028558 | Bacteria | 637 |
| 148 | Ga0265319_1000004 | 3300028563 | Bacteria | 305085 |
| 149 | Ga0265319_1025854 | 3300028563 | Bacteria | 2097 |
| 150 | Ga0265319_1028279 | 3300028563 | Bacteria | 1978 |
| 151 | Ga0265319_1052692 | 3300028563 | Bacteria | 1338 |
| 152 | Ga0265319_1209101 | 3300028563 | Bacteria | 598 |
| 153 | Ga0265334_10013313 | 3300028573 | Bacteria | 3445 |
| 154 | Ga0265318_10158742 | 3300028577 | Bacteria | 829 |
| 155 | Ga0265323_10000140 | 3300028653 | Bacteria | 41860 |
| 156 | Ga0265323_10005091 | 3300028653 | Bacteria | 5612 |
| 157 | Ga0265323_10006619 | 3300028653 | Bacteria | 4862 |
| 158 | Ga0265323_10022280 | 3300028653 | Bacteria | 2421 |
| 159 | Ga0265323_10066604 | 3300028653 | Bacteria | 1240 |
| 160 | Ga0265323_10103216 | 3300028653 | Bacteria | 941 |
| 161 | Ga0265322_10019174 | 3300028654 | Unclassified | 1964 |
| 162 | Ga0265322_10040080 | 3300028654 | Bacteria | 1333 |
| 163 | Ga0265322_10047770 | 3300028654 | Bacteria | 1217 |
| 164 | Ga0265322_10128176 | 3300028654 | Bacteria | 724 |
| 165 | Ga0265336_10002944 | 3300028666 | Bacteria | 6822 |
| 166 | Ga0265336_10023018 | 3300028666 | Bacteria | 1979 |
| 167 | Ga0265336_10043347 | 3300028666 | Bacteria | 1372 |
| 168 | Ga0265336_10076123 | 3300028666 | Bacteria | 1002 |
| 169 | Ga0265338_10000070 | 3300028800 | Bacteria | 185904 |
| 170 | Ga0265338_10000084 | 3300028800 | Bacteria | 175415 |
| 171 | Ga0265338_10000111 | 3300028800 | Bacteria | 151469 |
| 172 | Ga0265338_10000208 | 3300028800 | Bacteria | 109817 |
| 173 | Ga0265338_10000616 | 3300028800 | Bacteria | 62218 |
| 174 | Ga0265338_10003109 | 3300028800 | Bacteria | 23752 |
| 175 | Ga0265338_10004875 | 3300028800 | Bacteria | 17874 |
| 176 | Ga0265338_10005089 | 3300028800 | Bacteria | 17354 |
| 177 | Ga0265338_10005565 | 3300028800 | Bacteria | 16388 |
| 178 | Ga0265338_10006543 | 3300028800 | Bacteria | 14807 |
| 179 | Ga0265338_10008700 | 3300028800 | Bacteria | 12273 |
| 180 | Ga0265338_10012868 | 3300028800 | Bacteria | 9507 |
| 181 | Ga0265338_10019398 | 3300028800 | Bacteria | 7216 |
| 182 | Ga0265338_10036180 | 3300028800 | Bacteria | 4731 |
| 183 | Ga0265338_10036220 | 3300028800 | Bacteria | 4727 |
| 184 | Ga0265338_10048800 | 3300028800 | Bacteria | 3847 |
| 185 | Ga0265338_10059400 | 3300028800 | Bacteria | 3369 |
| 186 | Ga0265338_10061161 | 3300028800 | Bacteria | 3302 |
| 187 | Ga0265338_10096202 | 3300028800 | Bacteria | 2430 |
| 188 | Ga0265338_10109326 | 3300028800 | Bacteria | 2231 |
| 189 | Ga0265338_10147576 | 3300028800 | Bacteria | 1832 |
| 190 | Ga0265338_10154163 | 3300028800 | Bacteria | 1781 |
| 191 | Ga0265338_10177956 | 3300028800 | Bacteria | 1624 |
| 192 | Ga0265338_10261876 | 3300028800 | Bacteria | 1271 |
| 193 | Ga0265338_10365682 | 3300028800 | Bacteria | 1034 |
| 194 | Ga0265338_10404635 | 3300028800 | Bacteria | 972 |
| 195 | Ga0265338_10454609 | 3300028800 | Bacteria | 906 |
| 196 | Ga0265338_10467445 | 3300028800 | Bacteria | 891 |
| 197 | Ga0265338_10682144 | 3300028800 | Bacteria | 710 |
| 198 | Ga0265324_10000939 | 3300029957 | Bacteria | 18262 |
| 199 | Ga0265324_10007656 | 3300029957 | Bacteria | 4350 |
| 200 | Ga0265324_10011487 | 3300029957 | Bacteria | 3372 |
| 201 | Ga0265324_10025597 | 3300029957 | Bacteria | 2091 |
| 202 | Ga0265324_10063545 | 3300029957 | Bacteria | 1260 |
| 203 | Ga0265324_10064916 | 3300029957 | Bacteria | 1245 |
| 204 | Ga0265324_10067579 | 3300029957 | Bacteria | 1219 |
| 205 | Ga0265324_10162235 | 3300029957 | Bacteria | 759 |
| 206 | Ga0265324_10297489 | 3300029957 | Bacteria | 549 |
| 207 | Ga0265332_10039819 | 3300031238 | Bacteria | 2036 |
| 208 | Ga0265328_10049568 | 3300031239 | Bacteria | 1542 |
| 209 | Ga0265320_10000551 | 3300031240 | Bacteria | 28889 |
| 210 | Ga0265320_10001912 | 3300031240 | Bacteria | 14716 |
| 211 | Ga0265320_10003522 | 3300031240 | Bacteria | 10485 |
| 212 | Ga0265320_10018862 | 3300031240 | Bacteria | 3787 |
| 213 | Ga0265320_10020573 | 3300031240 | Bacteria | 3572 |
| 214 | Ga0265320_10039515 | 3300031240 | Bacteria | 2359 |
| 215 | Ga0265320_10085177 | 3300031240 | Bacteria | 1471 |
| 216 | Ga0265320_10147530 | 3300031240 | Bacteria | 1063 |
| 217 | Ga0265325_10031549 | 3300031241 | Bacteria | 2834 |
| 218 | Ga0265325_10040745 | 3300031241 | Bacteria | 2438 |
| 219 | Ga0265340_10001551 | 3300031247 | Bacteria | 13183 |
| 220 | Ga0265340_10054582 | 3300031247 | Bacteria | 1926 |
| 221 | Ga0265340_10222240 | 3300031247 | Bacteria | 846 |
| 222 | Ga0265339_10031067 | 3300031249 | Bacteria | 3020 |
| 223 | Ga0265339_10069664 | 3300031249 | Unclassified | 1877 |
| 224 | Ga0265339_10306343 | 3300031249 | Bacteria | 756 |
| 225 | Ga0265339_10556160 | 3300031249 | Bacteria | 527 |
| 226 | Ga0265331_10245194 | 3300031250 | Bacteria | 804 |
| 227 | Ga0265327_10000634 | 3300031251 | Bacteria | 57259 |
| 228 | Ga0265327_10159536 | 3300031251 | Bacteria | 1043 |
| 229 | Ga0265316_10009212 | 3300031344 | Bacteria | 9093 |
| 230 | Ga0265316_10029540 | 3300031344 | Bacteria | 4505 |
| 231 | Ga0265316_10055762 | 3300031344 | Bacteria | 3089 |
| 232 | Ga0265316_10142776 | 3300031344 | Bacteria | 1797 |
| 233 | Ga0265316_10292336 | 3300031344 | Bacteria | 1188 |
| 234 | Ga0265316_10325316 | 3300031344 | Bacteria | 1116 |
| 235 | Ga0265316_10408351 | 3300031344 | Bacteria | 977 |
| 236 | Ga0265316_10835845 | 3300031344 | Bacteria | 645 |
| 237 | Ga0307509_10379381 | 3300031507 | Bacteria | 1127 |
| 238 | Ga0265313_10000385 | 3300031595 | Bacteria | 47503 |
| 239 | Ga0265313_10015182 | 3300031595 | Bacteria | 4503 |
| 240 | Ga0265314_10056361 | 3300031711 | Bacteria | 2706 |
| 241 | Ga0265314_10269171 | 3300031711 | Bacteria | 969 |
| 242 | Ga0265314_10463879 | 3300031711 | Bacteria | 672 |
| 243 | Ga0265342_10083542 | 3300031712 | Bacteria | 1840 |
| 244 | Ga0265342_10089478 | 3300031712 | Bacteria | 1767 |
| 245 | Ga0265342_10100767 | 3300031712 | Bacteria | 1645 |
| 246 | Ga0265342_10124876 | 3300031712 | Bacteria | 1446 |
| 247 | Ga0265342_10517255 | 3300031712 | Unclassified | 608 |
| 248 | Ga0373930_0003785 | 3300034816 | Bacteria | 2425 |
| 249 | Ga0373928_0000004 | 3300035084 | Bacteria | 45792 |
| 250 | Ga0373944_0008707 | 3300035089 | Bacteria | 2742 |
| 251 | Ga0373949_0002066 | 3300035090 | Bacteria | 5309 |
| 252 | Ga0373932_0000001 | 3300035112 | Bacteria | 1459067 |
| 253 | Ga0373932_0020508 | 3300035112 | Bacteria | 1734 |
| 254 | Ga0373953_0271413 | 3300035117 | Bacteria | 739 |
| 255 | Ga0373954_0051710 | 3300035118 | Bacteria | 1930 |
| 256 | Ga0373956_0017790 | 3300035119 | Bacteria | 3002 |
| 257 | Ga0373943_0155952 | 3300035170 | Bacteria | 1240 |
| 258 | Ga0373955_0235031 | 3300035172 | Bacteria | 1097 |
| 259 | Ga0373961_0038405 | 3300035241 | Bacteria | 1372 |
| 260 | Ga0373962_0000254 | 3300035242 | Bacteria | 11361 |
| 261 | Ga0316574_0344725 | 3300035398 | Unclassified | 943 |
| 262 | Ga0373931_0000002 | 3300035691 | Bacteria | 599830 |
| 263 | Ga0373931_0274178 | 3300035691 | Unclassified | 1034 |
| 264 | Ga0373935_0100128 | 3300035692 | Bacteria | 1909 |
| 265 | Ga0373935_0635649 | 3300035692 | Bacteria | 782 |
| 266 | Ga0373927_0002484 | 3300035695 | Bacteria | 13459 |
| 267 | Ga0373927_0003007 | 3300035695 | Bacteria | 12237 |
| 268 | Ga0373927_0339810 | 3300035695 | Bacteria | 989 |
| 269 | Ga0373933_0494273 | 3300035724 | Bacteria | 801 |
| 270 | Ga0373947_0217826 | 3300035725 | Bacteria | 1254 |
| 271 | Ga0373937_0026632 | 3300036401 | Bacteria | 5224 |
| 272 | Ga0373937_0718444 | 3300036401 | Bacteria | 946 |
| 273 | Ga0316582_0235729 | 3300036647 | Unclassified | 1253 |
| 274 | Ga0373925_0000077 | 3300037068 | Bacteria | 105383 |
| 275 | Ga0451793_0684306 | 3300041452 | Bacteria | 674 |
| 276 | Ga0451798_0314004 | 3300041458 | Bacteria | 1095 |
| 277 | Ga0451798_1068640 | 3300041458 | Unclassified | 503 |
| 278 | Ga0451807_0297416 | 3300041486 | Bacteria | 792 |
| 279 | Ga0451835_0993691 | 3300041492 | Bacteria | 1058 |
| 280 | Ga0451849_1288056 | 3300041505 | Unclassified | 631 |
| 281 | Ga0451577_0052529 | 3300042876 | Bacteria | 3639 |
| 282 | Ga0451577_0475959 | 3300042876 | Unclassified | 1134 |
| 283 | Ga0451577_1007791 | 3300042876 | Bacteria | 748 |
| 284 | Ga0453684_0002150 | 3300044712 | Bacteria | 49388 |
| 285 | Ga0453684_0114653 | 3300044712 | Bacteria | 3267 |
| 286 | Ga0453684_0132002 | 3300044712 | Bacteria | 2996 |
| 287 | Ga0453684_0512749 | 3300044712 | Unclassified | 1326 |
| 288 | Ga0451576_0213110 | 3300045051 | Bacteria | 2017 |
| 289 | Ga0451576_0233651 | 3300045051 | Unclassified | 1920 |
| 290 | Ga0451576_0727909 | 3300045051 | Archaea | 1042 |
| 291 | Ga0451576_1033399 | 3300045051 | Bacteria | 861 |
| 292 | Ga0495592_0135301 | 3300046454 | Bacteria | 1720 |
| 293 | Ga0495651_0327938 | 3300046462 | Bacteria | 1018 |
| 294 | Ga0495662_0415565 | 3300046476 | Bacteria | 660 |
| 295 | Ga0495664_0261853 | 3300046477 | Bacteria | 1045 |
| 296 | Ga0495618_0000968 | 3300046514 | Bacteria | 19743 |
| 297 | Ga0495618_0305405 | 3300046514 | Bacteria | 988 |
| 298 | Ga0495618_0338728 | 3300046514 | Bacteria | 929 |
| 299 | Ga0495628_0302857 | 3300046516 | Bacteria | 1183 |
| 300 | Ga0495630_0193088 | 3300046517 | Bacteria | 1553 |
| 301 | Ga0495640_0080516 | 3300046533 | Bacteria | 2166 |
| 302 | Ga0495640_0294565 | 3300046533 | Bacteria | 1009 |
| 303 | Ga0495586_0018839 | 3300046535 | Bacteria | 3674 |
| 304 | Ga0495586_0027307 | 3300046535 | Bacteria | 3054 |
| 305 | Ga0495586_0213574 | 3300046535 | Bacteria | 1095 |
| 306 | Ga0495587_0367631 | 3300046536 | Bacteria | 800 |
| 307 | Ga0495645_0248638 | 3300046543 | Bacteria | 1183 |
| 308 | Ga0495645_0508699 | 3300046543 | Bacteria | 752 |
| 309 | Ga0495645_0598594 | 3300046543 | Bacteria | 678 |
| 310 | Ga0495622_0294891 | 3300046557 | Unclassified | 707 |
| 311 | Ga0495667_0029599 | 3300046559 | Bacteria | 3686 |
| 312 | Ga0495667_0066109 | 3300046559 | Bacteria | 2364 |
| 313 | Ga0495634_0002583 | 3300046642 | Bacteria | 14935 |
| 314 | Ga0495634_0309781 | 3300046642 | Bacteria | 953 |
| 315 | Ga0495657_0109553 | 3300046675 | Bacteria | 1751 |
| 316 | Ga0495599_0569555 | 3300046678 | Bacteria | 662 |
| 317 | Ga0495613_0002225 | 3300046689 | Bacteria | 14688 |
| 318 | Ga0495613_0665326 | 3300046689 | Bacteria | 688 |
| 319 | Ga0495600_0814238 | 3300046809 | Bacteria | 556 |
| 320 | Ga0495636_0226204 | 3300047318 | Bacteria | 860 |
| 321 | Ga0495674_0467876 | 3300047319 | Bacteria | 1011 |
| 322 | Ga0495674_1043634 | 3300047319 | Bacteria | 624 |
| 323 | Ga0495676_0571632 | 3300047321 | Bacteria | 738 |
| 324 | Ga0495680_0003659 | 3300047322 | Bacteria | 15005 |
| 325 | Ga0495684_0285728 | 3300047471 | Bacteria | 1189 |
| 326 | Ga0495684_0503385 | 3300047471 | Bacteria | 832 |
| 327 | Ga0496115_0792631 | 3300048918 | Bacteria | 738 |
| 328 | Ga0501031_0000569 | 3300049568 | Bacteria | 21596 |
| 329 | Ga0501032_0004203 | 3300049569 | Bacteria | 10904 |
| 330 | Ga0501032_0112691 | 3300049569 | Bacteria | 1799 |
| 331 | Ga0501033_0044587 | 3300049570 | Bacteria | 3301 |
| 332 | Ga0501033_0168978 | 3300049570 | Bacteria | 1571 |
| 333 | Ga0501034_0501252 | 3300049571 | Bacteria | 1128 |
| 334 | Ga0501036_0294463 | 3300049572 | Bacteria | 1358 |
| 335 | Ga0501037_0256288 | 3300049573 | Bacteria | 1223 |
| 336 | Ga0501043_0211977 | 3300049579 | Bacteria | 1501 |
| 337 | Ga0501043_0394553 | 3300049579 | Bacteria | 1046 |
| 338 | Ga0501047_0086778 | 3300049581 | Bacteria | 3007 |
| 339 | Ga0501047_0104549 | 3300049581 | Bacteria | 2712 |
| 340 | Ga0501047_0470614 | 3300049581 | Bacteria | 1085 |
| 341 | Ga0501048_1216578 | 3300049582 | Unclassified | 542 |
| 342 | Ga0501080_0126281 | 3300049742 | Bacteria | 2369 |
| 343 | Ga0501083_0002953 | 3300049744 | Bacteria | 11786 |
| 344 | Ga0501035_0010225 | 3300049822 | Bacteria | 8706 |
| 345 | Ga0501035_0151151 | 3300049822 | Bacteria | 2015 |
| 346 | Ga0501044_0000823 | 3300049823 | Bacteria | 37371 |
| 347 | Ga0501044_0038246 | 3300049823 | Bacteria | 5011 |
| 348 | Ga0501044_0977229 | 3300049823 | Bacteria | 719 |
| 349 | Ga0501044_1204038 | 3300049823 | Unclassified | 625 |
| 350 | nmdc:mga05p37_666181_c1 | 3300050507 | Bacteria | 1162 |
| 351 | nmdc:mga09592_176115_c1 | 3300050508 | Bacteria | 1850 |
| 352 | nmdc:mga08y16_23816_c1 | 3300050511 | Bacteria | 6465 |
| 353 | nmdc:mga08y16_518406_c1 | 3300050511 | Bacteria | 1209 |
| 354 | nmdc:mga0n895_943892_c1 | 3300050512 | Bacteria | 846 |
| 355 | Ga0500651_0410038 | 3300053093 | Unclassified | 760 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041492 | Ga0451835_0993691 | Ga0451835_0993691_205_654 | 149 |
| 2 | 3300045051 | Ga0451576_0213110 | Ga0451576_0213110_1176_1625 | 149 |
| 3 | 3300049571 | Ga0501034_0501252 | Ga0501034_0501252_259_708 | 149 |
| 4 | 3300049579 | Ga0501043_0211977 | Ga0501043_0211977_306_755 | 149 |
| 5 | 3300049581 | Ga0501047_0104549 | Ga0501047_0104549_472_921 | 149 |
| 6 | 3300035241 | Ga0373961_0038405 | Ga0373961_0038405_868_1323 | 150 |
| 7 | 3300035695 | Ga0373927_0003007 | Ga0373927_0003007_3776_4228 | 150 |
| 8 | 3300046514 | Ga0495618_0305405 | Ga0495618_0305405_34_486 | 150 |
| 9 | 3300046557 | Ga0495622_0294891 | Ga0495622_0294891_198_650 | 150 |
| 10 | 3300046642 | Ga0495634_0309781 | Ga0495634_0309781_466_918 | 150 |
| 11 | 3300047471 | Ga0495684_0285728 | Ga0495684_0285728_268_720 | 150 |
| 12 | 3300013104 | Ga0157370_10027492 | Ga0157370_100274922 | 151 |
| 13 | 3300003323 | rootH1_10132720 | rootH1_101327201 | 156 |
| 14 | 3300005530 | Ga0070679_100213414 | Ga0070679_1002134142 | 156 |
| 15 | 3300005577 | Ga0068857_100038433 | Ga0068857_1000384334 | 156 |
| 16 | 3300005614 | Ga0068856_100060613 | Ga0068856_1000606136 | 156 |
| 17 | 3300005719 | Ga0068861_101321600 | Ga0068861_1013216002 | 156 |
| 18 | 3300025921 | Ga0207652_10105303 | Ga0207652_101053032 | 156 |
| 19 | 3300026078 | Ga0207702_10000588 | Ga0207702_100005889 | 156 |
| 20 | 3300026116 | Ga0207674_10043795 | Ga0207674_100437954 | 156 |
| 21 | 3300026118 | Ga0207675_101221604 | Ga0207675_1012216042 | 156 |
| 22 | 3300028653 | Ga0265323_10066604 | Ga0265323_100666042 | 156 |
| 23 | 3300028653 | Ga0265323_10103216 | Ga0265323_101032161 | 156 |
| 24 | 3300028800 | Ga0265338_10012868 | Ga0265338_100128686 | 156 |
| 25 | 3300031240 | Ga0265320_10018862 | Ga0265320_100188623 | 156 |
| 26 | 3300031241 | Ga0265325_10040745 | Ga0265325_100407452 | 156 |
| 27 | 3300031344 | Ga0265316_10292336 | Ga0265316_102923362 | 156 |
| 28 | 3300031712 | Ga0265342_10100767 | Ga0265342_101007671 | 156 |
| 29 | 3300035112 | Ga0373932_0020508 | Ga0373932_0020508_61_531 | 156 |
| 30 | 3300000545 | CNXas_1001031 | CNXas_10010312 | 157 |
| 31 | 3300003320 | rootH2_10184661 | rootH2_101846615 | 157 |
| 32 | 3300003323 | rootH1_10049112 | rootH1_100491126 | 157 |
| 33 | 3300005289 | Ga0065704_10319064 | Ga0065704_103190641 | 157 |
| 34 | 3300005329 | Ga0070683_100986411 | Ga0070683_1009864111 | 157 |
| 35 | 3300005330 | Ga0070690_100033408 | Ga0070690_1000334082 | 157 |
| 36 | 3300005331 | Ga0070670_101131890 | Ga0070670_1011318901 | 157 |
| 37 | 3300005335 | Ga0070666_10503322 | Ga0070666_105033222 | 157 |
| 38 | 3300005336 | Ga0070680_100309622 | Ga0070680_1003096222 | 157 |
| 39 | 3300005336 | Ga0070680_100347342 | Ga0070680_1003473422 | 157 |
| 40 | 3300005340 | Ga0070689_100056714 | Ga0070689_1000567142 | 157 |
| 41 | 3300005340 | Ga0070689_100092449 | Ga0070689_1000924492 | 157 |
| 42 | 3300005340 | Ga0070689_100343328 | Ga0070689_1003433282 | 157 |
| 43 | 3300005340 | Ga0070689_100555326 | Ga0070689_1005553262 | 157 |
| 44 | 3300005341 | Ga0070691_10007247 | Ga0070691_100072474 | 157 |
| 45 | 3300005343 | Ga0070687_100387032 | Ga0070687_1003870321 | 157 |
| 46 | 3300005353 | Ga0070669_100659426 | Ga0070669_1006594261 | 157 |
| 47 | 3300005354 | Ga0070675_100324417 | Ga0070675_1003244171 | 157 |
| 48 | 3300005365 | Ga0070688_100369024 | Ga0070688_1003690241 | 157 |
| 49 | 3300005365 | Ga0070688_101562685 | Ga0070688_1015626851 | 157 |
| 50 | 3300005435 | Ga0070714_100060390 | Ga0070714_1000603902 | 157 |
| 51 | 3300005439 | Ga0070711_100001752 | Ga0070711_1000017522 | 157 |
| 52 | 3300005458 | Ga0070681_10016382 | Ga0070681_100163822 | 157 |
| 53 | 3300005458 | Ga0070681_10020688 | Ga0070681_100206884 | 157 |
| 54 | 3300005458 | Ga0070681_10368967 | Ga0070681_103689672 | 157 |
| 55 | 3300005466 | Ga0070685_10037454 | Ga0070685_100374542 | 157 |
| 56 | 3300005530 | Ga0070679_100144666 | Ga0070679_1001446662 | 157 |
| 57 | 3300005530 | Ga0070679_100542401 | Ga0070679_1005424012 | 157 |
| 58 | 3300005539 | Ga0068853_100615510 | Ga0068853_1006155102 | 157 |
| 59 | 3300005563 | Ga0068855_100018404 | Ga0068855_1000184047 | 157 |
| 60 | 3300005563 | Ga0068855_100044368 | Ga0068855_1000443685 | 157 |
| 61 | 3300005563 | Ga0068855_100196063 | Ga0068855_1001960631 | 157 |
| 62 | 3300005563 | Ga0068855_100208393 | Ga0068855_1002083932 | 157 |
| 63 | 3300005563 | Ga0068855_101451046 | Ga0068855_1014510462 | 157 |
| 64 | 3300005577 | Ga0068857_100048454 | Ga0068857_1000484544 | 157 |
| 65 | 3300005577 | Ga0068857_100977860 | Ga0068857_1009778602 | 157 |
| 66 | 3300005577 | Ga0068857_101153849 | Ga0068857_1011538492 | 157 |
| 67 | 3300005614 | Ga0068856_100000080 | Ga0068856_10000008036 | 157 |
| 68 | 3300005614 | Ga0068856_100042437 | Ga0068856_1000424374 | 157 |
| 69 | 3300005615 | Ga0070702_100420870 | Ga0070702_1004208701 | 157 |
| 70 | 3300005617 | Ga0068859_100335588 | Ga0068859_1003355882 | 157 |
| 71 | 3300005617 | Ga0068859_100430880 | Ga0068859_1004308802 | 157 |
| 72 | 3300005617 | Ga0068859_100668446 | Ga0068859_1006684462 | 157 |
| 73 | 3300005617 | Ga0068859_101545137 | Ga0068859_1015451371 | 157 |
| 74 | 3300005617 | Ga0068859_101982838 | Ga0068859_1019828381 | 157 |
| 75 | 3300005618 | Ga0068864_100301857 | Ga0068864_1003018573 | 157 |
| 76 | 3300005841 | Ga0068863_100226548 | Ga0068863_1002265482 | 157 |
| 77 | 3300005841 | Ga0068863_100729281 | Ga0068863_1007292812 | 157 |
| 78 | 3300006358 | Ga0068871_100729326 | Ga0068871_1007293261 | 157 |
| 79 | 3300006844 | Ga0075428_100001269 | Ga0075428_1000012698 | 157 |
| 80 | 3300006844 | Ga0075428_100184832 | Ga0075428_1001848322 | 157 |
| 81 | 3300006847 | Ga0075431_100671886 | Ga0075431_1006718862 | 157 |
| 82 | 3300006880 | Ga0075429_100043300 | Ga0075429_1000433004 | 157 |
| 83 | 3300006931 | Ga0097620_100335610 | Ga0097620_1003356102 | 157 |
| 84 | 3300006931 | Ga0097620_100430836 | Ga0097620_1004308362 | 157 |
| 85 | 3300006931 | Ga0097620_100668533 | Ga0097620_1006685332 | 157 |
| 86 | 3300006931 | Ga0097620_101545130 | Ga0097620_1015451301 | 157 |
| 87 | 3300006931 | Ga0097620_101982580 | Ga0097620_1019825801 | 157 |
| 88 | 3300009093 | Ga0105240_10020292 | Ga0105240_100202925 | 157 |
| 89 | 3300009093 | Ga0105240_10043586 | Ga0105240_100435862 | 157 |
| 90 | 3300009093 | Ga0105240_10095225 | Ga0105240_100952254 | 157 |
| 91 | 3300009093 | Ga0105240_10702297 | Ga0105240_107022971 | 157 |
| 92 | 3300009094 | Ga0111539_10004377 | Ga0111539_100043773 | 157 |
| 93 | 3300009094 | Ga0111539_10168584 | Ga0111539_101685841 | 157 |
| 94 | 3300009098 | Ga0105245_10644319 | Ga0105245_106443191 | 157 |
| 95 | 3300009176 | Ga0105242_12622927 | Ga0105242_126229271 | 157 |
| 96 | 3300009177 | Ga0105248_11156969 | Ga0105248_111569692 | 157 |
| 97 | 3300009177 | Ga0105248_11591595 | Ga0105248_115915952 | 157 |
| 98 | 3300009177 | Ga0105248_11601955 | Ga0105248_116019551 | 157 |
| 99 | 3300009551 | Ga0105238_10037077 | Ga0105238_100370772 | 157 |
| 100 | 3300009551 | Ga0105238_10044915 | Ga0105238_100449152 | 157 |
| 101 | 3300009551 | Ga0105238_10957254 | Ga0105238_109572541 | 157 |
| 102 | 3300009551 | Ga0105238_11515806 | Ga0105238_115158061 | 157 |
| 103 | 3300009551 | Ga0105238_11615117 | Ga0105238_116151171 | 157 |
| 104 | 3300013104 | Ga0157370_10125229 | Ga0157370_101252292 | 157 |
| 105 | 3300013104 | Ga0157370_10243007 | Ga0157370_102430071 | 157 |
| 106 | 3300013296 | Ga0157374_11494653 | Ga0157374_114946532 | 157 |
| 107 | 3300013297 | Ga0157378_10883160 | Ga0157378_108831602 | 157 |
| 108 | 3300013297 | Ga0157378_12363098 | Ga0157378_123630981 | 157 |
| 109 | 3300013306 | Ga0163162_10388213 | Ga0163162_103882132 | 157 |
| 110 | 3300013307 | Ga0157372_10100449 | Ga0157372_101004494 | 157 |
| 111 | 3300013307 | Ga0157372_10457264 | Ga0157372_104572642 | 157 |
| 112 | 3300013307 | Ga0157372_10582330 | Ga0157372_105823302 | 157 |
| 113 | 3300013308 | Ga0157375_10384247 | Ga0157375_103842472 | 157 |
| 114 | 3300013308 | Ga0157375_10778602 | Ga0157375_107786022 | 157 |
| 115 | 3300014325 | Ga0163163_10000211 | Ga0163163_1000021111 | 157 |
| 116 | 3300014326 | Ga0157380_11244829 | Ga0157380_112448291 | 157 |
| 117 | 3300014968 | Ga0157379_10438565 | Ga0157379_104385652 | 157 |
| 118 | 3300014969 | Ga0157376_11387179 | Ga0157376_113871791 | 157 |
| 119 | 3300025885 | Ga0207653_10329407 | Ga0207653_103294071 | 157 |
| 120 | 3300025909 | Ga0207705_10162688 | Ga0207705_101626882 | 157 |
| 121 | 3300025909 | Ga0207705_10491828 | Ga0207705_104918282 | 157 |
| 122 | 3300025912 | Ga0207707_10113748 | Ga0207707_101137482 | 157 |
| 123 | 3300025912 | Ga0207707_10511603 | Ga0207707_105116032 | 157 |
| 124 | 3300025913 | Ga0207695_10082251 | Ga0207695_100822514 | 157 |
| 125 | 3300025913 | Ga0207695_10235642 | Ga0207695_102356421 | 157 |
| 126 | 3300025916 | Ga0207663_10137163 | Ga0207663_101371632 | 157 |
| 127 | 3300025916 | Ga0207663_10353061 | Ga0207663_103530612 | 157 |
| 128 | 3300025917 | Ga0207660_10079532 | Ga0207660_100795322 | 157 |
| 129 | 3300025918 | Ga0207662_10270427 | Ga0207662_102704272 | 157 |
| 130 | 3300025921 | Ga0207652_10127153 | Ga0207652_101271532 | 157 |
| 131 | 3300025921 | Ga0207652_10661815 | Ga0207652_106618152 | 157 |
| 132 | 3300025924 | Ga0207694_10057318 | Ga0207694_100573183 | 157 |
| 133 | 3300025924 | Ga0207694_10107620 | Ga0207694_101076202 | 157 |
| 134 | 3300025924 | Ga0207694_10719700 | Ga0207694_107197001 | 157 |
| 135 | 3300025925 | Ga0207650_10731963 | Ga0207650_107319632 | 157 |
| 136 | 3300025929 | Ga0207664_10048918 | Ga0207664_100489182 | 157 |
| 137 | 3300025936 | Ga0207670_10236652 | Ga0207670_102366521 | 157 |
| 138 | 3300025936 | Ga0207670_10921800 | Ga0207670_109218001 | 157 |
| 139 | 3300025938 | Ga0207704_11416125 | Ga0207704_114161251 | 157 |
| 140 | 3300025941 | Ga0207711_11084251 | Ga0207711_110842511 | 157 |
| 141 | 3300025949 | Ga0207667_10003649 | Ga0207667_100036499 | 157 |
| 142 | 3300025949 | Ga0207667_10028120 | Ga0207667_100281203 | 157 |
| 143 | 3300025949 | Ga0207667_11096682 | Ga0207667_110966821 | 157 |
| 144 | 3300025960 | Ga0207651_10772530 | Ga0207651_107725302 | 157 |
| 145 | 3300026035 | Ga0207703_10241506 | Ga0207703_102415062 | 157 |
| 146 | 3300026041 | Ga0207639_11438901 | Ga0207639_114389011 | 157 |
| 147 | 3300026078 | Ga0207702_10001107 | Ga0207702_100011079 | 157 |
| 148 | 3300026078 | Ga0207702_10018780 | Ga0207702_100187805 | 157 |
| 149 | 3300026078 | Ga0207702_10134112 | Ga0207702_101341122 | 157 |
| 150 | 3300026116 | Ga0207674_10125796 | Ga0207674_101257962 | 157 |
| 151 | 3300026116 | Ga0207674_10980197 | Ga0207674_109801972 | 157 |
| 152 | 3300026118 | Ga0207675_100483221 | Ga0207675_1004832213 | 157 |
| 153 | 3300028556 | Ga0265337_1000847 | Ga0265337_10008472 | 157 |
| 154 | 3300028556 | Ga0265337_1002727 | Ga0265337_10027275 | 157 |
| 155 | 3300028556 | Ga0265337_1003374 | Ga0265337_10033742 | 157 |
| 156 | 3300028556 | Ga0265337_1011484 | Ga0265337_10114844 | 157 |
| 157 | 3300028556 | Ga0265337_1015373 | Ga0265337_10153735 | 157 |
| 158 | 3300028556 | Ga0265337_1022724 | Ga0265337_10227243 | 157 |
| 159 | 3300028556 | Ga0265337_1032530 | Ga0265337_10325302 | 157 |
| 160 | 3300028556 | Ga0265337_1038716 | Ga0265337_10387162 | 157 |
| 161 | 3300028556 | Ga0265337_1065510 | Ga0265337_10655101 | 157 |
| 162 | 3300028558 | Ga0265326_10001485 | Ga0265326_100014858 | 157 |
| 163 | 3300028558 | Ga0265326_10026862 | Ga0265326_100268622 | 157 |
| 164 | 3300028558 | Ga0265326_10038719 | Ga0265326_100387192 | 157 |
| 165 | 3300028558 | Ga0265326_10135316 | Ga0265326_101353161 | 157 |
| 166 | 3300028558 | Ga0265326_10163124 | Ga0265326_101631241 | 157 |
| 167 | 3300028563 | Ga0265319_1000004 | Ga0265319_1000004277 | 157 |
| 168 | 3300028563 | Ga0265319_1025854 | Ga0265319_10258541 | 157 |
| 169 | 3300028563 | Ga0265319_1028279 | Ga0265319_10282792 | 157 |
| 170 | 3300028563 | Ga0265319_1052692 | Ga0265319_10526922 | 157 |
| 171 | 3300028563 | Ga0265319_1209101 | Ga0265319_12091011 | 157 |
| 172 | 3300028573 | Ga0265334_10013313 | Ga0265334_100133132 | 157 |
| 173 | 3300028577 | Ga0265318_10158742 | Ga0265318_101587422 | 157 |
| 174 | 3300028653 | Ga0265323_10000140 | Ga0265323_1000014031 | 157 |
| 175 | 3300028653 | Ga0265323_10005091 | Ga0265323_100050917 | 157 |
| 176 | 3300028653 | Ga0265323_10006619 | Ga0265323_100066192 | 157 |
| 177 | 3300028653 | Ga0265323_10022280 | Ga0265323_100222802 | 157 |
| 178 | 3300028654 | Ga0265322_10019174 | Ga0265322_100191743 | 157 |
| 179 | 3300028654 | Ga0265322_10040080 | Ga0265322_100400802 | 157 |
| 180 | 3300028654 | Ga0265322_10047770 | Ga0265322_100477701 | 157 |
| 181 | 3300028654 | Ga0265322_10128176 | Ga0265322_101281761 | 157 |
| 182 | 3300028666 | Ga0265336_10002944 | Ga0265336_100029443 | 157 |
| 183 | 3300028666 | Ga0265336_10023018 | Ga0265336_100230181 | 157 |
| 184 | 3300028666 | Ga0265336_10043347 | Ga0265336_100433472 | 157 |
| 185 | 3300028666 | Ga0265336_10076123 | Ga0265336_100761232 | 157 |
| 186 | 3300028800 | Ga0265338_10000070 | Ga0265338_10000070135 | 157 |
| 187 | 3300028800 | Ga0265338_10000084 | Ga0265338_1000008416 | 157 |
| 188 | 3300028800 | Ga0265338_10000111 | Ga0265338_1000011150 | 157 |
| 189 | 3300028800 | Ga0265338_10000208 | Ga0265338_10000208115 | 157 |
| 190 | 3300028800 | Ga0265338_10000616 | Ga0265338_1000061616 | 157 |
| 191 | 3300028800 | Ga0265338_10003109 | Ga0265338_100031093 | 157 |
| 192 | 3300028800 | Ga0265338_10004875 | Ga0265338_1000487519 | 157 |
| 193 | 3300028800 | Ga0265338_10005089 | Ga0265338_100050893 | 157 |
| 194 | 3300028800 | Ga0265338_10005565 | Ga0265338_100055655 | 157 |
| 195 | 3300028800 | Ga0265338_10006543 | Ga0265338_1000654315 | 157 |
| 196 | 3300028800 | Ga0265338_10008700 | Ga0265338_100087006 | 157 |
| 197 | 3300028800 | Ga0265338_10019398 | Ga0265338_100193987 | 157 |
| 198 | 3300028800 | Ga0265338_10036180 | Ga0265338_100361805 | 157 |
| 199 | 3300028800 | Ga0265338_10036220 | Ga0265338_100362202 | 157 |
| 200 | 3300028800 | Ga0265338_10048800 | Ga0265338_100488002 | 157 |
| 201 | 3300028800 | Ga0265338_10059400 | Ga0265338_100594003 | 157 |
| 202 | 3300028800 | Ga0265338_10061161 | Ga0265338_100611614 | 157 |
| 203 | 3300028800 | Ga0265338_10096202 | Ga0265338_100962022 | 157 |
| 204 | 3300028800 | Ga0265338_10109326 | Ga0265338_101093262 | 157 |
| 205 | 3300028800 | Ga0265338_10147576 | Ga0265338_101475761 | 157 |
| 206 | 3300028800 | Ga0265338_10154163 | Ga0265338_101541632 | 157 |
| 207 | 3300028800 | Ga0265338_10177956 | Ga0265338_101779565 | 157 |
| 208 | 3300028800 | Ga0265338_10261876 | Ga0265338_102618763 | 157 |
| 209 | 3300028800 | Ga0265338_10365682 | Ga0265338_103656822 | 157 |
| 210 | 3300028800 | Ga0265338_10404635 | Ga0265338_104046352 | 157 |
| 211 | 3300028800 | Ga0265338_10454609 | Ga0265338_104546091 | 157 |
| 212 | 3300028800 | Ga0265338_10467445 | Ga0265338_104674451 | 157 |
| 213 | 3300028800 | Ga0265338_10682144 | Ga0265338_106821442 | 157 |
| 214 | 3300029957 | Ga0265324_10000939 | Ga0265324_1000093910 | 157 |
| 215 | 3300029957 | Ga0265324_10007656 | Ga0265324_100076565 | 157 |
| 216 | 3300029957 | Ga0265324_10011487 | Ga0265324_100114872 | 157 |
| 217 | 3300029957 | Ga0265324_10025597 | Ga0265324_100255972 | 157 |
| 218 | 3300029957 | Ga0265324_10063545 | Ga0265324_100635452 | 157 |
| 219 | 3300029957 | Ga0265324_10064916 | Ga0265324_100649161 | 157 |
| 220 | 3300029957 | Ga0265324_10067579 | Ga0265324_100675792 | 157 |
| 221 | 3300029957 | Ga0265324_10162235 | Ga0265324_101622352 | 157 |
| 222 | 3300029957 | Ga0265324_10297489 | Ga0265324_102974891 | 157 |
| 223 | 3300031238 | Ga0265332_10039819 | Ga0265332_100398192 | 157 |
| 224 | 3300031239 | Ga0265328_10049568 | Ga0265328_100495681 | 157 |
| 225 | 3300031240 | Ga0265320_10000551 | Ga0265320_1000055114 | 157 |
| 226 | 3300031240 | Ga0265320_10001912 | Ga0265320_1000191211 | 157 |
| 227 | 3300031240 | Ga0265320_10003522 | Ga0265320_100035223 | 157 |
| 228 | 3300031240 | Ga0265320_10020573 | Ga0265320_100205733 | 157 |
| 229 | 3300031240 | Ga0265320_10039515 | Ga0265320_100395154 | 157 |
| 230 | 3300031240 | Ga0265320_10085177 | Ga0265320_100851771 | 157 |
| 231 | 3300031240 | Ga0265320_10147530 | Ga0265320_101475301 | 157 |
| 232 | 3300031241 | Ga0265325_10031549 | Ga0265325_100315491 | 157 |
| 233 | 3300031247 | Ga0265340_10001551 | Ga0265340_1000155110 | 157 |
| 234 | 3300031247 | Ga0265340_10054582 | Ga0265340_100545821 | 157 |
| 235 | 3300031247 | Ga0265340_10222240 | Ga0265340_102222401 | 157 |
| 236 | 3300031249 | Ga0265339_10031067 | Ga0265339_100310672 | 157 |
| 237 | 3300031249 | Ga0265339_10069664 | Ga0265339_100696642 | 157 |
| 238 | 3300031249 | Ga0265339_10306343 | Ga0265339_103063431 | 157 |
| 239 | 3300031249 | Ga0265339_10556160 | Ga0265339_105561601 | 157 |
| 240 | 3300031250 | Ga0265331_10245194 | Ga0265331_102451941 | 157 |
| 241 | 3300031251 | Ga0265327_10000634 | Ga0265327_1000063441 | 157 |
| 242 | 3300031251 | Ga0265327_10159536 | Ga0265327_101595361 | 157 |
| 243 | 3300031344 | Ga0265316_10009212 | Ga0265316_100092128 | 157 |
| 244 | 3300031344 | Ga0265316_10029540 | Ga0265316_100295404 | 157 |
| 245 | 3300031344 | Ga0265316_10055762 | Ga0265316_100557622 | 157 |
| 246 | 3300031344 | Ga0265316_10142776 | Ga0265316_101427762 | 157 |
| 247 | 3300031344 | Ga0265316_10325316 | Ga0265316_103253162 | 157 |
| 248 | 3300031344 | Ga0265316_10408351 | Ga0265316_104083511 | 157 |
| 249 | 3300031344 | Ga0265316_10835845 | Ga0265316_108358451 | 157 |
| 250 | 3300031507 | Ga0307509_10379381 | Ga0307509_103793812 | 157 |
| 251 | 3300031595 | Ga0265313_10000385 | Ga0265313_1000038521 | 157 |
| 252 | 3300031595 | Ga0265313_10015182 | Ga0265313_100151823 | 157 |
| 253 | 3300031711 | Ga0265314_10056361 | Ga0265314_100563612 | 157 |
| 254 | 3300031711 | Ga0265314_10269171 | Ga0265314_102691712 | 157 |
| 255 | 3300031711 | Ga0265314_10463879 | Ga0265314_104638792 | 157 |
| 256 | 3300031712 | Ga0265342_10083542 | Ga0265342_100835422 | 157 |
| 257 | 3300031712 | Ga0265342_10089478 | Ga0265342_100894782 | 157 |
| 258 | 3300031712 | Ga0265342_10124876 | Ga0265342_101248762 | 157 |
| 259 | 3300031712 | Ga0265342_10517255 | Ga0265342_105172551 | 157 |
| 260 | 3300034816 | Ga0373930_0003785 | Ga0373930_0003785_1279_1755 | 157 |
| 261 | 3300035084 | Ga0373928_0000004 | Ga0373928_0000004_38729_39205 | 157 |
| 262 | 3300035089 | Ga0373944_0008707 | Ga0373944_0008707_508_984 | 157 |
| 263 | 3300035090 | Ga0373949_0002066 | Ga0373949_0002066_2756_3232 | 157 |
| 264 | 3300035112 | Ga0373932_0000001 | Ga0373932_0000001_905231_905707 | 157 |
| 265 | 3300035117 | Ga0373953_0271413 | Ga0373953_0271413_156_629 | 157 |
| 266 | 3300035118 | Ga0373954_0051710 | Ga0373954_0051710_459_932 | 157 |
| 267 | 3300035119 | Ga0373956_0017790 | Ga0373956_0017790_1803_2276 | 157 |
| 268 | 3300035170 | Ga0373943_0155952 | Ga0373943_0155952_158_634 | 157 |
| 269 | 3300035172 | Ga0373955_0235031 | Ga0373955_0235031_285_812 | 157 |
| 270 | 3300035242 | Ga0373962_0000254 | Ga0373962_0000254_1911_2387 | 157 |
| 271 | 3300035398 | Ga0316574_0344725 | Ga0316574_0344725_223_702 | 157 |
| 272 | 3300035691 | Ga0373931_0000002 | Ga0373931_0000002_589691_590167 | 157 |
| 273 | 3300035691 | Ga0373931_0274178 | Ga0373931_0274178_139_612 | 157 |
| 274 | 3300035692 | Ga0373935_0100128 | Ga0373935_0100128_758_1234 | 157 |
| 275 | 3300035692 | Ga0373935_0635649 | Ga0373935_0635649_190_663 | 157 |
| 276 | 3300035695 | Ga0373927_0002484 | Ga0373927_0002484_8879_9355 | 157 |
| 277 | 3300035695 | Ga0373927_0339810 | Ga0373927_0339810_419_892 | 157 |
| 278 | 3300035724 | Ga0373933_0494273 | Ga0373933_0494273_20_493 | 157 |
| 279 | 3300035725 | Ga0373947_0217826 | Ga0373947_0217826_277_753 | 157 |
| 280 | 3300036401 | Ga0373937_0026632 | Ga0373937_0026632_1402_1875 | 157 |
| 281 | 3300036401 | Ga0373937_0718444 | Ga0373937_0718444_134_607 | 157 |
| 282 | 3300036647 | Ga0316582_0235729 | Ga0316582_0235729_640_1119 | 157 |
| 283 | 3300037068 | Ga0373925_0000077 | Ga0373925_0000077_45912_46388 | 157 |
| 284 | 3300041452 | Ga0451793_0684306 | Ga0451793_0684306_189_662 | 157 |
| 285 | 3300041458 | Ga0451798_0314004 | Ga0451798_0314004_59_532 | 157 |
| 286 | 3300041458 | Ga0451798_1068640 | Ga0451798_1068640_14_487 | 157 |
| 287 | 3300041486 | Ga0451807_0297416 | Ga0451807_0297416_104_577 | 157 |
| 288 | 3300041505 | Ga0451849_1288056 | Ga0451849_1288056_69_542 | 157 |
| 289 | 3300042876 | Ga0451577_0052529 | Ga0451577_0052529_1957_2430 | 157 |
| 290 | 3300042876 | Ga0451577_0475959 | Ga0451577_0475959_329_802 | 157 |
| 291 | 3300042876 | Ga0451577_1007791 | Ga0451577_1007791_174_647 | 157 |
| 292 | 3300044712 | Ga0453684_0002150 | Ga0453684_0002150_41641_42114 | 157 |
| 293 | 3300044712 | Ga0453684_0114653 | Ga0453684_0114653_406_879 | 157 |
| 294 | 3300044712 | Ga0453684_0132002 | Ga0453684_0132002_915_1388 | 157 |
| 295 | 3300044712 | Ga0453684_0512749 | Ga0453684_0512749_602_1075 | 157 |
| 296 | 3300045051 | Ga0451576_0233651 | Ga0451576_0233651_992_1465 | 157 |
| 297 | 3300045051 | Ga0451576_0727909 | Ga0451576_0727909_156_629 | 157 |
| 298 | 3300045051 | Ga0451576_1033399 | Ga0451576_1033399_124_597 | 157 |
| 299 | 3300046454 | Ga0495592_0135301 | Ga0495592_0135301_357_830 | 157 |
| 300 | 3300046462 | Ga0495651_0327938 | Ga0495651_0327938_143_628 | 157 |
| 301 | 3300046476 | Ga0495662_0415565 | Ga0495662_0415565_153_626 | 157 |
| 302 | 3300046477 | Ga0495664_0261853 | Ga0495664_0261853_213_686 | 157 |
| 303 | 3300046514 | Ga0495618_0000968 | Ga0495618_0000968_7503_7976 | 157 |
| 304 | 3300046514 | Ga0495618_0338728 | Ga0495618_0338728_257_784 | 157 |
| 305 | 3300046516 | Ga0495628_0302857 | Ga0495628_0302857_297_770 | 157 |
| 306 | 3300046517 | Ga0495630_0193088 | Ga0495630_0193088_938_1411 | 157 |
| 307 | 3300046533 | Ga0495640_0080516 | Ga0495640_0080516_319_846 | 157 |
| 308 | 3300046533 | Ga0495640_0294565 | Ga0495640_0294565_341_814 | 157 |
| 309 | 3300046535 | Ga0495586_0018839 | Ga0495586_0018839_236_709 | 157 |
| 310 | 3300046535 | Ga0495586_0027307 | Ga0495586_0027307_2099_2572 | 157 |
| 311 | 3300046535 | Ga0495586_0213574 | Ga0495586_0213574_107_580 | 157 |
| 312 | 3300046536 | Ga0495587_0367631 | Ga0495587_0367631_135_608 | 157 |
| 313 | 3300046543 | Ga0495645_0248638 | Ga0495645_0248638_634_1119 | 157 |
| 314 | 3300046543 | Ga0495645_0508699 | Ga0495645_0508699_10_483 | 157 |
| 315 | 3300046543 | Ga0495645_0598594 | Ga0495645_0598594_121_594 | 157 |
| 316 | 3300046559 | Ga0495667_0029599 | Ga0495667_0029599_2948_3421 | 157 |
| 317 | 3300046559 | Ga0495667_0066109 | Ga0495667_0066109_1220_1693 | 157 |
| 318 | 3300046642 | Ga0495634_0002583 | Ga0495634_0002583_6171_6644 | 157 |
| 319 | 3300046675 | Ga0495657_0109553 | Ga0495657_0109553_796_1269 | 157 |
| 320 | 3300046678 | Ga0495599_0569555 | Ga0495599_0569555_177_650 | 157 |
| 321 | 3300046689 | Ga0495613_0002225 | Ga0495613_0002225_7368_7841 | 157 |
| 322 | 3300046689 | Ga0495613_0665326 | Ga0495613_0665326_91_564 | 157 |
| 323 | 3300046809 | Ga0495600_0814238 | Ga0495600_0814238_12_485 | 157 |
| 324 | 3300047318 | Ga0495636_0226204 | Ga0495636_0226204_274_747 | 157 |
| 325 | 3300047319 | Ga0495674_0467876 | Ga0495674_0467876_335_808 | 157 |
| 326 | 3300047319 | Ga0495674_1043634 | Ga0495674_1043634_113_586 | 157 |
| 327 | 3300047321 | Ga0495676_0571632 | Ga0495676_0571632_103_576 | 157 |
| 328 | 3300047322 | Ga0495680_0003659 | Ga0495680_0003659_3078_3551 | 157 |
| 329 | 3300047471 | Ga0495684_0503385 | Ga0495684_0503385_132_605 | 157 |
| 330 | 3300048918 | Ga0496115_0792631 | Ga0496115_0792631_81_554 | 157 |
| 331 | 3300049568 | Ga0501031_0000569 | Ga0501031_0000569_20500_20973 | 157 |
| 332 | 3300049569 | Ga0501032_0004203 | Ga0501032_0004203_5979_6452 | 157 |
| 333 | 3300049569 | Ga0501032_0112691 | Ga0501032_0112691_143_619 | 157 |
| 334 | 3300049570 | Ga0501033_0044587 | Ga0501033_0044587_2499_2975 | 157 |
| 335 | 3300049570 | Ga0501033_0168978 | Ga0501033_0168978_998_1471 | 157 |
| 336 | 3300049572 | Ga0501036_0294463 | Ga0501036_0294463_675_1151 | 157 |
| 337 | 3300049573 | Ga0501037_0256288 | Ga0501037_0256288_261_737 | 157 |
| 338 | 3300049579 | Ga0501043_0394553 | Ga0501043_0394553_286_762 | 157 |
| 339 | 3300049581 | Ga0501047_0086778 | Ga0501047_0086778_1746_2222 | 157 |
| 340 | 3300049581 | Ga0501047_0470614 | Ga0501047_0470614_469_945 | 157 |
| 341 | 3300049582 | Ga0501048_1216578 | Ga0501048_1216578_52_528 | 157 |
| 342 | 3300049742 | Ga0501080_0126281 | Ga0501080_0126281_1168_1644 | 157 |
| 343 | 3300049744 | Ga0501083_0002953 | Ga0501083_0002953_7953_8426 | 157 |
| 344 | 3300049822 | Ga0501035_0010225 | Ga0501035_0010225_5353_5826 | 157 |
| 345 | 3300049822 | Ga0501035_0151151 | Ga0501035_0151151_1159_1635 | 157 |
| 346 | 3300049823 | Ga0501044_0000823 | Ga0501044_0000823_29972_30445 | 157 |
| 347 | 3300049823 | Ga0501044_0038246 | Ga0501044_0038246_1046_1522 | 157 |
| 348 | 3300049823 | Ga0501044_0977229 | Ga0501044_0977229_108_638 | 157 |
| 349 | 3300049823 | Ga0501044_1204038 | Ga0501044_1204038_115_588 | 157 |
| 350 | 3300050507 | nmdc:mga05p37_666181_c1 | nmdc:mga05p37_666181_c1_458_931 | 157 |
| 351 | 3300050508 | nmdc:mga09592_176115_c1 | nmdc:mga09592_176115_c1_1064_1537 | 157 |
| 352 | 3300050511 | nmdc:mga08y16_23816_c1 | nmdc:mga08y16_23816_c1_4687_5160 | 157 |
| 353 | 3300050511 | nmdc:mga08y16_518406_c1 | nmdc:mga08y16_518406_c1_10_483 | 157 |
| 354 | 3300050512 | nmdc:mga0n895_943892_c1 | nmdc:mga0n895_943892_c1_332_805 | 157 |
| 355 | 3300053093 | Ga0500651_0410038 | Ga0500651_0410038_57_530 | 157 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6u9h-assembly1.cif.gz_G | arabidopsis thaliana acetohydroxyacid synthase complex | 0.9341 | 2 | 157 |
| 2f1f-assembly1.cif.gz_A | crystal structure of the regulatory subunit of acetohydroxyacid synthase isozyme iii from e. coli | 0.9235 | 1 | 157 |
| 6u9h-assembly1.cif.gz_G | arabidopsis thaliana acetohydroxyacid synthase complex | 0.9229 | 2 | 157 |
| 2fgc-assembly1.cif.gz_A-2 | crystal structure of acetolactate synthase- small subunit from thermotoga maritima | 0.9183 | 1 | 157 |
| 2f1f-assembly1.cif.gz_A | crystal structure of the regulatory subunit of acetohydroxyacid synthase isozyme iii from e. coli | 0.918 | 1 | 157 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WKJ3_86_164_3.30.70.1150 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT-like. Chain A, domain 2 | 0.9749 | 84 | 157 | 3.30.70.1150 |
| af_P25605_75_154_3.30.70.260 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain | 0.9624 | 2 | 76 | 3.30.70.260 |
| af_Q57625_89_166_3.30.70.1150 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT-like. Chain A, domain 2 | 0.9603 | 84 | 157 | 3.30.70.1150 |
| af_Q93YZ7_400_477_3.30.70.1150 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT-like. Chain A, domain 2 | 0.9516 | 84 | 157 | 3.30.70.1150 |
| 2fgdA02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT-like. Chain A, domain 2 | 0.9429 | 81 | 156 | 3.30.70.1150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A522JBU8-F1-model_v4 | Acetolactate synthase small subunit (AHAS) (ALS) (EC 2.2.1.6) (Acetohydroxy-acid synthase small subunit) | 0.9813 | 1 | 79 |
GO:0003984
GO:0005829 GO:0009097 GO:0009099 GO:1990610 |
| AF-A0A550HI48-F1-model_v4 | Acetolactate synthase small subunit C-terminal domain-containing protein | 0.9677 | 81 | 157 |
GO:0003984
GO:0005829 GO:0009097 GO:0009099 GO:1990610 |
| AF-A0A3C0YS73-F1-model_v4 | Acetolactate synthase small subunit (AHAS) (ALS) (EC 2.2.1.6) (Acetohydroxy-acid synthase small subunit) | 0.9657 | 84 | 157 |
GO:0003984
GO:0005829 GO:0009097 GO:0009099 GO:1990610 |
| AF-A0A1L5KZ17-F1-model_v4 | Acetolactate synthase small subunit (AHAS) (ALS) (EC 2.2.1.6) (Acetohydroxy-acid synthase small subunit) | 0.96 | 1 | 79 |
GO:0003984
GO:0005829 GO:0009097 GO:0009099 GO:1990610 |
| AF-A0A4U7EZ41-F1-model_v4 | Acetolactate synthase small subunit (AHAS) (ALS) (EC 2.2.1.6) (Acetohydroxy-acid synthase small subunit) | 0.96 | 1 | 79 |
GO:0003984
GO:0005829 GO:0009097 GO:0009099 GO:1990610 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar