F420004

General Info

Members Datasets Scaffolds Average Seq Length
355 165 355 157

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_100033408|Ga0070690_1000334082
Length 178
Sequence MQIDPFPAGCYAFRPFSNGFMRHTISVLVENKFGVLTRVAGLFSGRGYNIDTLNVGPTNDPDLSRMTIVTHGDEATLEQIVKQLNKLPDVIKVQDFRDGSEYVDRELVLVKVGVDSKSRAEVMQITDIFRAKIVDVQPKSLTVEITGTDSKVEKFLDLMETFGVKEITRTGKAALPRK

Samples

Sample ID Description Type Environment
1 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
73 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
74 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
75 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
76 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
77 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
78 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
79 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
80 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
81 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
82 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
83 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
84 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
85 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
86 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
87 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
88 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
89 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
90 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
91 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
92 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
93 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
94 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
95 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
96 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
97 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
98 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
99 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
100 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
101 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
102 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
103 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
104 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
105 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
106 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
107 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
108 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
109 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
111 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
112 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
113 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
114 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
115 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
116 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
117 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
118 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
119 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
120 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
121 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
122 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
123 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
124 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
125 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
126 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
127 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
128 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
129 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
130 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
131 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
132 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
133 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
134 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
135 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
136 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
137 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
138 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
139 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
140 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
141 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
142 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
143 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
144 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
145 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
146 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
158 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
159 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
165 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 1.41
Rhizosphere 96.62
Stem 0
Stem Tuber 0
Unclassified 1.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNXas_1001031 3300000545 Bacteria 1834
2 rootH2_10184661 3300003320 Bacteria 4326
3 rootH1_10049112 3300003323 Bacteria 11034
4 rootH1_10132720 3300003323 Bacteria 1160
5 Ga0065704_10319064 3300005289 Bacteria 856
6 Ga0070683_100986411 3300005329 Bacteria 809
7 Ga0070690_100033408 3300005330 Bacteria 3220
8 Ga0070670_101131890 3300005331 Unclassified 714
9 Ga0070666_10503322 3300005335 Unclassified 878
10 Ga0070680_100309622 3300005336 Bacteria 1340
11 Ga0070680_100347342 3300005336 Bacteria 1261
12 Ga0070689_100056714 3300005340 Bacteria 3038
13 Ga0070689_100092449 3300005340 Bacteria 2386
14 Ga0070689_100343328 3300005340 Bacteria 1251
15 Ga0070689_100555326 3300005340 Bacteria 990
16 Ga0070691_10007247 3300005341 Bacteria 5076
17 Ga0070687_100387032 3300005343 Bacteria 913
18 Ga0070669_100659426 3300005353 Bacteria 881
19 Ga0070675_100324417 3300005354 Bacteria 1361
20 Ga0070688_100369024 3300005365 Bacteria 1055
21 Ga0070688_101562685 3300005365 Bacteria 538
22 Ga0070714_100060390 3300005435 Bacteria 3253
23 Ga0070711_100001752 3300005439 Bacteria 12061
24 Ga0070681_10016382 3300005458 Bacteria 7399
25 Ga0070681_10020688 3300005458 Bacteria 6592
26 Ga0070681_10368967 3300005458 Bacteria 1346
27 Ga0070685_10037454 3300005466 Bacteria 2747
28 Ga0070679_100144666 3300005530 Bacteria 2356
29 Ga0070679_100213414 3300005530 Bacteria 1893
30 Ga0070679_100542401 3300005530 Unclassified 1107
31 Ga0068853_100615510 3300005539 Bacteria 1032
32 Ga0068855_100018404 3300005563 Bacteria 8394
33 Ga0068855_100044368 3300005563 Bacteria 5261
34 Ga0068855_100196063 3300005563 Bacteria 2275
35 Ga0068855_100208393 3300005563 Bacteria 2198
36 Ga0068855_101451046 3300005563 Bacteria 706
37 Ga0068857_100038433 3300005577 Bacteria 4239
38 Ga0068857_100048454 3300005577 Bacteria 3772
39 Ga0068857_100977860 3300005577 Bacteria 814
40 Ga0068857_101153849 3300005577 Bacteria 749
41 Ga0068856_100000080 3300005614 Bacteria 90679
42 Ga0068856_100042437 3300005614 Bacteria 4474
43 Ga0068856_100060613 3300005614 Bacteria 3738
44 Ga0070702_100420870 3300005615 Bacteria 961
45 Ga0068859_100335588 3300005617 Bacteria 1606
46 Ga0068859_100430880 3300005617 Bacteria 1415
47 Ga0068859_100668446 3300005617 Unclassified 1130
48 Ga0068859_101545137 3300005617 Unclassified 733
49 Ga0068859_101982838 3300005617 Bacteria 643
50 Ga0068864_100301857 3300005618 Bacteria 1499
51 Ga0068861_101321600 3300005719 Bacteria 702
52 Ga0068863_100226548 3300005841 Bacteria 1802
53 Ga0068863_100729281 3300005841 Bacteria 986
54 Ga0068871_100729326 3300006358 Bacteria 910
55 Ga0075428_100001269 3300006844 Bacteria 26915
56 Ga0075428_100184832 3300006844 Bacteria 2255
57 Ga0075431_100671886 3300006847 Bacteria 1015
58 Ga0075429_100043300 3300006880 Bacteria 3918
59 Ga0097620_100335610 3300006931 Bacteria 1606
60 Ga0097620_100430836 3300006931 Bacteria 1415
61 Ga0097620_100668533 3300006931 Unclassified 1130
62 Ga0097620_101545130 3300006931 Unclassified 733
63 Ga0097620_101982580 3300006931 Bacteria 643
64 Ga0105240_10020292 3300009093 Bacteria 8870
65 Ga0105240_10043586 3300009093 Bacteria 5707
66 Ga0105240_10095225 3300009093 Bacteria 3630
67 Ga0105240_10702297 3300009093 Bacteria 1104
68 Ga0111539_10004377 3300009094 Bacteria 18480
69 Ga0111539_10168584 3300009094 Bacteria 2559
70 Ga0105245_10644319 3300009098 Bacteria 1089
71 Ga0105242_12622927 3300009176 Bacteria 553
72 Ga0105248_11156969 3300009177 Bacteria 875
73 Ga0105248_11591595 3300009177 Bacteria 740
74 Ga0105248_11601955 3300009177 Unclassified 738
75 Ga0105238_10037077 3300009551 Bacteria 4957
76 Ga0105238_10044915 3300009551 Bacteria 4465
77 Ga0105238_10957254 3300009551 Bacteria 876
78 Ga0105238_11515806 3300009551 Bacteria 699
79 Ga0105238_11615117 3300009551 Bacteria 678
80 Ga0157370_10027492 3300013104 Bacteria 5609
81 Ga0157370_10125229 3300013104 Bacteria 2399
82 Ga0157370_10243007 3300013104 Unclassified 1665
83 Ga0157374_11494653 3300013296 Bacteria 699
84 Ga0157378_10883160 3300013297 Bacteria 924
85 Ga0157378_12363098 3300013297 Bacteria 583
86 Ga0163162_10388213 3300013306 Bacteria 1529
87 Ga0157372_10100449 3300013307 Bacteria 3301
88 Ga0157372_10457264 3300013307 Bacteria 1488
89 Ga0157372_10582330 3300013307 Bacteria 1304
90 Ga0157375_10384247 3300013308 Bacteria 1571
91 Ga0157375_10778602 3300013308 Bacteria 1106
92 Ga0163163_10000211 3300014325 Bacteria 60430
93 Ga0157380_11244829 3300014326 Unclassified 789
94 Ga0157379_10438565 3300014968 Bacteria 1204
95 Ga0157376_11387179 3300014969 Unclassified 734
96 Ga0207653_10329407 3300025885 Bacteria 595
97 Ga0207705_10162688 3300025909 Bacteria 1677
98 Ga0207705_10491828 3300025909 Bacteria 952
99 Ga0207707_10113748 3300025912 Bacteria 2365
100 Ga0207707_10511603 3300025912 Bacteria 1023
101 Ga0207695_10082251 3300025913 Unclassified 3257
102 Ga0207695_10235642 3300025913 Bacteria 1733
103 Ga0207663_10137163 3300025916 Bacteria 1699
104 Ga0207663_10353061 3300025916 Bacteria 1114
105 Ga0207660_10079532 3300025917 Bacteria 2405
106 Ga0207662_10270427 3300025918 Bacteria 1121
107 Ga0207652_10105303 3300025921 Bacteria 2496
108 Ga0207652_10127153 3300025921 Bacteria 2270
109 Ga0207652_10661815 3300025921 Bacteria 933
110 Ga0207694_10057318 3300025924 Bacteria 3028
111 Ga0207694_10107620 3300025924 Bacteria 2215
112 Ga0207694_10719700 3300025924 Bacteria 842
113 Ga0207650_10731963 3300025925 Unclassified 836
114 Ga0207664_10048918 3300025929 Bacteria 3327
115 Ga0207670_10236652 3300025936 Bacteria 1405
116 Ga0207670_10921800 3300025936 Bacteria 732
117 Ga0207704_11416125 3300025938 Bacteria 596
118 Ga0207711_11084251 3300025941 Bacteria 742
119 Ga0207667_10003649 3300025949 Bacteria 18978
120 Ga0207667_10028120 3300025949 Bacteria 6108
121 Ga0207667_11096682 3300025949 Bacteria 779
122 Ga0207651_10772530 3300025960 Bacteria 850
123 Ga0207703_10241506 3300026035 Bacteria 1624
124 Ga0207639_11438901 3300026041 Bacteria 647
125 Ga0207702_10000588 3300026078 Bacteria 40254
126 Ga0207702_10001107 3300026078 Bacteria 27560
127 Ga0207702_10018780 3300026078 Bacteria 5718
128 Ga0207702_10134112 3300026078 Bacteria 2232
129 Ga0207674_10043795 3300026116 Bacteria 4613
130 Ga0207674_10125796 3300026116 Bacteria 2529
131 Ga0207674_10980197 3300026116 Bacteria 814
132 Ga0207675_100483221 3300026118 Bacteria 1231
133 Ga0207675_101221604 3300026118 Bacteria 772
134 Ga0265337_1000847 3300028556 Bacteria 16046
135 Ga0265337_1002727 3300028556 Bacteria 7927
136 Ga0265337_1003374 3300028556 Bacteria 6940
137 Ga0265337_1011484 3300028556 Bacteria 3050
138 Ga0265337_1015373 3300028556 Bacteria 2506
139 Ga0265337_1022724 3300028556 Bacteria 1938
140 Ga0265337_1032530 3300028556 Bacteria 1542
141 Ga0265337_1038716 3300028556 Bacteria 1381
142 Ga0265337_1065510 3300028556 Unclassified 1002
143 Ga0265326_10001485 3300028558 Bacteria 8238
144 Ga0265326_10026862 3300028558 Bacteria 1641
145 Ga0265326_10038719 3300028558 Bacteria 1355
146 Ga0265326_10135316 3300028558 Bacteria 703
147 Ga0265326_10163124 3300028558 Bacteria 637
148 Ga0265319_1000004 3300028563 Bacteria 305085
149 Ga0265319_1025854 3300028563 Bacteria 2097
150 Ga0265319_1028279 3300028563 Bacteria 1978
151 Ga0265319_1052692 3300028563 Bacteria 1338
152 Ga0265319_1209101 3300028563 Bacteria 598
153 Ga0265334_10013313 3300028573 Bacteria 3445
154 Ga0265318_10158742 3300028577 Bacteria 829
155 Ga0265323_10000140 3300028653 Bacteria 41860
156 Ga0265323_10005091 3300028653 Bacteria 5612
157 Ga0265323_10006619 3300028653 Bacteria 4862
158 Ga0265323_10022280 3300028653 Bacteria 2421
159 Ga0265323_10066604 3300028653 Bacteria 1240
160 Ga0265323_10103216 3300028653 Bacteria 941
161 Ga0265322_10019174 3300028654 Unclassified 1964
162 Ga0265322_10040080 3300028654 Bacteria 1333
163 Ga0265322_10047770 3300028654 Bacteria 1217
164 Ga0265322_10128176 3300028654 Bacteria 724
165 Ga0265336_10002944 3300028666 Bacteria 6822
166 Ga0265336_10023018 3300028666 Bacteria 1979
167 Ga0265336_10043347 3300028666 Bacteria 1372
168 Ga0265336_10076123 3300028666 Bacteria 1002
169 Ga0265338_10000070 3300028800 Bacteria 185904
170 Ga0265338_10000084 3300028800 Bacteria 175415
171 Ga0265338_10000111 3300028800 Bacteria 151469
172 Ga0265338_10000208 3300028800 Bacteria 109817
173 Ga0265338_10000616 3300028800 Bacteria 62218
174 Ga0265338_10003109 3300028800 Bacteria 23752
175 Ga0265338_10004875 3300028800 Bacteria 17874
176 Ga0265338_10005089 3300028800 Bacteria 17354
177 Ga0265338_10005565 3300028800 Bacteria 16388
178 Ga0265338_10006543 3300028800 Bacteria 14807
179 Ga0265338_10008700 3300028800 Bacteria 12273
180 Ga0265338_10012868 3300028800 Bacteria 9507
181 Ga0265338_10019398 3300028800 Bacteria 7216
182 Ga0265338_10036180 3300028800 Bacteria 4731
183 Ga0265338_10036220 3300028800 Bacteria 4727
184 Ga0265338_10048800 3300028800 Bacteria 3847
185 Ga0265338_10059400 3300028800 Bacteria 3369
186 Ga0265338_10061161 3300028800 Bacteria 3302
187 Ga0265338_10096202 3300028800 Bacteria 2430
188 Ga0265338_10109326 3300028800 Bacteria 2231
189 Ga0265338_10147576 3300028800 Bacteria 1832
190 Ga0265338_10154163 3300028800 Bacteria 1781
191 Ga0265338_10177956 3300028800 Bacteria 1624
192 Ga0265338_10261876 3300028800 Bacteria 1271
193 Ga0265338_10365682 3300028800 Bacteria 1034
194 Ga0265338_10404635 3300028800 Bacteria 972
195 Ga0265338_10454609 3300028800 Bacteria 906
196 Ga0265338_10467445 3300028800 Bacteria 891
197 Ga0265338_10682144 3300028800 Bacteria 710
198 Ga0265324_10000939 3300029957 Bacteria 18262
199 Ga0265324_10007656 3300029957 Bacteria 4350
200 Ga0265324_10011487 3300029957 Bacteria 3372
201 Ga0265324_10025597 3300029957 Bacteria 2091
202 Ga0265324_10063545 3300029957 Bacteria 1260
203 Ga0265324_10064916 3300029957 Bacteria 1245
204 Ga0265324_10067579 3300029957 Bacteria 1219
205 Ga0265324_10162235 3300029957 Bacteria 759
206 Ga0265324_10297489 3300029957 Bacteria 549
207 Ga0265332_10039819 3300031238 Bacteria 2036
208 Ga0265328_10049568 3300031239 Bacteria 1542
209 Ga0265320_10000551 3300031240 Bacteria 28889
210 Ga0265320_10001912 3300031240 Bacteria 14716
211 Ga0265320_10003522 3300031240 Bacteria 10485
212 Ga0265320_10018862 3300031240 Bacteria 3787
213 Ga0265320_10020573 3300031240 Bacteria 3572
214 Ga0265320_10039515 3300031240 Bacteria 2359
215 Ga0265320_10085177 3300031240 Bacteria 1471
216 Ga0265320_10147530 3300031240 Bacteria 1063
217 Ga0265325_10031549 3300031241 Bacteria 2834
218 Ga0265325_10040745 3300031241 Bacteria 2438
219 Ga0265340_10001551 3300031247 Bacteria 13183
220 Ga0265340_10054582 3300031247 Bacteria 1926
221 Ga0265340_10222240 3300031247 Bacteria 846
222 Ga0265339_10031067 3300031249 Bacteria 3020
223 Ga0265339_10069664 3300031249 Unclassified 1877
224 Ga0265339_10306343 3300031249 Bacteria 756
225 Ga0265339_10556160 3300031249 Bacteria 527
226 Ga0265331_10245194 3300031250 Bacteria 804
227 Ga0265327_10000634 3300031251 Bacteria 57259
228 Ga0265327_10159536 3300031251 Bacteria 1043
229 Ga0265316_10009212 3300031344 Bacteria 9093
230 Ga0265316_10029540 3300031344 Bacteria 4505
231 Ga0265316_10055762 3300031344 Bacteria 3089
232 Ga0265316_10142776 3300031344 Bacteria 1797
233 Ga0265316_10292336 3300031344 Bacteria 1188
234 Ga0265316_10325316 3300031344 Bacteria 1116
235 Ga0265316_10408351 3300031344 Bacteria 977
236 Ga0265316_10835845 3300031344 Bacteria 645
237 Ga0307509_10379381 3300031507 Bacteria 1127
238 Ga0265313_10000385 3300031595 Bacteria 47503
239 Ga0265313_10015182 3300031595 Bacteria 4503
240 Ga0265314_10056361 3300031711 Bacteria 2706
241 Ga0265314_10269171 3300031711 Bacteria 969
242 Ga0265314_10463879 3300031711 Bacteria 672
243 Ga0265342_10083542 3300031712 Bacteria 1840
244 Ga0265342_10089478 3300031712 Bacteria 1767
245 Ga0265342_10100767 3300031712 Bacteria 1645
246 Ga0265342_10124876 3300031712 Bacteria 1446
247 Ga0265342_10517255 3300031712 Unclassified 608
248 Ga0373930_0003785 3300034816 Bacteria 2425
249 Ga0373928_0000004 3300035084 Bacteria 45792
250 Ga0373944_0008707 3300035089 Bacteria 2742
251 Ga0373949_0002066 3300035090 Bacteria 5309
252 Ga0373932_0000001 3300035112 Bacteria 1459067
253 Ga0373932_0020508 3300035112 Bacteria 1734
254 Ga0373953_0271413 3300035117 Bacteria 739
255 Ga0373954_0051710 3300035118 Bacteria 1930
256 Ga0373956_0017790 3300035119 Bacteria 3002
257 Ga0373943_0155952 3300035170 Bacteria 1240
258 Ga0373955_0235031 3300035172 Bacteria 1097
259 Ga0373961_0038405 3300035241 Bacteria 1372
260 Ga0373962_0000254 3300035242 Bacteria 11361
261 Ga0316574_0344725 3300035398 Unclassified 943
262 Ga0373931_0000002 3300035691 Bacteria 599830
263 Ga0373931_0274178 3300035691 Unclassified 1034
264 Ga0373935_0100128 3300035692 Bacteria 1909
265 Ga0373935_0635649 3300035692 Bacteria 782
266 Ga0373927_0002484 3300035695 Bacteria 13459
267 Ga0373927_0003007 3300035695 Bacteria 12237
268 Ga0373927_0339810 3300035695 Bacteria 989
269 Ga0373933_0494273 3300035724 Bacteria 801
270 Ga0373947_0217826 3300035725 Bacteria 1254
271 Ga0373937_0026632 3300036401 Bacteria 5224
272 Ga0373937_0718444 3300036401 Bacteria 946
273 Ga0316582_0235729 3300036647 Unclassified 1253
274 Ga0373925_0000077 3300037068 Bacteria 105383
275 Ga0451793_0684306 3300041452 Bacteria 674
276 Ga0451798_0314004 3300041458 Bacteria 1095
277 Ga0451798_1068640 3300041458 Unclassified 503
278 Ga0451807_0297416 3300041486 Bacteria 792
279 Ga0451835_0993691 3300041492 Bacteria 1058
280 Ga0451849_1288056 3300041505 Unclassified 631
281 Ga0451577_0052529 3300042876 Bacteria 3639
282 Ga0451577_0475959 3300042876 Unclassified 1134
283 Ga0451577_1007791 3300042876 Bacteria 748
284 Ga0453684_0002150 3300044712 Bacteria 49388
285 Ga0453684_0114653 3300044712 Bacteria 3267
286 Ga0453684_0132002 3300044712 Bacteria 2996
287 Ga0453684_0512749 3300044712 Unclassified 1326
288 Ga0451576_0213110 3300045051 Bacteria 2017
289 Ga0451576_0233651 3300045051 Unclassified 1920
290 Ga0451576_0727909 3300045051 Archaea 1042
291 Ga0451576_1033399 3300045051 Bacteria 861
292 Ga0495592_0135301 3300046454 Bacteria 1720
293 Ga0495651_0327938 3300046462 Bacteria 1018
294 Ga0495662_0415565 3300046476 Bacteria 660
295 Ga0495664_0261853 3300046477 Bacteria 1045
296 Ga0495618_0000968 3300046514 Bacteria 19743
297 Ga0495618_0305405 3300046514 Bacteria 988
298 Ga0495618_0338728 3300046514 Bacteria 929
299 Ga0495628_0302857 3300046516 Bacteria 1183
300 Ga0495630_0193088 3300046517 Bacteria 1553
301 Ga0495640_0080516 3300046533 Bacteria 2166
302 Ga0495640_0294565 3300046533 Bacteria 1009
303 Ga0495586_0018839 3300046535 Bacteria 3674
304 Ga0495586_0027307 3300046535 Bacteria 3054
305 Ga0495586_0213574 3300046535 Bacteria 1095
306 Ga0495587_0367631 3300046536 Bacteria 800
307 Ga0495645_0248638 3300046543 Bacteria 1183
308 Ga0495645_0508699 3300046543 Bacteria 752
309 Ga0495645_0598594 3300046543 Bacteria 678
310 Ga0495622_0294891 3300046557 Unclassified 707
311 Ga0495667_0029599 3300046559 Bacteria 3686
312 Ga0495667_0066109 3300046559 Bacteria 2364
313 Ga0495634_0002583 3300046642 Bacteria 14935
314 Ga0495634_0309781 3300046642 Bacteria 953
315 Ga0495657_0109553 3300046675 Bacteria 1751
316 Ga0495599_0569555 3300046678 Bacteria 662
317 Ga0495613_0002225 3300046689 Bacteria 14688
318 Ga0495613_0665326 3300046689 Bacteria 688
319 Ga0495600_0814238 3300046809 Bacteria 556
320 Ga0495636_0226204 3300047318 Bacteria 860
321 Ga0495674_0467876 3300047319 Bacteria 1011
322 Ga0495674_1043634 3300047319 Bacteria 624
323 Ga0495676_0571632 3300047321 Bacteria 738
324 Ga0495680_0003659 3300047322 Bacteria 15005
325 Ga0495684_0285728 3300047471 Bacteria 1189
326 Ga0495684_0503385 3300047471 Bacteria 832
327 Ga0496115_0792631 3300048918 Bacteria 738
328 Ga0501031_0000569 3300049568 Bacteria 21596
329 Ga0501032_0004203 3300049569 Bacteria 10904
330 Ga0501032_0112691 3300049569 Bacteria 1799
331 Ga0501033_0044587 3300049570 Bacteria 3301
332 Ga0501033_0168978 3300049570 Bacteria 1571
333 Ga0501034_0501252 3300049571 Bacteria 1128
334 Ga0501036_0294463 3300049572 Bacteria 1358
335 Ga0501037_0256288 3300049573 Bacteria 1223
336 Ga0501043_0211977 3300049579 Bacteria 1501
337 Ga0501043_0394553 3300049579 Bacteria 1046
338 Ga0501047_0086778 3300049581 Bacteria 3007
339 Ga0501047_0104549 3300049581 Bacteria 2712
340 Ga0501047_0470614 3300049581 Bacteria 1085
341 Ga0501048_1216578 3300049582 Unclassified 542
342 Ga0501080_0126281 3300049742 Bacteria 2369
343 Ga0501083_0002953 3300049744 Bacteria 11786
344 Ga0501035_0010225 3300049822 Bacteria 8706
345 Ga0501035_0151151 3300049822 Bacteria 2015
346 Ga0501044_0000823 3300049823 Bacteria 37371
347 Ga0501044_0038246 3300049823 Bacteria 5011
348 Ga0501044_0977229 3300049823 Bacteria 719
349 Ga0501044_1204038 3300049823 Unclassified 625
350 nmdc:mga05p37_666181_c1 3300050507 Bacteria 1162
351 nmdc:mga09592_176115_c1 3300050508 Bacteria 1850
352 nmdc:mga08y16_23816_c1 3300050511 Bacteria 6465
353 nmdc:mga08y16_518406_c1 3300050511 Bacteria 1209
354 nmdc:mga0n895_943892_c1 3300050512 Bacteria 846
355 Ga0500651_0410038 3300053093 Unclassified 760

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041492 Ga0451835_0993691 Ga0451835_0993691_205_654 149
2 3300045051 Ga0451576_0213110 Ga0451576_0213110_1176_1625 149
3 3300049571 Ga0501034_0501252 Ga0501034_0501252_259_708 149
4 3300049579 Ga0501043_0211977 Ga0501043_0211977_306_755 149
5 3300049581 Ga0501047_0104549 Ga0501047_0104549_472_921 149
6 3300035241 Ga0373961_0038405 Ga0373961_0038405_868_1323 150
7 3300035695 Ga0373927_0003007 Ga0373927_0003007_3776_4228 150
8 3300046514 Ga0495618_0305405 Ga0495618_0305405_34_486 150
9 3300046557 Ga0495622_0294891 Ga0495622_0294891_198_650 150
10 3300046642 Ga0495634_0309781 Ga0495634_0309781_466_918 150
11 3300047471 Ga0495684_0285728 Ga0495684_0285728_268_720 150
12 3300013104 Ga0157370_10027492 Ga0157370_100274922 151
13 3300003323 rootH1_10132720 rootH1_101327201 156
14 3300005530 Ga0070679_100213414 Ga0070679_1002134142 156
15 3300005577 Ga0068857_100038433 Ga0068857_1000384334 156
16 3300005614 Ga0068856_100060613 Ga0068856_1000606136 156
17 3300005719 Ga0068861_101321600 Ga0068861_1013216002 156
18 3300025921 Ga0207652_10105303 Ga0207652_101053032 156
19 3300026078 Ga0207702_10000588 Ga0207702_100005889 156
20 3300026116 Ga0207674_10043795 Ga0207674_100437954 156
21 3300026118 Ga0207675_101221604 Ga0207675_1012216042 156
22 3300028653 Ga0265323_10066604 Ga0265323_100666042 156
23 3300028653 Ga0265323_10103216 Ga0265323_101032161 156
24 3300028800 Ga0265338_10012868 Ga0265338_100128686 156
25 3300031240 Ga0265320_10018862 Ga0265320_100188623 156
26 3300031241 Ga0265325_10040745 Ga0265325_100407452 156
27 3300031344 Ga0265316_10292336 Ga0265316_102923362 156
28 3300031712 Ga0265342_10100767 Ga0265342_101007671 156
29 3300035112 Ga0373932_0020508 Ga0373932_0020508_61_531 156
30 3300000545 CNXas_1001031 CNXas_10010312 157
31 3300003320 rootH2_10184661 rootH2_101846615 157
32 3300003323 rootH1_10049112 rootH1_100491126 157
33 3300005289 Ga0065704_10319064 Ga0065704_103190641 157
34 3300005329 Ga0070683_100986411 Ga0070683_1009864111 157
35 3300005330 Ga0070690_100033408 Ga0070690_1000334082 157
36 3300005331 Ga0070670_101131890 Ga0070670_1011318901 157
37 3300005335 Ga0070666_10503322 Ga0070666_105033222 157
38 3300005336 Ga0070680_100309622 Ga0070680_1003096222 157
39 3300005336 Ga0070680_100347342 Ga0070680_1003473422 157
40 3300005340 Ga0070689_100056714 Ga0070689_1000567142 157
41 3300005340 Ga0070689_100092449 Ga0070689_1000924492 157
42 3300005340 Ga0070689_100343328 Ga0070689_1003433282 157
43 3300005340 Ga0070689_100555326 Ga0070689_1005553262 157
44 3300005341 Ga0070691_10007247 Ga0070691_100072474 157
45 3300005343 Ga0070687_100387032 Ga0070687_1003870321 157
46 3300005353 Ga0070669_100659426 Ga0070669_1006594261 157
47 3300005354 Ga0070675_100324417 Ga0070675_1003244171 157
48 3300005365 Ga0070688_100369024 Ga0070688_1003690241 157
49 3300005365 Ga0070688_101562685 Ga0070688_1015626851 157
50 3300005435 Ga0070714_100060390 Ga0070714_1000603902 157
51 3300005439 Ga0070711_100001752 Ga0070711_1000017522 157
52 3300005458 Ga0070681_10016382 Ga0070681_100163822 157
53 3300005458 Ga0070681_10020688 Ga0070681_100206884 157
54 3300005458 Ga0070681_10368967 Ga0070681_103689672 157
55 3300005466 Ga0070685_10037454 Ga0070685_100374542 157
56 3300005530 Ga0070679_100144666 Ga0070679_1001446662 157
57 3300005530 Ga0070679_100542401 Ga0070679_1005424012 157
58 3300005539 Ga0068853_100615510 Ga0068853_1006155102 157
59 3300005563 Ga0068855_100018404 Ga0068855_1000184047 157
60 3300005563 Ga0068855_100044368 Ga0068855_1000443685 157
61 3300005563 Ga0068855_100196063 Ga0068855_1001960631 157
62 3300005563 Ga0068855_100208393 Ga0068855_1002083932 157
63 3300005563 Ga0068855_101451046 Ga0068855_1014510462 157
64 3300005577 Ga0068857_100048454 Ga0068857_1000484544 157
65 3300005577 Ga0068857_100977860 Ga0068857_1009778602 157
66 3300005577 Ga0068857_101153849 Ga0068857_1011538492 157
67 3300005614 Ga0068856_100000080 Ga0068856_10000008036 157
68 3300005614 Ga0068856_100042437 Ga0068856_1000424374 157
69 3300005615 Ga0070702_100420870 Ga0070702_1004208701 157
70 3300005617 Ga0068859_100335588 Ga0068859_1003355882 157
71 3300005617 Ga0068859_100430880 Ga0068859_1004308802 157
72 3300005617 Ga0068859_100668446 Ga0068859_1006684462 157
73 3300005617 Ga0068859_101545137 Ga0068859_1015451371 157
74 3300005617 Ga0068859_101982838 Ga0068859_1019828381 157
75 3300005618 Ga0068864_100301857 Ga0068864_1003018573 157
76 3300005841 Ga0068863_100226548 Ga0068863_1002265482 157
77 3300005841 Ga0068863_100729281 Ga0068863_1007292812 157
78 3300006358 Ga0068871_100729326 Ga0068871_1007293261 157
79 3300006844 Ga0075428_100001269 Ga0075428_1000012698 157
80 3300006844 Ga0075428_100184832 Ga0075428_1001848322 157
81 3300006847 Ga0075431_100671886 Ga0075431_1006718862 157
82 3300006880 Ga0075429_100043300 Ga0075429_1000433004 157
83 3300006931 Ga0097620_100335610 Ga0097620_1003356102 157
84 3300006931 Ga0097620_100430836 Ga0097620_1004308362 157
85 3300006931 Ga0097620_100668533 Ga0097620_1006685332 157
86 3300006931 Ga0097620_101545130 Ga0097620_1015451301 157
87 3300006931 Ga0097620_101982580 Ga0097620_1019825801 157
88 3300009093 Ga0105240_10020292 Ga0105240_100202925 157
89 3300009093 Ga0105240_10043586 Ga0105240_100435862 157
90 3300009093 Ga0105240_10095225 Ga0105240_100952254 157
91 3300009093 Ga0105240_10702297 Ga0105240_107022971 157
92 3300009094 Ga0111539_10004377 Ga0111539_100043773 157
93 3300009094 Ga0111539_10168584 Ga0111539_101685841 157
94 3300009098 Ga0105245_10644319 Ga0105245_106443191 157
95 3300009176 Ga0105242_12622927 Ga0105242_126229271 157
96 3300009177 Ga0105248_11156969 Ga0105248_111569692 157
97 3300009177 Ga0105248_11591595 Ga0105248_115915952 157
98 3300009177 Ga0105248_11601955 Ga0105248_116019551 157
99 3300009551 Ga0105238_10037077 Ga0105238_100370772 157
100 3300009551 Ga0105238_10044915 Ga0105238_100449152 157
101 3300009551 Ga0105238_10957254 Ga0105238_109572541 157
102 3300009551 Ga0105238_11515806 Ga0105238_115158061 157
103 3300009551 Ga0105238_11615117 Ga0105238_116151171 157
104 3300013104 Ga0157370_10125229 Ga0157370_101252292 157
105 3300013104 Ga0157370_10243007 Ga0157370_102430071 157
106 3300013296 Ga0157374_11494653 Ga0157374_114946532 157
107 3300013297 Ga0157378_10883160 Ga0157378_108831602 157
108 3300013297 Ga0157378_12363098 Ga0157378_123630981 157
109 3300013306 Ga0163162_10388213 Ga0163162_103882132 157
110 3300013307 Ga0157372_10100449 Ga0157372_101004494 157
111 3300013307 Ga0157372_10457264 Ga0157372_104572642 157
112 3300013307 Ga0157372_10582330 Ga0157372_105823302 157
113 3300013308 Ga0157375_10384247 Ga0157375_103842472 157
114 3300013308 Ga0157375_10778602 Ga0157375_107786022 157
115 3300014325 Ga0163163_10000211 Ga0163163_1000021111 157
116 3300014326 Ga0157380_11244829 Ga0157380_112448291 157
117 3300014968 Ga0157379_10438565 Ga0157379_104385652 157
118 3300014969 Ga0157376_11387179 Ga0157376_113871791 157
119 3300025885 Ga0207653_10329407 Ga0207653_103294071 157
120 3300025909 Ga0207705_10162688 Ga0207705_101626882 157
121 3300025909 Ga0207705_10491828 Ga0207705_104918282 157
122 3300025912 Ga0207707_10113748 Ga0207707_101137482 157
123 3300025912 Ga0207707_10511603 Ga0207707_105116032 157
124 3300025913 Ga0207695_10082251 Ga0207695_100822514 157
125 3300025913 Ga0207695_10235642 Ga0207695_102356421 157
126 3300025916 Ga0207663_10137163 Ga0207663_101371632 157
127 3300025916 Ga0207663_10353061 Ga0207663_103530612 157
128 3300025917 Ga0207660_10079532 Ga0207660_100795322 157
129 3300025918 Ga0207662_10270427 Ga0207662_102704272 157
130 3300025921 Ga0207652_10127153 Ga0207652_101271532 157
131 3300025921 Ga0207652_10661815 Ga0207652_106618152 157
132 3300025924 Ga0207694_10057318 Ga0207694_100573183 157
133 3300025924 Ga0207694_10107620 Ga0207694_101076202 157
134 3300025924 Ga0207694_10719700 Ga0207694_107197001 157
135 3300025925 Ga0207650_10731963 Ga0207650_107319632 157
136 3300025929 Ga0207664_10048918 Ga0207664_100489182 157
137 3300025936 Ga0207670_10236652 Ga0207670_102366521 157
138 3300025936 Ga0207670_10921800 Ga0207670_109218001 157
139 3300025938 Ga0207704_11416125 Ga0207704_114161251 157
140 3300025941 Ga0207711_11084251 Ga0207711_110842511 157
141 3300025949 Ga0207667_10003649 Ga0207667_100036499 157
142 3300025949 Ga0207667_10028120 Ga0207667_100281203 157
143 3300025949 Ga0207667_11096682 Ga0207667_110966821 157
144 3300025960 Ga0207651_10772530 Ga0207651_107725302 157
145 3300026035 Ga0207703_10241506 Ga0207703_102415062 157
146 3300026041 Ga0207639_11438901 Ga0207639_114389011 157
147 3300026078 Ga0207702_10001107 Ga0207702_100011079 157
148 3300026078 Ga0207702_10018780 Ga0207702_100187805 157
149 3300026078 Ga0207702_10134112 Ga0207702_101341122 157
150 3300026116 Ga0207674_10125796 Ga0207674_101257962 157
151 3300026116 Ga0207674_10980197 Ga0207674_109801972 157
152 3300026118 Ga0207675_100483221 Ga0207675_1004832213 157
153 3300028556 Ga0265337_1000847 Ga0265337_10008472 157
154 3300028556 Ga0265337_1002727 Ga0265337_10027275 157
155 3300028556 Ga0265337_1003374 Ga0265337_10033742 157
156 3300028556 Ga0265337_1011484 Ga0265337_10114844 157
157 3300028556 Ga0265337_1015373 Ga0265337_10153735 157
158 3300028556 Ga0265337_1022724 Ga0265337_10227243 157
159 3300028556 Ga0265337_1032530 Ga0265337_10325302 157
160 3300028556 Ga0265337_1038716 Ga0265337_10387162 157
161 3300028556 Ga0265337_1065510 Ga0265337_10655101 157
162 3300028558 Ga0265326_10001485 Ga0265326_100014858 157
163 3300028558 Ga0265326_10026862 Ga0265326_100268622 157
164 3300028558 Ga0265326_10038719 Ga0265326_100387192 157
165 3300028558 Ga0265326_10135316 Ga0265326_101353161 157
166 3300028558 Ga0265326_10163124 Ga0265326_101631241 157
167 3300028563 Ga0265319_1000004 Ga0265319_1000004277 157
168 3300028563 Ga0265319_1025854 Ga0265319_10258541 157
169 3300028563 Ga0265319_1028279 Ga0265319_10282792 157
170 3300028563 Ga0265319_1052692 Ga0265319_10526922 157
171 3300028563 Ga0265319_1209101 Ga0265319_12091011 157
172 3300028573 Ga0265334_10013313 Ga0265334_100133132 157
173 3300028577 Ga0265318_10158742 Ga0265318_101587422 157
174 3300028653 Ga0265323_10000140 Ga0265323_1000014031 157
175 3300028653 Ga0265323_10005091 Ga0265323_100050917 157
176 3300028653 Ga0265323_10006619 Ga0265323_100066192 157
177 3300028653 Ga0265323_10022280 Ga0265323_100222802 157
178 3300028654 Ga0265322_10019174 Ga0265322_100191743 157
179 3300028654 Ga0265322_10040080 Ga0265322_100400802 157
180 3300028654 Ga0265322_10047770 Ga0265322_100477701 157
181 3300028654 Ga0265322_10128176 Ga0265322_101281761 157
182 3300028666 Ga0265336_10002944 Ga0265336_100029443 157
183 3300028666 Ga0265336_10023018 Ga0265336_100230181 157
184 3300028666 Ga0265336_10043347 Ga0265336_100433472 157
185 3300028666 Ga0265336_10076123 Ga0265336_100761232 157
186 3300028800 Ga0265338_10000070 Ga0265338_10000070135 157
187 3300028800 Ga0265338_10000084 Ga0265338_1000008416 157
188 3300028800 Ga0265338_10000111 Ga0265338_1000011150 157
189 3300028800 Ga0265338_10000208 Ga0265338_10000208115 157
190 3300028800 Ga0265338_10000616 Ga0265338_1000061616 157
191 3300028800 Ga0265338_10003109 Ga0265338_100031093 157
192 3300028800 Ga0265338_10004875 Ga0265338_1000487519 157
193 3300028800 Ga0265338_10005089 Ga0265338_100050893 157
194 3300028800 Ga0265338_10005565 Ga0265338_100055655 157
195 3300028800 Ga0265338_10006543 Ga0265338_1000654315 157
196 3300028800 Ga0265338_10008700 Ga0265338_100087006 157
197 3300028800 Ga0265338_10019398 Ga0265338_100193987 157
198 3300028800 Ga0265338_10036180 Ga0265338_100361805 157
199 3300028800 Ga0265338_10036220 Ga0265338_100362202 157
200 3300028800 Ga0265338_10048800 Ga0265338_100488002 157
201 3300028800 Ga0265338_10059400 Ga0265338_100594003 157
202 3300028800 Ga0265338_10061161 Ga0265338_100611614 157
203 3300028800 Ga0265338_10096202 Ga0265338_100962022 157
204 3300028800 Ga0265338_10109326 Ga0265338_101093262 157
205 3300028800 Ga0265338_10147576 Ga0265338_101475761 157
206 3300028800 Ga0265338_10154163 Ga0265338_101541632 157
207 3300028800 Ga0265338_10177956 Ga0265338_101779565 157
208 3300028800 Ga0265338_10261876 Ga0265338_102618763 157
209 3300028800 Ga0265338_10365682 Ga0265338_103656822 157
210 3300028800 Ga0265338_10404635 Ga0265338_104046352 157
211 3300028800 Ga0265338_10454609 Ga0265338_104546091 157
212 3300028800 Ga0265338_10467445 Ga0265338_104674451 157
213 3300028800 Ga0265338_10682144 Ga0265338_106821442 157
214 3300029957 Ga0265324_10000939 Ga0265324_1000093910 157
215 3300029957 Ga0265324_10007656 Ga0265324_100076565 157
216 3300029957 Ga0265324_10011487 Ga0265324_100114872 157
217 3300029957 Ga0265324_10025597 Ga0265324_100255972 157
218 3300029957 Ga0265324_10063545 Ga0265324_100635452 157
219 3300029957 Ga0265324_10064916 Ga0265324_100649161 157
220 3300029957 Ga0265324_10067579 Ga0265324_100675792 157
221 3300029957 Ga0265324_10162235 Ga0265324_101622352 157
222 3300029957 Ga0265324_10297489 Ga0265324_102974891 157
223 3300031238 Ga0265332_10039819 Ga0265332_100398192 157
224 3300031239 Ga0265328_10049568 Ga0265328_100495681 157
225 3300031240 Ga0265320_10000551 Ga0265320_1000055114 157
226 3300031240 Ga0265320_10001912 Ga0265320_1000191211 157
227 3300031240 Ga0265320_10003522 Ga0265320_100035223 157
228 3300031240 Ga0265320_10020573 Ga0265320_100205733 157
229 3300031240 Ga0265320_10039515 Ga0265320_100395154 157
230 3300031240 Ga0265320_10085177 Ga0265320_100851771 157
231 3300031240 Ga0265320_10147530 Ga0265320_101475301 157
232 3300031241 Ga0265325_10031549 Ga0265325_100315491 157
233 3300031247 Ga0265340_10001551 Ga0265340_1000155110 157
234 3300031247 Ga0265340_10054582 Ga0265340_100545821 157
235 3300031247 Ga0265340_10222240 Ga0265340_102222401 157
236 3300031249 Ga0265339_10031067 Ga0265339_100310672 157
237 3300031249 Ga0265339_10069664 Ga0265339_100696642 157
238 3300031249 Ga0265339_10306343 Ga0265339_103063431 157
239 3300031249 Ga0265339_10556160 Ga0265339_105561601 157
240 3300031250 Ga0265331_10245194 Ga0265331_102451941 157
241 3300031251 Ga0265327_10000634 Ga0265327_1000063441 157
242 3300031251 Ga0265327_10159536 Ga0265327_101595361 157
243 3300031344 Ga0265316_10009212 Ga0265316_100092128 157
244 3300031344 Ga0265316_10029540 Ga0265316_100295404 157
245 3300031344 Ga0265316_10055762 Ga0265316_100557622 157
246 3300031344 Ga0265316_10142776 Ga0265316_101427762 157
247 3300031344 Ga0265316_10325316 Ga0265316_103253162 157
248 3300031344 Ga0265316_10408351 Ga0265316_104083511 157
249 3300031344 Ga0265316_10835845 Ga0265316_108358451 157
250 3300031507 Ga0307509_10379381 Ga0307509_103793812 157
251 3300031595 Ga0265313_10000385 Ga0265313_1000038521 157
252 3300031595 Ga0265313_10015182 Ga0265313_100151823 157
253 3300031711 Ga0265314_10056361 Ga0265314_100563612 157
254 3300031711 Ga0265314_10269171 Ga0265314_102691712 157
255 3300031711 Ga0265314_10463879 Ga0265314_104638792 157
256 3300031712 Ga0265342_10083542 Ga0265342_100835422 157
257 3300031712 Ga0265342_10089478 Ga0265342_100894782 157
258 3300031712 Ga0265342_10124876 Ga0265342_101248762 157
259 3300031712 Ga0265342_10517255 Ga0265342_105172551 157
260 3300034816 Ga0373930_0003785 Ga0373930_0003785_1279_1755 157
261 3300035084 Ga0373928_0000004 Ga0373928_0000004_38729_39205 157
262 3300035089 Ga0373944_0008707 Ga0373944_0008707_508_984 157
263 3300035090 Ga0373949_0002066 Ga0373949_0002066_2756_3232 157
264 3300035112 Ga0373932_0000001 Ga0373932_0000001_905231_905707 157
265 3300035117 Ga0373953_0271413 Ga0373953_0271413_156_629 157
266 3300035118 Ga0373954_0051710 Ga0373954_0051710_459_932 157
267 3300035119 Ga0373956_0017790 Ga0373956_0017790_1803_2276 157
268 3300035170 Ga0373943_0155952 Ga0373943_0155952_158_634 157
269 3300035172 Ga0373955_0235031 Ga0373955_0235031_285_812 157
270 3300035242 Ga0373962_0000254 Ga0373962_0000254_1911_2387 157
271 3300035398 Ga0316574_0344725 Ga0316574_0344725_223_702 157
272 3300035691 Ga0373931_0000002 Ga0373931_0000002_589691_590167 157
273 3300035691 Ga0373931_0274178 Ga0373931_0274178_139_612 157
274 3300035692 Ga0373935_0100128 Ga0373935_0100128_758_1234 157
275 3300035692 Ga0373935_0635649 Ga0373935_0635649_190_663 157
276 3300035695 Ga0373927_0002484 Ga0373927_0002484_8879_9355 157
277 3300035695 Ga0373927_0339810 Ga0373927_0339810_419_892 157
278 3300035724 Ga0373933_0494273 Ga0373933_0494273_20_493 157
279 3300035725 Ga0373947_0217826 Ga0373947_0217826_277_753 157
280 3300036401 Ga0373937_0026632 Ga0373937_0026632_1402_1875 157
281 3300036401 Ga0373937_0718444 Ga0373937_0718444_134_607 157
282 3300036647 Ga0316582_0235729 Ga0316582_0235729_640_1119 157
283 3300037068 Ga0373925_0000077 Ga0373925_0000077_45912_46388 157
284 3300041452 Ga0451793_0684306 Ga0451793_0684306_189_662 157
285 3300041458 Ga0451798_0314004 Ga0451798_0314004_59_532 157
286 3300041458 Ga0451798_1068640 Ga0451798_1068640_14_487 157
287 3300041486 Ga0451807_0297416 Ga0451807_0297416_104_577 157
288 3300041505 Ga0451849_1288056 Ga0451849_1288056_69_542 157
289 3300042876 Ga0451577_0052529 Ga0451577_0052529_1957_2430 157
290 3300042876 Ga0451577_0475959 Ga0451577_0475959_329_802 157
291 3300042876 Ga0451577_1007791 Ga0451577_1007791_174_647 157
292 3300044712 Ga0453684_0002150 Ga0453684_0002150_41641_42114 157
293 3300044712 Ga0453684_0114653 Ga0453684_0114653_406_879 157
294 3300044712 Ga0453684_0132002 Ga0453684_0132002_915_1388 157
295 3300044712 Ga0453684_0512749 Ga0453684_0512749_602_1075 157
296 3300045051 Ga0451576_0233651 Ga0451576_0233651_992_1465 157
297 3300045051 Ga0451576_0727909 Ga0451576_0727909_156_629 157
298 3300045051 Ga0451576_1033399 Ga0451576_1033399_124_597 157
299 3300046454 Ga0495592_0135301 Ga0495592_0135301_357_830 157
300 3300046462 Ga0495651_0327938 Ga0495651_0327938_143_628 157
301 3300046476 Ga0495662_0415565 Ga0495662_0415565_153_626 157
302 3300046477 Ga0495664_0261853 Ga0495664_0261853_213_686 157
303 3300046514 Ga0495618_0000968 Ga0495618_0000968_7503_7976 157
304 3300046514 Ga0495618_0338728 Ga0495618_0338728_257_784 157
305 3300046516 Ga0495628_0302857 Ga0495628_0302857_297_770 157
306 3300046517 Ga0495630_0193088 Ga0495630_0193088_938_1411 157
307 3300046533 Ga0495640_0080516 Ga0495640_0080516_319_846 157
308 3300046533 Ga0495640_0294565 Ga0495640_0294565_341_814 157
309 3300046535 Ga0495586_0018839 Ga0495586_0018839_236_709 157
310 3300046535 Ga0495586_0027307 Ga0495586_0027307_2099_2572 157
311 3300046535 Ga0495586_0213574 Ga0495586_0213574_107_580 157
312 3300046536 Ga0495587_0367631 Ga0495587_0367631_135_608 157
313 3300046543 Ga0495645_0248638 Ga0495645_0248638_634_1119 157
314 3300046543 Ga0495645_0508699 Ga0495645_0508699_10_483 157
315 3300046543 Ga0495645_0598594 Ga0495645_0598594_121_594 157
316 3300046559 Ga0495667_0029599 Ga0495667_0029599_2948_3421 157
317 3300046559 Ga0495667_0066109 Ga0495667_0066109_1220_1693 157
318 3300046642 Ga0495634_0002583 Ga0495634_0002583_6171_6644 157
319 3300046675 Ga0495657_0109553 Ga0495657_0109553_796_1269 157
320 3300046678 Ga0495599_0569555 Ga0495599_0569555_177_650 157
321 3300046689 Ga0495613_0002225 Ga0495613_0002225_7368_7841 157
322 3300046689 Ga0495613_0665326 Ga0495613_0665326_91_564 157
323 3300046809 Ga0495600_0814238 Ga0495600_0814238_12_485 157
324 3300047318 Ga0495636_0226204 Ga0495636_0226204_274_747 157
325 3300047319 Ga0495674_0467876 Ga0495674_0467876_335_808 157
326 3300047319 Ga0495674_1043634 Ga0495674_1043634_113_586 157
327 3300047321 Ga0495676_0571632 Ga0495676_0571632_103_576 157
328 3300047322 Ga0495680_0003659 Ga0495680_0003659_3078_3551 157
329 3300047471 Ga0495684_0503385 Ga0495684_0503385_132_605 157
330 3300048918 Ga0496115_0792631 Ga0496115_0792631_81_554 157
331 3300049568 Ga0501031_0000569 Ga0501031_0000569_20500_20973 157
332 3300049569 Ga0501032_0004203 Ga0501032_0004203_5979_6452 157
333 3300049569 Ga0501032_0112691 Ga0501032_0112691_143_619 157
334 3300049570 Ga0501033_0044587 Ga0501033_0044587_2499_2975 157
335 3300049570 Ga0501033_0168978 Ga0501033_0168978_998_1471 157
336 3300049572 Ga0501036_0294463 Ga0501036_0294463_675_1151 157
337 3300049573 Ga0501037_0256288 Ga0501037_0256288_261_737 157
338 3300049579 Ga0501043_0394553 Ga0501043_0394553_286_762 157
339 3300049581 Ga0501047_0086778 Ga0501047_0086778_1746_2222 157
340 3300049581 Ga0501047_0470614 Ga0501047_0470614_469_945 157
341 3300049582 Ga0501048_1216578 Ga0501048_1216578_52_528 157
342 3300049742 Ga0501080_0126281 Ga0501080_0126281_1168_1644 157
343 3300049744 Ga0501083_0002953 Ga0501083_0002953_7953_8426 157
344 3300049822 Ga0501035_0010225 Ga0501035_0010225_5353_5826 157
345 3300049822 Ga0501035_0151151 Ga0501035_0151151_1159_1635 157
346 3300049823 Ga0501044_0000823 Ga0501044_0000823_29972_30445 157
347 3300049823 Ga0501044_0038246 Ga0501044_0038246_1046_1522 157
348 3300049823 Ga0501044_0977229 Ga0501044_0977229_108_638 157
349 3300049823 Ga0501044_1204038 Ga0501044_1204038_115_588 157
350 3300050507 nmdc:mga05p37_666181_c1 nmdc:mga05p37_666181_c1_458_931 157
351 3300050508 nmdc:mga09592_176115_c1 nmdc:mga09592_176115_c1_1064_1537 157
352 3300050511 nmdc:mga08y16_23816_c1 nmdc:mga08y16_23816_c1_4687_5160 157
353 3300050511 nmdc:mga08y16_518406_c1 nmdc:mga08y16_518406_c1_10_483 157
354 3300050512 nmdc:mga0n895_943892_c1 nmdc:mga0n895_943892_c1_332_805 157
355 3300053093 Ga0500651_0410038 Ga0500651_0410038_57_530 157

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10369

ALS_ss_C

Small subunit of acetolactate synthase

105

178

0.99

PF01842

ACT

ACT domain

23

89

0.98

PF13710

ACT_5

ACT domain

31

93

0.98

PF22629

AHAS-like_ACT

AHAS-like ACT domain

25

92

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6u9h-assembly1.cif.gz_G arabidopsis thaliana acetohydroxyacid synthase complex 0.9341 2 157
2f1f-assembly1.cif.gz_A crystal structure of the regulatory subunit of acetohydroxyacid synthase isozyme iii from e. coli 0.9235 1 157
6u9h-assembly1.cif.gz_G arabidopsis thaliana acetohydroxyacid synthase complex 0.9229 2 157
2fgc-assembly1.cif.gz_A-2 crystal structure of acetolactate synthase- small subunit from thermotoga maritima 0.9183 1 157
2f1f-assembly1.cif.gz_A crystal structure of the regulatory subunit of acetohydroxyacid synthase isozyme iii from e. coli 0.918 1 157
ID Description Score Start End Superfamily
af_P9WKJ3_86_164_3.30.70.1150 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT-like. Chain A, domain 2 0.9749 84 157 3.30.70.1150
af_P25605_75_154_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9624 2 76 3.30.70.260
af_Q57625_89_166_3.30.70.1150 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT-like. Chain A, domain 2 0.9603 84 157 3.30.70.1150
af_Q93YZ7_400_477_3.30.70.1150 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT-like. Chain A, domain 2 0.9516 84 157 3.30.70.1150
2fgdA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT-like. Chain A, domain 2 0.9429 81 156 3.30.70.1150
ID Description Score Start End GO Terms
AF-A0A522JBU8-F1-model_v4 Acetolactate synthase small subunit (AHAS) (ALS) (EC 2.2.1.6) (Acetohydroxy-acid synthase small subunit) 0.9813 1 79 GO:0003984
GO:0005829
GO:0009097
GO:0009099
GO:1990610
AF-A0A550HI48-F1-model_v4 Acetolactate synthase small subunit C-terminal domain-containing protein 0.9677 81 157 GO:0003984
GO:0005829
GO:0009097
GO:0009099
GO:1990610
AF-A0A3C0YS73-F1-model_v4 Acetolactate synthase small subunit (AHAS) (ALS) (EC 2.2.1.6) (Acetohydroxy-acid synthase small subunit) 0.9657 84 157 GO:0003984
GO:0005829
GO:0009097
GO:0009099
GO:1990610
AF-A0A1L5KZ17-F1-model_v4 Acetolactate synthase small subunit (AHAS) (ALS) (EC 2.2.1.6) (Acetohydroxy-acid synthase small subunit) 0.96 1 79 GO:0003984
GO:0005829
GO:0009097
GO:0009099
GO:1990610
AF-A0A4U7EZ41-F1-model_v4 Acetolactate synthase small subunit (AHAS) (ALS) (EC 2.2.1.6) (Acetohydroxy-acid synthase small subunit) 0.96 1 79 GO:0003984
GO:0005829
GO:0009097
GO:0009099
GO:1990610

Feature Viewer

pLDDT pTM Quality
89.03 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map