F420035

General Info

Members Datasets Scaffolds Average Seq Length
355 191 355 136

Family's Representative Sequence

Representative Sequence 3300005441|Ga0070700_100267424|Ga0070700_1002674242
Length 160
Sequence VPPFLRTPCPPKLTWIFGAKVGNIRGVGDHIFFYGTLMAPFNRPGRQRITPKLIYKGRGTIRAALFDLGIYPAAIPADDDSLVWGEVYETSEPAAVLAALDEIEGYRPNEPDRSLYLRVLVDATLEDGRLEKAWAYFYNAPLGGAQRITSGDYLDHLSAR

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
125 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
131 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
132 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
133 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
134 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
138 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
139 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
140 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
141 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
142 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
143 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
144 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
145 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
146 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
147 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
150 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
151 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
152 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
153 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
154 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
155 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
156 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
157 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
158 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
159 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
160 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
161 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
162 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
170 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
171 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
172 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
173 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
174 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
175 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
176 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
179 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
180 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
181 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
182 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
183 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
184 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
185 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
186 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
187 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
188 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
189 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
191 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.13
Nodule 0
Rhizoplane 0.85
Rhizosphere 98.03
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_5922638 2162886012 Bacteria 830
2 Ga0065704_10003830 3300005289 Bacteria 4032
3 Ga0065715_10129179 3300005293 Unclassified 2050
4 Ga0065715_10489567 3300005293 Unclassified 789
5 Ga0065707_10618364 3300005295 Bacteria 680
6 Ga0070676_10081005 3300005328 Bacteria 1969
7 Ga0070690_100051862 3300005330 Bacteria 2620
8 Ga0070670_100575554 3300005331 Unclassified 1006
9 Ga0070677_10066143 3300005333 Bacteria 1506
10 Ga0068869_100096783 3300005334 Bacteria 2228
11 Ga0068869_100264581 3300005334 Bacteria 1378
12 Ga0070680_100394466 3300005336 Unclassified 1179
13 Ga0068868_100628076 3300005338 Unclassified 954
14 Ga0070689_100017380 3300005340 Bacteria 5281
15 Ga0070689_100348535 3300005340 Bacteria 1241
16 Ga0070687_100011315 3300005343 Bacteria 3900
17 Ga0070687_100309973 3300005343 Bacteria 1004
18 Ga0070661_100058411 3300005344 Unclassified 2827
19 Ga0070692_10055446 3300005345 Unclassified 2072
20 Ga0070668_100162065 3300005347 Bacteria 1815
21 Ga0070669_100003055 3300005353 Bacteria 12035
22 Ga0070675_100042329 3300005354 Bacteria 3721
23 Ga0070675_100066140 3300005354 Unclassified 2989
24 Ga0070675_100634795 3300005354 Bacteria 970
25 Ga0070671_100026331 3300005355 Bacteria 4778
26 Ga0070674_100848890 3300005356 Bacteria 792
27 Ga0070673_100315780 3300005364 Bacteria 1379
28 Ga0070673_100363916 3300005364 Unclassified 1286
29 Ga0070688_100032350 3300005365 Bacteria 3152
30 Ga0070688_100392018 3300005365 Bacteria 1026
31 Ga0070667_101206213 3300005367 Bacteria 708
32 Ga0070714_100001306 3300005435 Bacteria 17997
33 Ga0070713_100131065 3300005436 Bacteria 2211
34 Ga0070701_10073991 3300005438 Bacteria 1829
35 Ga0070701_10142775 3300005438 Unclassified 1371
36 Ga0070701_10223728 3300005438 Unclassified 1123
37 Ga0070701_10404829 3300005438 Bacteria 865
38 Ga0070705_100269378 3300005440 Bacteria 1205
39 Ga0070705_100490770 3300005440 Bacteria 930
40 Ga0070705_101372283 3300005440 Bacteria 588
41 Ga0070700_100006115 3300005441 Bacteria 6414
42 Ga0070700_100006689 3300005441 Bacteria 6175
43 Ga0070700_100267424 3300005441 Bacteria 1234
44 Ga0070694_100004051 3300005444 Bacteria 8779
45 Ga0070694_100178357 3300005444 Bacteria 1570
46 Ga0070694_100260310 3300005444 Unclassified 1316
47 Ga0070694_100583444 3300005444 Bacteria 899
48 Ga0070694_100758498 3300005444 Bacteria 793
49 Ga0070708_100139451 3300005445 Bacteria 2248
50 Ga0070662_100165931 3300005457 Unclassified 1730
51 Ga0070681_10565988 3300005458 Bacteria 1050
52 Ga0068867_100002507 3300005459 Bacteria 12913
53 Ga0068867_100485180 3300005459 Bacteria 1060
54 Ga0070706_100193171 3300005467 Bacteria 1902
55 Ga0070707_100452116 3300005468 Unclassified 1245
56 Ga0070707_100512323 3300005468 Unclassified 1162
57 Ga0070707_101073026 3300005468 Unclassified 771
58 Ga0070698_100022995 3300005471 Bacteria 6518
59 Ga0070699_100001230 3300005518 Bacteria 23625
60 Ga0070699_100015643 3300005518 Bacteria 6517
61 Ga0070699_100063966 3300005518 Unclassified 3190
62 Ga0070697_100152436 3300005536 Unclassified 1949
63 Ga0070697_100199578 3300005536 Unclassified 1700
64 Ga0070697_100368431 3300005536 Bacteria 1243
65 Ga0068853_100327966 3300005539 Bacteria 1420
66 Ga0070672_100292908 3300005543 Bacteria 1378
67 Ga0070695_100020198 3300005545 Bacteria 4066
68 Ga0070695_100228323 3300005545 Unclassified 1344
69 Ga0070695_100416903 3300005545 Bacteria 1021
70 Ga0070696_100210517 3300005546 Bacteria 1455
71 Ga0070704_100001808 3300005549 Bacteria 11768
72 Ga0070704_100087811 3300005549 Unclassified 2309
73 Ga0070704_100232577 3300005549 Bacteria 1504
74 Ga0070704_101628796 3300005549 Unclassified 595
75 Ga0070664_100248096 3300005564 Unclassified 1600
76 Ga0070664_100565395 3300005564 Bacteria 1052
77 Ga0068857_100049868 3300005577 Bacteria 3714
78 Ga0068857_100073702 3300005577 Unclassified 3042
79 Ga0068854_100534215 3300005578 Bacteria 992
80 Ga0070702_100974499 3300005615 Unclassified 669
81 Ga0068852_100333762 3300005616 Bacteria 1476
82 Ga0068859_100006982 3300005617 Bacteria 11465
83 Ga0068859_100008268 3300005617 Bacteria 10550
84 Ga0068859_100340745 3300005617 Unclassified 1593
85 Ga0068859_100364147 3300005617 Unclassified 1541
86 Ga0068864_100053149 3300005618 Bacteria 3493
87 Ga0068864_100359733 3300005618 Bacteria 1375
88 Ga0068864_100725410 3300005618 Bacteria 972
89 Ga0068861_100007509 3300005719 Bacteria 7474
90 Ga0068861_100284706 3300005719 Unclassified 1425
91 Ga0068861_101315942 3300005719 Unclassified 703
92 Ga0068870_10003756 3300005840 Bacteria 6459
93 Ga0068870_10059541 3300005840 Unclassified 2047
94 Ga0068870_10236741 3300005840 Bacteria 1125
95 Ga0068863_100038334 3300005841 Bacteria 4560
96 Ga0068858_100224619 3300005842 Bacteria 1779
97 Ga0068860_100441636 3300005843 Bacteria 1292
98 Ga0068862_100000454 3300005844 Bacteria 44332
99 Ga0068862_100334941 3300005844 Unclassified 1400
100 Ga0081539_10008972 3300005985 Bacteria 8508
101 Ga0081539_10190263 3300005985 Bacteria 956
102 Ga0075432_10065058 3300006058 Bacteria 1303
103 Ga0070712_100200522 3300006175 Unclassified 1567
104 Ga0075367_10065943 3300006178 Unclassified 2169
105 Ga0097621_100245503 3300006237 Bacteria 1566
106 Ga0097621_101385088 3300006237 Unclassified 666
107 Ga0068871_100623209 3300006358 Bacteria 983
108 Ga0068871_101150891 3300006358 Unclassified 727
109 Ga0075428_100018555 3300006844 Bacteria 7689
110 Ga0075428_100295582 3300006844 Bacteria 1742
111 Ga0075428_100507371 3300006844 Bacteria 1290
112 Ga0075428_100988938 3300006844 Bacteria 891
113 Ga0075428_102697238 3300006844 Unclassified 506
114 Ga0075430_100009513 3300006846 Bacteria 8216
115 Ga0075430_100341946 3300006846 Bacteria 1236
116 Ga0075430_100634534 3300006846 Bacteria 881
117 Ga0075431_100035784 3300006847 Bacteria 5112
118 Ga0075431_100502754 3300006847 Bacteria 1203
119 Ga0075431_101668495 3300006847 Bacteria 594
120 Ga0075434_100041430 3300006871 Bacteria 4563
121 Ga0075429_100079674 3300006880 Bacteria 2855
122 Ga0075429_100190086 3300006880 Bacteria 1799
123 Ga0075429_100440608 3300006880 Unclassified 1142
124 Ga0075436_100010185 3300006914 Bacteria 6438
125 Ga0075436_100353650 3300006914 Bacteria 1059
126 Ga0075436_100438837 3300006914 Unclassified 949
127 Ga0075436_101337536 3300006914 Unclassified 542
128 Ga0097620_100006981 3300006931 Bacteria 11465
129 Ga0097620_100008268 3300006931 Bacteria 10550
130 Ga0097620_100340762 3300006931 Unclassified 1593
131 Ga0097620_100364187 3300006931 Unclassified 1541
132 Ga0075435_100009639 3300007076 Bacteria 7009
133 Ga0075435_100142659 3300007076 Unclassified 2010
134 Ga0075435_100419894 3300007076 Bacteria 1152
135 Ga0105240_10003905 3300009093 Bacteria 23022
136 Ga0111539_10022067 3300009094 Bacteria 7824
137 Ga0111539_10024058 3300009094 Bacteria 7481
138 Ga0111539_10449355 3300009094 Unclassified 1501
139 Ga0111539_10769553 3300009094 Unclassified 1120
140 Ga0111539_10940153 3300009094 Bacteria 1005
141 Ga0111539_11000502 3300009094 Bacteria 972
142 Ga0111539_11132499 3300009094 Unclassified 909
143 Ga0114129_10001867 3300009147 Bacteria 28697
144 Ga0114129_10008154 3300009147 Bacteria 14931
145 Ga0114129_10050236 3300009147 Bacteria 5858
146 Ga0114129_10060834 3300009147 Bacteria 5280
147 Ga0114129_10424306 3300009147 Bacteria 1749
148 Ga0114129_10436426 3300009147 Unclassified 1720
149 Ga0114129_10897155 3300009147 Bacteria 1123
150 Ga0105243_10130287 3300009148 Bacteria 2133
151 Ga0105243_10171792 3300009148 Bacteria 1878
152 Ga0105248_10061959 3300009177 Bacteria 4201
153 Ga0105248_10083057 3300009177 Bacteria 3604
154 Ga0105249_10004276 3300009553 Bacteria 12343
155 Ga0157374_11439009 3300013296 Unclassified 712
156 Ga0157378_10327805 3300013297 Bacteria 1489
157 Ga0157375_10000745 3300013308 Bacteria 28582
158 Ga0157375_10192622 3300013308 Bacteria 2194
159 Ga0157375_10202421 3300013308 Unclassified 2141
160 Ga0157375_11941842 3300013308 Unclassified 699
161 Ga0163163_11268384 3300014325 Unclassified 799
162 Ga0157380_10015118 3300014326 Bacteria 5665
163 Ga0157380_10025097 3300014326 Bacteria 4518
164 Ga0157380_10031061 3300014326 Bacteria 4098
165 Ga0157380_10041964 3300014326 Bacteria 3574
166 Ga0157380_10165323 3300014326 Bacteria 1927
167 Ga0157380_11069902 3300014326 Bacteria 844
168 Ga0157377_10110796 3300014745 Bacteria 1649
169 Ga0157377_11747970 3300014745 Unclassified 503
170 Ga0157379_11305396 3300014968 Unclassified 701
171 Ga0157376_10382778 3300014969 Bacteria 1356
172 Ga0163161_10255042 3300017792 Bacteria 1368
173 Ga0207682_10155840 3300025893 Bacteria 1032
174 Ga0207699_11181353 3300025906 Unclassified 567
175 Ga0207645_10057216 3300025907 Bacteria 2489
176 Ga0207643_10001631 3300025908 Bacteria 12621
177 Ga0207643_10068500 3300025908 Unclassified 2038
178 Ga0207684_10382550 3300025910 Bacteria 1210
179 Ga0207695_10013989 3300025913 Bacteria 9532
180 Ga0207693_10464399 3300025915 Unclassified 989
181 Ga0207662_10017137 3300025918 Bacteria 4096
182 Ga0207649_10079422 3300025920 Unclassified 2119
183 Ga0207646_10459095 3300025922 Unclassified 1149
184 Ga0207646_10603112 3300025922 Unclassified 985
185 Ga0207681_10008436 3300025923 Bacteria 6299
186 Ga0207650_11315787 3300025925 Unclassified 615
187 Ga0207659_10002077 3300025926 Bacteria 11861
188 Ga0207659_10056840 3300025926 Unclassified 2803
189 Ga0207659_10767495 3300025926 Bacteria 828
190 Ga0207700_10168625 3300025928 Bacteria 1824
191 Ga0207664_10372771 3300025929 Bacteria 1266
192 Ga0207644_10016089 3300025931 Bacteria 5030
193 Ga0207644_10105644 3300025931 Bacteria 2122
194 Ga0207706_10100044 3300025933 Bacteria 2551
195 Ga0207706_10880823 3300025933 Bacteria 757
196 Ga0207709_10056532 3300025935 Bacteria 2429
197 Ga0207670_10016195 3300025936 Bacteria 4474
198 Ga0207670_10018899 3300025936 Bacteria 4199
199 Ga0207691_10094546 3300025940 Unclassified 2674
200 Ga0207691_10132373 3300025940 Bacteria 2201
201 Ga0207691_10259058 3300025940 Bacteria 1499
202 Ga0207711_10214353 3300025941 Bacteria 1759
203 Ga0207711_11114706 3300025941 Unclassified 730
204 Ga0207679_10123685 3300025945 Unclassified 2064
205 Ga0207651_10048350 3300025960 Unclassified 2875
206 Ga0207712_10029981 3300025961 Bacteria 3654
207 Ga0207640_10231206 3300025981 Bacteria 1423
208 Ga0207677_10522034 3300026023 Bacteria 1030
209 Ga0207703_10743411 3300026035 Bacteria 934
210 Ga0207708_10014346 3300026075 Bacteria 5928
211 Ga0207708_10024325 3300026075 Bacteria 4581
212 Ga0207708_10251067 3300026075 Bacteria 1425
213 Ga0207708_10340945 3300026075 Bacteria 1227
214 Ga0207641_10192103 3300026088 Bacteria 1877
215 Ga0207641_10697354 3300026088 Bacteria 1000
216 Ga0207648_10000417 3300026089 Bacteria 46899
217 Ga0207648_10052202 3300026089 Bacteria 3574
218 Ga0207648_10107300 3300026089 Bacteria 2451
219 Ga0207676_10072116 3300026095 Unclassified 2775
220 Ga0207676_10330120 3300026095 Bacteria 1403
221 Ga0207674_10031639 3300026116 Bacteria 5555
222 Ga0207674_10031885 3300026116 Bacteria 5532
223 Ga0207674_10754894 3300026116 Bacteria 939
224 Ga0207675_100004237 3300026118 Bacteria 13868
225 Ga0207675_100045152 3300026118 Bacteria 4116
226 Ga0207675_100518177 3300026118 Bacteria 1188
227 Ga0207698_10128912 3300026142 Bacteria 2158
228 Ga0207428_10000350 3300027907 Bacteria 59657
229 Ga0207428_10006309 3300027907 Bacteria 10962
230 Ga0207428_10103773 3300027907 Bacteria 2194
231 Ga0207428_11057702 3300027907 Unclassified 568
232 Ga0268265_10000319 3300028380 Bacteria 53044
233 Ga0268264_10011940 3300028381 Bacteria 7152
234 Ga0307408_100156708 3300031548 Unclassified 1804
235 Ga0307406_10058482 3300031901 Bacteria 2478
236 Ga0307407_10181536 3300031903 Bacteria 1395
237 Ga0307409_100052447 3300031995 Bacteria 3127
238 Ga0307409_100095710 3300031995 Bacteria 2447
239 Ga0307409_100129392 3300031995 Bacteria 2154
240 Ga0307409_100449485 3300031995 Bacteria 1243
241 Ga0307409_102401167 3300031995 Bacteria 556
242 Ga0307416_100016769 3300032002 Bacteria 5104
243 Ga0307416_100665103 3300032002 Unclassified 1128
244 Ga0307416_102968957 3300032002 Bacteria 567
245 Ga0307411_10129679 3300032005 Unclassified 1841
246 Ga0307415_100268665 3300032126 Unclassified 1396
247 Ga0316585_10148661 3300032137 Unclassified 773
248 Ga0373958_0052861 3300034819 Unclassified 862
249 Ga0373939_0043232 3300035114 Bacteria 1366
250 Ga0373931_0065221 3300035691 Bacteria 1973
251 Ga0373935_0745113 3300035692 Bacteria 722
252 Ga0373937_0811909 3300036401 Bacteria 883
253 Ga0395901_1393208 3300038443 Bacteria 660
254 Ga0439453_0017168 3300041408 Bacteria 1269
255 Ga0451798_0697548 3300041458 Bacteria 514
256 Ga0451798_0733151 3300041458 Bacteria 776
257 Ga0451800_0336816 3300041459 Unclassified 550
258 Ga0439433_0001623 3300041999 Bacteria 4679
259 Ga0439462_0004668 3300042015 Bacteria 3352
260 Ga0450895_002548 3300042132 Bacteria 1361
261 Ga0450896_014755 3300042133 Bacteria 1116
262 Ga0439446_0167762 3300042156 Bacteria 729
263 Ga0439435_0134072 3300042436 Bacteria 785
264 Ga0439444_0062421 3300042437 Unclassified 781
265 Ga0439444_0109619 3300042437 Bacteria 634
266 Ga0439460_0009828 3300042461 Unclassified 2437
267 Ga0451576_0187188 3300045051 Bacteria 2162
268 Ga0451576_0262473 3300045051 Bacteria 1805
269 Ga0466967_0077092 3300045976 Unclassified 3000
270 Ga0495603_0069283 3300046455 Bacteria 2075
271 Ga0495603_0547043 3300046455 Bacteria 663
272 Ga0495580_0417925 3300046472 Unclassified 902
273 Ga0495594_0065517 3300046499 Bacteria 2015
274 Ga0495586_0143502 3300046535 Bacteria 1341
275 Ga0495598_0050261 3300046537 Unclassified 1253
276 Ga0495598_0194416 3300046537 Bacteria 730
277 Ga0495656_0144235 3300046615 Unclassified 1145
278 Ga0495659_0024511 3300046664 Unclassified 2058
279 Ga0495659_0045202 3300046664 Bacteria 1586
280 Ga0495659_0066485 3300046664 Bacteria 1343
281 Ga0495659_0221026 3300046664 Unclassified 782
282 Ga0495659_0445503 3300046664 Unclassified 563
283 Ga0495588_0085498 3300046674 Bacteria 1649
284 Ga0495647_0062118 3300046681 Unclassified 1477
285 Ga0495658_0520559 3300046683 Unclassified 761
286 Ga0495658_0676588 3300046683 Bacteria 661
287 Ga0495676_0716532 3300047321 Bacteria 647
288 Ga0501299_117701 3300049522 Unclassified 636
289 Ga0501033_0955449 3300049570 Unclassified 574
290 Ga0501033_1140263 3300049570 Bacteria 518
291 Ga0501039_0028176 3300049575 Bacteria 4322
292 Ga0501039_0164424 3300049575 Bacteria 1745
293 Ga0501040_1122727 3300049576 Unclassified 570
294 Ga0501041_0069449 3300049577 Bacteria 2161
295 Ga0501042_0035617 3300049578 Bacteria 3531
296 Ga0501042_1276310 3300049578 Bacteria 535
297 Ga0501042_1379461 3300049578 Unclassified 514
298 Ga0501046_0892103 3300049580 Bacteria 620
299 Ga0501048_0074551 3300049582 Unclassified 2394
300 Ga0501071_0016738 3300049587 Bacteria 5043
301 Ga0501071_0234633 3300049587 Bacteria 1383
302 Ga0501071_0443855 3300049587 Unclassified 993
303 Ga0501072_0157532 3300049588 Unclassified 1811
304 Ga0501075_0294562 3300049591 Unclassified 1236
305 Ga0501077_0244424 3300049593 Bacteria 1141
306 Ga0501077_0670527 3300049593 Bacteria 666
307 Ga0501077_1016896 3300049593 Unclassified 533
308 Ga0501081_0350670 3300049743 Bacteria 1088
309 Ga0501045_0205632 3300049824 Bacteria 1467
310 Ga0501045_1150108 3300049824 Unclassified 567
311 Ga0501045_1318047 3300049824 Bacteria 525
312 nmdc:mga03683_198348_c1 3300050489 Unclassified 920
313 nmdc:mga06z11_60206_c1 3300050494 Unclassified 1976
314 nmdc:mga05p37_280161_c1 3300050507 Unclassified 1989
315 nmdc:mga05p37_3639_c1 3300050507 Bacteria 18018
316 nmdc:mga05p37_588121_c1 3300050507 Bacteria 1259
317 nmdc:mga05p37_639674_c1 3300050507 Bacteria 1193
318 nmdc:mga05p37_64794_c1 3300050507 Bacteria 4496
319 nmdc:mga05p37_990221_c1 3300050507 Bacteria 894
320 nmdc:mga09592_142940_c1 3300050508 Bacteria 2063
321 nmdc:mga09592_339613_c1 3300050508 Bacteria 1300
322 nmdc:mga09592_986723_c1 3300050508 Unclassified 705
323 nmdc:mga0qj67_536600_c1 3300050509 Unclassified 939
324 nmdc:mga0qj67_573373_c1 3300050509 Unclassified 904
325 nmdc:mga0qj67_638015_c1 3300050509 Bacteria 850
326 nmdc:mga0qj67_6854_c1 3300050509 Bacteria 8377
327 nmdc:mga06r32_1704522_c1 3300050510 Bacteria 567
328 nmdc:mga06r32_329230_c1 3300050510 Bacteria 1512
329 nmdc:mga06r32_42335_c1 3300050510 Bacteria 4330
330 nmdc:mga06r32_771954_c1 3300050510 Bacteria 923
331 nmdc:mga08y16_1262723_c1 3300050511 Unclassified 707
332 nmdc:mga08y16_445749_c1 3300050511 Bacteria 1321
333 nmdc:mga08y16_500861_c1 3300050511 Unclassified 1234
334 nmdc:mga08y16_53964_c1 3300050511 Bacteria 4201
335 nmdc:mga08y16_879_c1 3300050511 Bacteria 28983
336 nmdc:mga0n895_1028741_c1 3300050512 Unclassified 804
337 nmdc:mga0n895_189901_c1 3300050512 Bacteria 2085
338 nmdc:mga0rr50_1677870_c1 3300050513 Unclassified 536
339 nmdc:mga0rr50_368044_c1 3300050513 Bacteria 1211
340 nmdc:mga0rr50_72830_c1 3300050513 Unclassified 2625
341 nmdc:mga08x19_318957_c1 3300050514 Bacteria 1081
342 nmdc:mga08x19_559349_c1 3300050514 Unclassified 809
343 nmdc:mga08x19_671067_c1 3300050514 Unclassified 735
344 nmdc:mga08x19_98114_c1 3300050514 Unclassified 1941
345 nmdc:mga0a205_168166_c1 3300050515 Unclassified 2088
346 Ga0500646_0130857 3300053090 Unclassified 815
347 Ga0501084_1485031 3300054114 Unclassified 567
348 Ga0590075_059105 3300059424 Bacteria 987
349 Ga0587086_029679 3300059507 Unclassified 797
350 Ga0501082_0082664 3300060353 Bacteria 2771
351 Ga0501082_1007745 3300060353 Unclassified 728
352 Ga0501082_1144497 3300060353 Bacteria 680
353 Ga0501082_1526931 3300060353 Unclassified 583
354 Ga0530510_0323168 3300061734 Bacteria 1157
355 Ga0530510_0488297 3300061734 Bacteria 933

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005435 Ga0070714_100001306 Ga0070714_1000013068 122
2 3300005436 Ga0070713_100131065 Ga0070713_1001310653 122
3 3300006914 Ga0075436_100438837 Ga0075436_1004388372 122
4 3300025928 Ga0207700_10168625 Ga0207700_101686252 122
5 3300031995 Ga0307409_100095710 Ga0307409_1000957103 122
6 3300036401 Ga0373937_0811909 Ga0373937_0811909_427_795 122
7 3300046664 Ga0495659_0445503 Ga0495659_0445503_165_542 122
8 3300005338 Ga0068868_100628076 Ga0068868_1006280762 123
9 3300005355 Ga0070671_100026331 Ga0070671_1000263313 123
10 3300005440 Ga0070705_100490770 Ga0070705_1004907702 123
11 3300005467 Ga0070706_100193171 Ga0070706_1001931711 123
12 3300005468 Ga0070707_100512323 Ga0070707_1005123232 123
13 3300005468 Ga0070707_101073026 Ga0070707_1010730262 123
14 3300005536 Ga0070697_100368431 Ga0070697_1003684312 123
15 3300005545 Ga0070695_100020198 Ga0070695_1000201984 123
16 3300005549 Ga0070704_100232577 Ga0070704_1002325772 123
17 3300005841 Ga0068863_100038334 Ga0068863_1000383342 123
18 3300006175 Ga0070712_100200522 Ga0070712_1002005222 123
19 3300006914 Ga0075436_100353650 Ga0075436_1003536502 123
20 3300007076 Ga0075435_100142659 Ga0075435_1001426592 123
21 3300025910 Ga0207684_10382550 Ga0207684_103825502 123
22 3300025922 Ga0207646_10603112 Ga0207646_106031122 123
23 3300025931 Ga0207644_10016089 Ga0207644_100160895 123
24 3300046615 Ga0495656_0144235 Ga0495656_0144235_162_536 123
25 3300046664 Ga0495659_0221026 Ga0495659_0221026_202_576 123
26 3300046472 Ga0495580_0417925 Ga0495580_0417925_14_412 131
27 3300046535 Ga0495586_0143502 Ga0495586_0143502_842_1240 131
28 3300050515 nmdc:mga0a205_168166_c1 nmdc:mga0a205_168166_c1_293_691 131
29 3300032137 Ga0316585_10148661 Ga0316585_101486611 132
30 3300005331 Ga0070670_100575554 Ga0070670_1005755542 133
31 3300005356 Ga0070674_100848890 Ga0070674_1008488902 133
32 3300005365 Ga0070688_100392018 Ga0070688_1003920182 133
33 3300005445 Ga0070708_100139451 Ga0070708_1001394512 133
34 3300005458 Ga0070681_10565988 Ga0070681_105659882 133
35 3300005468 Ga0070707_100452116 Ga0070707_1004521162 133
36 3300005518 Ga0070699_100001230 Ga0070699_10000123020 133
37 3300005518 Ga0070699_100015643 Ga0070699_1000156432 133
38 3300005536 Ga0070697_100152436 Ga0070697_1001524362 133
39 3300005536 Ga0070697_100199578 Ga0070697_1001995782 133
40 3300005546 Ga0070696_100210517 Ga0070696_1002105172 133
41 3300005549 Ga0070704_100087811 Ga0070704_1000878113 133
42 3300005615 Ga0070702_100974499 Ga0070702_1009744991 133
43 3300005616 Ga0068852_100333762 Ga0068852_1003337623 133
44 3300005985 Ga0081539_10008972 Ga0081539_100089728 133
45 3300006844 Ga0075428_100507371 Ga0075428_1005073712 133
46 3300006844 Ga0075428_102697238 Ga0075428_1026972381 133
47 3300006846 Ga0075430_100009513 Ga0075430_1000095135 133
48 3300006847 Ga0075431_100035784 Ga0075431_1000357844 133
49 3300006880 Ga0075429_100079674 Ga0075429_1000796744 133
50 3300006880 Ga0075429_100190086 Ga0075429_1001900862 133
51 3300006914 Ga0075436_100010185 Ga0075436_1000101855 133
52 3300007076 Ga0075435_100419894 Ga0075435_1004198942 133
53 3300009093 Ga0105240_10003905 Ga0105240_1000390514 133
54 3300009094 Ga0111539_11132499 Ga0111539_111324992 133
55 3300009147 Ga0114129_10008154 Ga0114129_100081546 133
56 3300009147 Ga0114129_10050236 Ga0114129_100502364 133
57 3300009147 Ga0114129_10060834 Ga0114129_100608345 133
58 3300014326 Ga0157380_10031061 Ga0157380_100310615 133
59 3300025906 Ga0207699_11181353 Ga0207699_111813531 133
60 3300025913 Ga0207695_10013989 Ga0207695_100139896 133
61 3300025926 Ga0207659_10767495 Ga0207659_107674952 133
62 3300025929 Ga0207664_10372771 Ga0207664_103727712 133
63 3300026142 Ga0207698_10128912 Ga0207698_101289123 133
64 3300031548 Ga0307408_100156708 Ga0307408_1001567083 133
65 3300031901 Ga0307406_10058482 Ga0307406_100584824 133
66 3300031995 Ga0307409_100129392 Ga0307409_1001293922 133
67 3300032002 Ga0307416_100016769 Ga0307416_1000167693 133
68 3300032002 Ga0307416_102968957 Ga0307416_1029689571 133
69 3300032126 Ga0307415_100268665 Ga0307415_1002686652 133
70 3300038443 Ga0395901_1393208 Ga0395901_1393208_78_482 133
71 3300042437 Ga0439444_0062421 Ga0439444_0062421_332_733 133
72 3300046537 Ga0495598_0050261 Ga0495598_0050261_472_888 133
73 3300049522 Ga0501299_117701 Ga0501299_117701_123_524 133
74 3300049575 Ga0501039_0028176 Ga0501039_0028176_74_481 133
75 3300049577 Ga0501041_0069449 Ga0501041_0069449_94_579 133
76 3300049578 Ga0501042_1276310 Ga0501042_1276310_90_497 133
77 3300049587 Ga0501071_0234633 Ga0501071_0234633_100_507 133
78 3300049593 Ga0501077_0244424 Ga0501077_0244424_551_958 133
79 3300050489 nmdc:mga03683_198348_c1 nmdc:mga03683_198348_c1_465_893 133
80 3300050507 nmdc:mga05p37_280161_c1 nmdc:mga05p37_280161_c1_1106_1522 133
81 3300050507 nmdc:mga05p37_3639_c1 nmdc:mga05p37_3639_c1_7154_7555 133
82 3300050507 nmdc:mga05p37_64794_c1 nmdc:mga05p37_64794_c1_3958_4359 133
83 3300050508 nmdc:mga09592_142940_c1 nmdc:mga09592_142940_c1_1369_1770 133
84 3300050508 nmdc:mga09592_986723_c1 nmdc:mga09592_986723_c1_171_572 133
85 3300050509 nmdc:mga0qj67_6854_c1 nmdc:mga0qj67_6854_c1_4326_4727 133
86 3300050510 nmdc:mga06r32_42335_c1 nmdc:mga06r32_42335_c1_1248_1649 133
87 3300050513 nmdc:mga0rr50_368044_c1 nmdc:mga0rr50_368044_c1_303_743 133
88 3300050514 nmdc:mga08x19_318957_c1 nmdc:mga08x19_318957_c1_248_649 133
89 3300050514 nmdc:mga08x19_98114_c1 nmdc:mga08x19_98114_c1_338_778 133
90 3300059507 Ga0587086_029679 Ga0587086_029679_112_513 133
91 3300060353 Ga0501082_0082664 Ga0501082_0082664_1020_1427 133
92 3300061734 Ga0530510_0323168 Ga0530510_0323168_86_493 133
93 3300005289 Ga0065704_10003830 Ga0065704_100038301 134
94 3300005293 Ga0065715_10129179 Ga0065715_101291793 134
95 3300005328 Ga0070676_10081005 Ga0070676_100810053 134
96 3300005330 Ga0070690_100051862 Ga0070690_1000518624 134
97 3300005334 Ga0068869_100264581 Ga0068869_1002645812 134
98 3300005336 Ga0070680_100394466 Ga0070680_1003944662 134
99 3300005340 Ga0070689_100017380 Ga0070689_1000173806 134
100 3300005343 Ga0070687_100011315 Ga0070687_1000113155 134
101 3300005344 Ga0070661_100058411 Ga0070661_1000584114 134
102 3300005345 Ga0070692_10055446 Ga0070692_100554463 134
103 3300005347 Ga0070668_100162065 Ga0070668_1001620654 134
104 3300005353 Ga0070669_100003055 Ga0070669_1000030553 134
105 3300005354 Ga0070675_100042329 Ga0070675_1000423293 134
106 3300005364 Ga0070673_100315780 Ga0070673_1003157802 134
107 3300005364 Ga0070673_100363916 Ga0070673_1003639163 134
108 3300005438 Ga0070701_10073991 Ga0070701_100739913 134
109 3300005438 Ga0070701_10142775 Ga0070701_101427752 134
110 3300005438 Ga0070701_10223728 Ga0070701_102237283 134
111 3300005438 Ga0070701_10404829 Ga0070701_104048292 134
112 3300005440 Ga0070705_100269378 Ga0070705_1002693782 134
113 3300005440 Ga0070705_101372283 Ga0070705_1013722831 134
114 3300005441 Ga0070700_100006115 Ga0070700_1000061157 134
115 3300005441 Ga0070700_100006689 Ga0070700_1000066894 134
116 3300005441 Ga0070700_100267424 Ga0070700_1002674242 134
117 3300005444 Ga0070694_100004051 Ga0070694_1000040515 134
118 3300005444 Ga0070694_100178357 Ga0070694_1001783572 134
119 3300005444 Ga0070694_100260310 Ga0070694_1002603102 134
120 3300005444 Ga0070694_100583444 Ga0070694_1005834442 134
121 3300005444 Ga0070694_100758498 Ga0070694_1007584982 134
122 3300005457 Ga0070662_100165931 Ga0070662_1001659312 134
123 3300005459 Ga0068867_100002507 Ga0068867_1000025072 134
124 3300005459 Ga0068867_100485180 Ga0068867_1004851802 134
125 3300005471 Ga0070698_100022995 Ga0070698_1000229956 134
126 3300005518 Ga0070699_100063966 Ga0070699_1000639662 134
127 3300005543 Ga0070672_100292908 Ga0070672_1002929083 134
128 3300005545 Ga0070695_100228323 Ga0070695_1002283231 134
129 3300005545 Ga0070695_100416903 Ga0070695_1004169031 134
130 3300005549 Ga0070704_100001808 Ga0070704_10000180810 134
131 3300005549 Ga0070704_101628796 Ga0070704_1016287962 134
132 3300005564 Ga0070664_100248096 Ga0070664_1002480962 134
133 3300005577 Ga0068857_100049868 Ga0068857_1000498684 134
134 3300005577 Ga0068857_100073702 Ga0068857_1000737023 134
135 3300005578 Ga0068854_100534215 Ga0068854_1005342152 134
136 3300005617 Ga0068859_100008268 Ga0068859_10000826813 134
137 3300005617 Ga0068859_100340745 Ga0068859_1003407452 134
138 3300005618 Ga0068864_100053149 Ga0068864_1000531494 134
139 3300005618 Ga0068864_100359733 Ga0068864_1003597332 134
140 3300005719 Ga0068861_100007509 Ga0068861_1000075094 134
141 3300005719 Ga0068861_100284706 Ga0068861_1002847063 134
142 3300005719 Ga0068861_101315942 Ga0068861_1013159421 134
143 3300005840 Ga0068870_10003756 Ga0068870_100037568 134
144 3300005840 Ga0068870_10059541 Ga0068870_100595412 134
145 3300005840 Ga0068870_10236741 Ga0068870_102367411 134
146 3300005842 Ga0068858_100224619 Ga0068858_1002246192 134
147 3300005844 Ga0068862_100000454 Ga0068862_10000045417 134
148 3300005844 Ga0068862_100334941 Ga0068862_1003349412 134
149 3300005985 Ga0081539_10190263 Ga0081539_101902632 134
150 3300006058 Ga0075432_10065058 Ga0075432_100650583 134
151 3300006178 Ga0075367_10065943 Ga0075367_100659434 134
152 3300006844 Ga0075428_100018555 Ga0075428_1000185554 134
153 3300006844 Ga0075428_100295582 Ga0075428_1002955822 134
154 3300006847 Ga0075431_100502754 Ga0075431_1005027541 134
155 3300006871 Ga0075434_100041430 Ga0075434_1000414305 134
156 3300006880 Ga0075429_100440608 Ga0075429_1004406081 134
157 3300006914 Ga0075436_101337536 Ga0075436_1013375361 134
158 3300006931 Ga0097620_100008268 Ga0097620_10000826813 134
159 3300006931 Ga0097620_100340762 Ga0097620_1003407622 134
160 3300007076 Ga0075435_100009639 Ga0075435_1000096397 134
161 3300009094 Ga0111539_10022067 Ga0111539_100220674 134
162 3300009094 Ga0111539_10024058 Ga0111539_100240583 134
163 3300009094 Ga0111539_10449355 Ga0111539_104493552 134
164 3300009094 Ga0111539_10769553 Ga0111539_107695531 134
165 3300009094 Ga0111539_10940153 Ga0111539_109401532 134
166 3300009094 Ga0111539_11000502 Ga0111539_110005022 134
167 3300009147 Ga0114129_10001867 Ga0114129_100018673 134
168 3300009147 Ga0114129_10424306 Ga0114129_104243061 134
169 3300009147 Ga0114129_10436426 Ga0114129_104364262 134
170 3300009148 Ga0105243_10130287 Ga0105243_101302874 134
171 3300009148 Ga0105243_10171792 Ga0105243_101717923 134
172 3300009553 Ga0105249_10004276 Ga0105249_100042762 134
173 3300013296 Ga0157374_11439009 Ga0157374_114390092 134
174 3300013297 Ga0157378_10327805 Ga0157378_103278053 134
175 3300013308 Ga0157375_10000745 Ga0157375_100007453 134
176 3300013308 Ga0157375_10202421 Ga0157375_102024212 134
177 3300013308 Ga0157375_11941842 Ga0157375_119418422 134
178 3300014325 Ga0163163_11268384 Ga0163163_112683842 134
179 3300014326 Ga0157380_10015118 Ga0157380_100151183 134
180 3300014326 Ga0157380_10025097 Ga0157380_100250974 134
181 3300014326 Ga0157380_10041964 Ga0157380_100419642 134
182 3300014326 Ga0157380_10165323 Ga0157380_101653234 134
183 3300014326 Ga0157380_11069902 Ga0157380_110699022 134
184 3300014745 Ga0157377_11747970 Ga0157377_117479701 134
185 3300025907 Ga0207645_10057216 Ga0207645_100572163 134
186 3300025908 Ga0207643_10001631 Ga0207643_100016313 134
187 3300025908 Ga0207643_10068500 Ga0207643_100685003 134
188 3300025915 Ga0207693_10464399 Ga0207693_104643992 134
189 3300025920 Ga0207649_10079422 Ga0207649_100794222 134
190 3300025922 Ga0207646_10459095 Ga0207646_104590952 134
191 3300025923 Ga0207681_10008436 Ga0207681_100084365 134
192 3300025926 Ga0207659_10056840 Ga0207659_100568403 134
193 3300025933 Ga0207706_10100044 Ga0207706_101000442 134
194 3300025933 Ga0207706_10880823 Ga0207706_108808232 134
195 3300025935 Ga0207709_10056532 Ga0207709_100565322 134
196 3300025936 Ga0207670_10016195 Ga0207670_100161955 134
197 3300025940 Ga0207691_10132373 Ga0207691_101323734 134
198 3300025940 Ga0207691_10259058 Ga0207691_102590582 134
199 3300025945 Ga0207679_10123685 Ga0207679_101236853 134
200 3300025961 Ga0207712_10029981 Ga0207712_100299812 134
201 3300025981 Ga0207640_10231206 Ga0207640_102312062 134
202 3300026035 Ga0207703_10743411 Ga0207703_107434112 134
203 3300026075 Ga0207708_10014346 Ga0207708_100143464 134
204 3300026075 Ga0207708_10024325 Ga0207708_100243256 134
205 3300026075 Ga0207708_10251067 Ga0207708_102510672 134
206 3300026088 Ga0207641_10697354 Ga0207641_106973542 134
207 3300026089 Ga0207648_10000417 Ga0207648_1000041712 134
208 3300026089 Ga0207648_10052202 Ga0207648_100522024 134
209 3300026089 Ga0207648_10107300 Ga0207648_101073004 134
210 3300026095 Ga0207676_10330120 Ga0207676_103301202 134
211 3300026116 Ga0207674_10031639 Ga0207674_100316393 134
212 3300026116 Ga0207674_10031885 Ga0207674_100318856 134
213 3300026118 Ga0207675_100004237 Ga0207675_1000042375 134
214 3300026118 Ga0207675_100045152 Ga0207675_1000451522 134
215 3300026118 Ga0207675_100518177 Ga0207675_1005181771 134
216 3300027907 Ga0207428_10000350 Ga0207428_1000035023 134
217 3300027907 Ga0207428_10006309 Ga0207428_100063092 134
218 3300027907 Ga0207428_10103773 Ga0207428_101037734 134
219 3300027907 Ga0207428_11057702 Ga0207428_110577021 134
220 3300028380 Ga0268265_10000319 Ga0268265_100003194 134
221 3300031903 Ga0307407_10181536 Ga0307407_101815363 134
222 3300031995 Ga0307409_100052447 Ga0307409_1000524474 134
223 3300031995 Ga0307409_100449485 Ga0307409_1004494852 134
224 3300031995 Ga0307409_102401167 Ga0307409_1024011671 134
225 3300032002 Ga0307416_100665103 Ga0307416_1006651033 134
226 3300032005 Ga0307411_10129679 Ga0307411_101296792 134
227 3300041408 Ga0439453_0017168 Ga0439453_0017168_760_1164 134
228 3300041458 Ga0451798_0697548 Ga0451798_0697548_12_416 134
229 3300041458 Ga0451798_0733151 Ga0451798_0733151_146_550 134
230 3300041459 Ga0451800_0336816 Ga0451800_0336816_65_469 134
231 3300042132 Ga0450895_002548 Ga0450895_002548_929_1342 134
232 3300042133 Ga0450896_014755 Ga0450896_014755_234_638 134
233 3300042156 Ga0439446_0167762 Ga0439446_0167762_243_647 134
234 3300042436 Ga0439435_0134072 Ga0439435_0134072_248_652 134
235 3300042437 Ga0439444_0109619 Ga0439444_0109619_152_556 134
236 3300045051 Ga0451576_0187188 Ga0451576_0187188_46_453 134
237 3300045976 Ga0466967_0077092 Ga0466967_0077092_1012_1416 134
238 3300046455 Ga0495603_0069283 Ga0495603_0069283_1050_1457 134
239 3300046499 Ga0495594_0065517 Ga0495594_0065517_462_869 134
240 3300046537 Ga0495598_0194416 Ga0495598_0194416_254_661 134
241 3300046664 Ga0495659_0024511 Ga0495659_0024511_459_866 134
242 3300046664 Ga0495659_0045202 Ga0495659_0045202_615_1022 134
243 3300046664 Ga0495659_0066485 Ga0495659_0066485_459_866 134
244 3300046674 Ga0495588_0085498 Ga0495588_0085498_646_1053 134
245 3300046683 Ga0495658_0520559 Ga0495658_0520559_69_476 134
246 3300049576 Ga0501040_1122727 Ga0501040_1122727_24_443 134
247 3300049578 Ga0501042_0035617 Ga0501042_0035617_3081_3500 134
248 3300049582 Ga0501048_0074551 Ga0501048_0074551_481_900 134
249 3300049587 Ga0501071_0016738 Ga0501071_0016738_2416_2835 134
250 3300049587 Ga0501071_0443855 Ga0501071_0443855_112_525 134
251 3300049588 Ga0501072_0157532 Ga0501072_0157532_408_827 134
252 3300049591 Ga0501075_0294562 Ga0501075_0294562_800_1219 134
253 3300049593 Ga0501077_1016896 Ga0501077_1016896_92_511 134
254 3300049743 Ga0501081_0350670 Ga0501081_0350670_239_652 134
255 3300050494 nmdc:mga06z11_60206_c1 nmdc:mga06z11_60206_c1_1133_1537 134
256 3300050507 nmdc:mga05p37_588121_c1 nmdc:mga05p37_588121_c1_789_1208 134
257 3300050507 nmdc:mga05p37_990221_c1 nmdc:mga05p37_990221_c1_406_813 134
258 3300050508 nmdc:mga09592_339613_c1 nmdc:mga09592_339613_c1_413_820 134
259 3300050510 nmdc:mga06r32_329230_c1 nmdc:mga06r32_329230_c1_1049_1453 134
260 3300050511 nmdc:mga08y16_1262723_c1 nmdc:mga08y16_1262723_c1_242_646 134
261 3300050511 nmdc:mga08y16_445749_c1 nmdc:mga08y16_445749_c1_547_969 134
262 3300050511 nmdc:mga08y16_500861_c1 nmdc:mga08y16_500861_c1_497_940 134
263 3300050511 nmdc:mga08y16_53964_c1 nmdc:mga08y16_53964_c1_3399_3821 134
264 3300050511 nmdc:mga08y16_879_c1 nmdc:mga08y16_879_c1_6074_6481 134
265 3300050512 nmdc:mga0n895_1028741_c1 nmdc:mga0n895_1028741_c1_14_421 134
266 3300050512 nmdc:mga0n895_189901_c1 nmdc:mga0n895_189901_c1_24_428 134
267 3300050513 nmdc:mga0rr50_1677870_c1 nmdc:mga0rr50_1677870_c1_64_471 134
268 3300050513 nmdc:mga0rr50_72830_c1 nmdc:mga0rr50_72830_c1_2157_2564 134
269 3300050514 nmdc:mga08x19_559349_c1 nmdc:mga08x19_559349_c1_306_713 134
270 3300050514 nmdc:mga08x19_671067_c1 nmdc:mga08x19_671067_c1_164_571 134
271 3300053090 Ga0500646_0130857 Ga0500646_0130857_52_456 134
272 3300060353 Ga0501082_1526931 Ga0501082_1526931_27_446 134
273 3300005333 Ga0070677_10066143 Ga0070677_100661433 135
274 3300005367 Ga0070667_101206213 Ga0070667_1012062132 135
275 3300005564 Ga0070664_100565395 Ga0070664_1005653952 135
276 3300005617 Ga0068859_100364147 Ga0068859_1003641472 135
277 3300006237 Ga0097621_101385088 Ga0097621_1013850881 135
278 3300006358 Ga0068871_100623209 Ga0068871_1006232092 135
279 3300006931 Ga0097620_100364187 Ga0097620_1003641872 135
280 3300009177 Ga0105248_10061959 Ga0105248_100619594 135
281 3300014968 Ga0157379_11305396 Ga0157379_113053962 135
282 3300014969 Ga0157376_10382778 Ga0157376_103827782 135
283 3300017792 Ga0163161_10255042 Ga0163161_102550422 135
284 3300025893 Ga0207682_10155840 Ga0207682_101558401 135
285 3300025940 Ga0207691_10094546 Ga0207691_100945462 135
286 3300025941 Ga0207711_11114706 Ga0207711_111147062 135
287 3300025960 Ga0207651_10048350 Ga0207651_100483504 135
288 3300041999 Ga0439433_0001623 Ga0439433_0001623_2170_2577 135
289 3300042015 Ga0439462_0004668 Ga0439462_0004668_2794_3201 135
290 3300042461 Ga0439460_0009828 Ga0439460_0009828_121_534 135
291 3300046455 Ga0495603_0547043 Ga0495603_0547043_165_572 135
292 3300046681 Ga0495647_0062118 Ga0495647_0062118_903_1310 135
293 3300046683 Ga0495658_0676588 Ga0495658_0676588_128_535 135
294 3300047321 Ga0495676_0716532 Ga0495676_0716532_133_540 135
295 3300049570 Ga0501033_0955449 Ga0501033_0955449_37_444 135
296 3300049570 Ga0501033_1140263 Ga0501033_1140263_61_471 135
297 3300049575 Ga0501039_0164424 Ga0501039_0164424_1196_1606 135
298 3300049580 Ga0501046_0892103 Ga0501046_0892103_28_438 135
299 3300049593 Ga0501077_0670527 Ga0501077_0670527_113_523 135
300 3300049824 Ga0501045_1150108 Ga0501045_1150108_48_455 135
301 3300049824 Ga0501045_1318047 Ga0501045_1318047_48_458 135
302 3300059424 Ga0590075_059105 Ga0590075_059105_303_710 135
303 3300060353 Ga0501082_1144497 Ga0501082_1144497_191_598 135
304 3300061734 Ga0530510_0488297 Ga0530510_0488297_214_624 135
305 3300005295 Ga0065707_10618364 Ga0065707_106183642 136
306 3300005334 Ga0068869_100096783 Ga0068869_1000967833 136
307 3300005340 Ga0070689_100348535 Ga0070689_1003485352 136
308 3300005343 Ga0070687_100309973 Ga0070687_1003099732 136
309 3300005354 Ga0070675_100066140 Ga0070675_1000661404 136
310 3300005365 Ga0070688_100032350 Ga0070688_1000323504 136
311 3300005539 Ga0068853_100327966 Ga0068853_1003279662 136
312 3300005617 Ga0068859_100006982 Ga0068859_10000698215 136
313 3300005618 Ga0068864_100725410 Ga0068864_1007254102 136
314 3300005843 Ga0068860_100441636 Ga0068860_1004416362 136
315 3300006237 Ga0097621_100245503 Ga0097621_1002455033 136
316 3300006358 Ga0068871_101150891 Ga0068871_1011508912 136
317 3300006844 Ga0075428_100988938 Ga0075428_1009889381 136
318 3300006847 Ga0075431_101668495 Ga0075431_1016684951 136
319 3300006931 Ga0097620_100006981 Ga0097620_10000698115 136
320 3300009147 Ga0114129_10897155 Ga0114129_108971552 136
321 3300009177 Ga0105248_10083057 Ga0105248_100830574 136
322 3300013308 Ga0157375_10192622 Ga0157375_101926222 136
323 3300014745 Ga0157377_10110796 Ga0157377_101107962 136
324 3300025918 Ga0207662_10017137 Ga0207662_100171374 136
325 3300025926 Ga0207659_10002077 Ga0207659_1000207714 136
326 3300025936 Ga0207670_10018899 Ga0207670_100188993 136
327 3300025941 Ga0207711_10214353 Ga0207711_102143532 136
328 3300026023 Ga0207677_10522034 Ga0207677_105220342 136
329 3300026075 Ga0207708_10340945 Ga0207708_103409452 136
330 3300026088 Ga0207641_10192103 Ga0207641_101921032 136
331 3300026095 Ga0207676_10072116 Ga0207676_100721162 136
332 3300026116 Ga0207674_10754894 Ga0207674_107548941 136
333 3300028381 Ga0268264_10011940 Ga0268264_100119402 136
334 3300034819 Ga0373958_0052861 Ga0373958_0052861_22_435 136
335 3300035114 Ga0373939_0043232 Ga0373939_0043232_415_828 136
336 3300035691 Ga0373931_0065221 Ga0373931_0065221_476_889 136
337 3300045051 Ga0451576_0262473 Ga0451576_0262473_613_1026 136
338 3300050507 nmdc:mga05p37_639674_c1 nmdc:mga05p37_639674_c1_314_724 136
339 3300050509 nmdc:mga0qj67_536600_c1 nmdc:mga0qj67_536600_c1_368_778 136
340 3300050509 nmdc:mga0qj67_573373_c1 nmdc:mga0qj67_573373_c1_479_889 136
341 3300050509 nmdc:mga0qj67_638015_c1 nmdc:mga0qj67_638015_c1_65_475 136
342 3300050510 nmdc:mga06r32_1704522_c1 nmdc:mga06r32_1704522_c1_57_467 136
343 3300050510 nmdc:mga06r32_771954_c1 nmdc:mga06r32_771954_c1_480_890 136
344 3300006846 Ga0075430_100634534 Ga0075430_1006345342 137
345 3300006846 Ga0075430_100341946 Ga0075430_1003419461 140
346 3300035692 Ga0373935_0745113 Ga0373935_0745113_91_522 142
347 3300049578 Ga0501042_1379461 Ga0501042_1379461_30_458 142
348 3300049824 Ga0501045_0205632 Ga0501045_0205632_973_1401 142
349 3300054114 Ga0501084_1485031 Ga0501084_1485031_70_498 142
350 3300060353 Ga0501082_1007745 Ga0501082_1007745_119_547 142
351 2162886012 MBSR1b_contig_5922638 MBSR1b_0473.00005220 143
352 3300005293 Ga0065715_10489567 Ga0065715_104895671 143
353 3300005354 Ga0070675_100634795 Ga0070675_1006347952 143
354 3300025925 Ga0207650_11315787 Ga0207650_113157871 143
355 3300025931 Ga0207644_10105644 Ga0207644_101056442 143

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06094

GGACT

Gamma-glutamyl cyclotransferase, AIG2-like

31

155

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qik-assembly1.cif.gz_A crystal structure of ykqa from bacillus subtilis. northeast structural genomics target sr631 0.8389 1 136
1v30-assembly1.cif.gz_A crystal structure of uncharacterized protein ph0828 from pyrococcus horikoshii 0.7431 2 142
1v30-assembly1.cif.gz_A crystal structure of uncharacterized protein ph0828 from pyrococcus horikoshii 0.7376 2 142
1vkb-assembly1.cif.gz_A crystal structure of an aig2-like protein (a2ld1, ggact, mgc7867) from mus musculus at 1.90 a resolution 0.7103 2 115
5c5z-assembly1.cif.gz_B crystal structure analysis of c4763, a uropathogenic e. coli-specific protein 0.7076 1 132
ID Description Score Start End Superfamily
af_Q58909_1_120_3.10.490.10 Alpha Beta;Roll;Hypothetical upf0131 protein ytfp;Gamma-glutamyl cyclotransferase-like 0.8568 3 131 3.10.490.10
af_Q58909_1_120_3.10.490.10 Alpha Beta;Roll;Hypothetical upf0131 protein ytfp;Gamma-glutamyl cyclotransferase-like 0.8372 3 131 3.10.490.10
2qikA01 Alpha Beta;Roll;Hypothetical upf0131 protein ytfp;Gamma-glutamyl cyclotransferase-like 0.8336 3 130 3.10.490.10
2qikA01 Alpha Beta;Roll;Hypothetical upf0131 protein ytfp;Gamma-glutamyl cyclotransferase-like 0.8128 3 130 3.10.490.10
af_A8MRP2_2_115_3.10.490.10 Alpha Beta;Roll;Hypothetical upf0131 protein ytfp;Gamma-glutamyl cyclotransferase-like 0.8009 1 112 3.10.490.10
ID Description Score Start End GO Terms
AF-A0A1F2SBY8-F1-model_v4 Gamma-glutamylcyclotransferase AIG2-like domain-containing protein 0.9957 24 134
AF-A0A2V8GEU5-F1-model_v4 Gamma-glutamylcyclotransferase 0.9808 66 132 GO:0016740
AF-A0A1F2SBY8-F1-model_v4 Gamma-glutamylcyclotransferase AIG2-like domain-containing protein 0.978 24 134
AF-A0A1F2V6A0-F1-model_v4 Gamma-glutamylcyclotransferase AIG2-like domain-containing protein 0.969 1 133
AF-A0A2V8AGD5-F1-model_v4 Gamma-glutamylcyclotransferase 0.9575 1 133 GO:0016740

Feature Viewer

pLDDT pTM Quality
82.24 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map