F420040
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 355 | 202 | 344 | 412 |
Family's Representative Sequence
| Representative Sequence | 3300005458|Ga0070681_10089677|Ga0070681_100896772 |
| Length | 459 |
| Sequence | MGRSGNIVRRLTFVTRQLFVNLPPIVPAIMIRTIRIFCPAVSFLYILLSLPLFNVQACPAGGGAGASQKDYPPNGIWQASIIRKDGQFIRFNFEMKDSAGKKILYIMNGKERLLADNIRQQEDSLFIEMPFFDSRFALRIYDDDKLEGNWIKNYGHRQVIMPFRAFRNETKRFSVSRQPLFNITGRWSVHFREKNQTTEEAVGEFRQSGSEITGTFLTTTGDYRFLEGVVDGDSLRLSTFDGGHAYYFTAKIDAADKISGGAFYSGATSKEGWQAEKNEHAALPDEFSLTTLKNPHDDRLNFTFRSTDGPLVSINDKAFKNKVVIVQIMGSWCPNCMDETRFLSDYYKKNKARGIEIIALAYERTPNFDESRKSLQSFKNRFDVTYPVLVTPVALNDSLRTEKTLPQIKKILGFPTTIFIDKAGKVRKISTGFNGPGTGDHYEIFKKEFNELVNGLLKE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 2 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 3 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 4 | 2911138879 | Spirosoma sp. KUDC1026 | Isolate | Rhizosphere |
| 5 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 6 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 7 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 8 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 9 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 10 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 11 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 12 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 13 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 14 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 15 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 16 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 17 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 18 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 19 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 20 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 22 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 49 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 50 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 51 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 52 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 53 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 54 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 56 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 57 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 58 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 59 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 60 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 86 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 123 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 124 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 125 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 126 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 127 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 128 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 129 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 130 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 131 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 132 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 133 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 134 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 135 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 136 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 137 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 138 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 139 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 140 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 141 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 142 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 164 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 165 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 182 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 186 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 189 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 190 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 191 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 192 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 193 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 194 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 195 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 196 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 197 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 198 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 199 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 200 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 201 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 202 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.9 |
| Metatranscriptomes | 0 |
| Isolates | 3.1 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.32 |
| Nodule | 0 |
| Rhizoplane | 0.56 |
| Rhizosphere | 83.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10009113 | 3300001990 | Bacteria | 3307 |
| 2 | JGI24735J21928_10000007 | 3300002067 | Bacteria | 333510 |
| 3 | JGI24735J21928_10007016 | 3300002067 | Bacteria | 3682 |
| 4 | JGI25162J39368_1000086 | 3300002737 | Bacteria | 107401 |
| 5 | rootH1_10022655 | 3300003316 | Unclassified | 2391 |
| 6 | rootH1_10055794 | 3300003316 | Bacteria | 3992 |
| 7 | rootH1_10117279 | 3300003316 | Unclassified | 1555 |
| 8 | rootH1_10123087 | 3300003316 | Bacteria | 3780 |
| 9 | rootH2_10013019 | 3300003320 | Bacteria | 26132 |
| 10 | rootH2_10047580 | 3300003320 | Bacteria | 23351 |
| 11 | rootH2_10069535 | 3300003320 | Bacteria | 11638 |
| 12 | rootH2_10115320 | 3300003320 | Bacteria | 2864 |
| 13 | rootL2_10019581 | 3300003322 | Bacteria | 4375 |
| 14 | rootL2_10026870 | 3300003322 | Bacteria | 9958 |
| 15 | rootL2_10054063 | 3300003322 | Bacteria | 2667 |
| 16 | rootL2_10069142 | 3300003322 | Bacteria | 8171 |
| 17 | rootL2_10135105 | 3300003322 | Bacteria | 5007 |
| 18 | rootL2_10195979 | 3300003322 | Bacteria | 3753 |
| 19 | rootL2_10263470 | 3300003322 | Bacteria | 1583 |
| 20 | rootH1_10008448 | 3300003323 | Bacteria | 25690 |
| 21 | rootH1_10100719 | 3300003323 | Bacteria | 10062 |
| 22 | JGI25160J50197_1000790 | 3300003354 | Bacteria | 17009 |
| 23 | Ga0055535_1003565 | 3300003761 | Bacteria | 4314 |
| 24 | Ga0065165_1001522 | 3300005262 | Bacteria | 24416 |
| 25 | Ga0065714_10021152 | 3300005288 | Bacteria | 2043 |
| 26 | Ga0065712_10068102 | 3300005290 | Bacteria | 14685 |
| 27 | Ga0070658_10058439 | 3300005327 | Unclassified | 3139 |
| 28 | Ga0070670_100032523 | 3300005331 | Bacteria | 4492 |
| 29 | Ga0070680_100000075 | 3300005336 | Bacteria | 53328 |
| 30 | Ga0070682_100000628 | 3300005337 | Bacteria | 21473 |
| 31 | Ga0068868_100029988 | 3300005338 | Unclassified | 4169 |
| 32 | Ga0070660_100003934 | 3300005339 | Bacteria | 10267 |
| 33 | Ga0070660_100051817 | 3300005339 | Bacteria | 3162 |
| 34 | Ga0070660_100088322 | 3300005339 | Bacteria | 2441 |
| 35 | Ga0070689_100014800 | 3300005340 | Bacteria | 5675 |
| 36 | Ga0070691_10000522 | 3300005341 | Bacteria | 14488 |
| 37 | Ga0070674_100007210 | 3300005356 | Bacteria | 6544 |
| 38 | Ga0070659_100000120 | 3300005366 | Bacteria | 59172 |
| 39 | Ga0070659_100013534 | 3300005366 | Bacteria | 6074 |
| 40 | Ga0070667_100037265 | 3300005367 | Bacteria | 4077 |
| 41 | Ga0070667_100189070 | 3300005367 | Bacteria | 1823 |
| 42 | Ga0070678_100039769 | 3300005456 | Unclassified | 3321 |
| 43 | Ga0070678_100137368 | 3300005456 | Bacteria | 1951 |
| 44 | Ga0070662_100071105 | 3300005457 | Bacteria | 2565 |
| 45 | Ga0070681_10089677 | 3300005458 | Bacteria | 3026 |
| 46 | Ga0070685_10000872 | 3300005466 | Bacteria | 16341 |
| 47 | Ga0070685_10006752 | 3300005466 | Bacteria | 5854 |
| 48 | Ga0070685_10015858 | 3300005466 | Bacteria | 4007 |
| 49 | Ga0070698_100006230 | 3300005471 | Bacteria | 12981 |
| 50 | Ga0070679_100000892 | 3300005530 | Bacteria | 25923 |
| 51 | Ga0070679_100117630 | 3300005530 | Bacteria | 2643 |
| 52 | Ga0070684_100002223 | 3300005535 | Bacteria | 14311 |
| 53 | Ga0068853_100000393 | 3300005539 | Bacteria | 29967 |
| 54 | Ga0068853_100004852 | 3300005539 | Bacteria | 10451 |
| 55 | Ga0070672_100186805 | 3300005543 | Bacteria | 1729 |
| 56 | Ga0068855_100000424 | 3300005563 | Bacteria | 52152 |
| 57 | Ga0068855_100001368 | 3300005563 | Bacteria | 30198 |
| 58 | Ga0068855_100002033 | 3300005563 | Bacteria | 25069 |
| 59 | Ga0068855_100025564 | 3300005563 | Bacteria | 7062 |
| 60 | Ga0068855_100036848 | 3300005563 | Bacteria | 5819 |
| 61 | Ga0068855_100154396 | 3300005563 | Bacteria | 2609 |
| 62 | Ga0068854_100027376 | 3300005578 | Bacteria | 3929 |
| 63 | Ga0068854_100106775 | 3300005578 | Bacteria | 2107 |
| 64 | Ga0068856_100000040 | 3300005614 | Bacteria | 114443 |
| 65 | Ga0068856_100067175 | 3300005614 | Bacteria | 3543 |
| 66 | Ga0068856_100088073 | 3300005614 | Unclassified | 3087 |
| 67 | Ga0068852_100176858 | 3300005616 | Bacteria | 2004 |
| 68 | Ga0068861_100024264 | 3300005719 | Bacteria | 4385 |
| 69 | Ga0068861_100094601 | 3300005719 | Bacteria | 2364 |
| 70 | Ga0068861_100246346 | 3300005719 | Bacteria | 1522 |
| 71 | Ga0068863_100003469 | 3300005841 | Bacteria | 15551 |
| 72 | Ga0068863_100309820 | 3300005841 | Bacteria | 1532 |
| 73 | Ga0068858_100104828 | 3300005842 | Bacteria | 2638 |
| 74 | Ga0068862_100230763 | 3300005844 | Bacteria | 1679 |
| 75 | Ga0081540_1021413 | 3300005983 | Bacteria | 3850 |
| 76 | Ga0075366_10006224 | 3300006195 | Bacteria | 6517 |
| 77 | Ga0097621_100007287 | 3300006237 | Bacteria | 7904 |
| 78 | Ga0097621_100047074 | 3300006237 | Bacteria | 3492 |
| 79 | Ga0068871_100131051 | 3300006358 | Unclassified | 2126 |
| 80 | Ga0075428_100004227 | 3300006844 | Bacteria | 15805 |
| 81 | Ga0075428_100078709 | 3300006844 | Bacteria | 3599 |
| 82 | Ga0075428_100151108 | 3300006844 | Bacteria | 2523 |
| 83 | Ga0075430_100000903 | 3300006846 | Bacteria | 23286 |
| 84 | Ga0075431_100001482 | 3300006847 | Bacteria | 21685 |
| 85 | Ga0075429_100003075 | 3300006880 | Bacteria | 14153 |
| 86 | Ga0075429_100007210 | 3300006880 | Bacteria | 9648 |
| 87 | Ga0105240_10000486 | 3300009093 | Bacteria | 73492 |
| 88 | Ga0105240_10001336 | 3300009093 | Bacteria | 42397 |
| 89 | Ga0105240_10014457 | 3300009093 | Bacteria | 10777 |
| 90 | Ga0105240_10038372 | 3300009093 | Bacteria | 6144 |
| 91 | Ga0105240_10078599 | 3300009093 | Bacteria | 4062 |
| 92 | Ga0105240_10153861 | 3300009093 | Bacteria | 2737 |
| 93 | Ga0105240_10232607 | 3300009093 | Bacteria | 2141 |
| 94 | Ga0105240_10366139 | 3300009093 | Bacteria | 1631 |
| 95 | Ga0114129_10246787 | 3300009147 | Bacteria | 2398 |
| 96 | Ga0114129_10257260 | 3300009147 | Bacteria | 2341 |
| 97 | Ga0105241_10008261 | 3300009174 | Bacteria | 7666 |
| 98 | Ga0105241_10261945 | 3300009174 | Bacteria | 1470 |
| 99 | Ga0105242_10033854 | 3300009176 | Bacteria | 4094 |
| 100 | Ga0105248_10226529 | 3300009177 | Bacteria | 2104 |
| 101 | Ga0105237_10000400 | 3300009545 | Bacteria | 61626 |
| 102 | Ga0105237_10002069 | 3300009545 | Bacteria | 25437 |
| 103 | Ga0105237_10007738 | 3300009545 | Bacteria | 11732 |
| 104 | Ga0105237_10012955 | 3300009545 | Bacteria | 8758 |
| 105 | Ga0105237_10030263 | 3300009545 | Bacteria | 5500 |
| 106 | Ga0105237_10031518 | 3300009545 | Bacteria | 5374 |
| 107 | Ga0105237_10035921 | 3300009545 | Bacteria | 5012 |
| 108 | Ga0105249_10000887 | 3300009553 | Bacteria | 26498 |
| 109 | Ga0105249_10006490 | 3300009553 | Bacteria | 10175 |
| 110 | Ga0105239_10000014 | 3300010375 | Bacteria | 325391 |
| 111 | Ga0105239_10000457 | 3300010375 | Bacteria | 59635 |
| 112 | Ga0105239_10001481 | 3300010375 | Bacteria | 31222 |
| 113 | Ga0105239_10001703 | 3300010375 | Bacteria | 28972 |
| 114 | Ga0105239_10003895 | 3300010375 | Bacteria | 18090 |
| 115 | Ga0105239_10023003 | 3300010375 | Bacteria | 6871 |
| 116 | Ga0105239_10032023 | 3300010375 | Bacteria | 5778 |
| 117 | Ga0105239_10036772 | 3300010375 | Bacteria | 5371 |
| 118 | Ga0105239_10200895 | 3300010375 | Bacteria | 2233 |
| 119 | Ga0157373_10002671 | 3300013100 | Bacteria | 13525 |
| 120 | Ga0157371_10000121 | 3300013102 | Bacteria | 118793 |
| 121 | Ga0157371_10000943 | 3300013102 | Bacteria | 32475 |
| 122 | Ga0157371_10014170 | 3300013102 | Bacteria | 6027 |
| 123 | Ga0157371_10052757 | 3300013102 | Bacteria | 2887 |
| 124 | Ga0157370_10000238 | 3300013104 | Bacteria | 70036 |
| 125 | Ga0157370_10000426 | 3300013104 | Bacteria | 52773 |
| 126 | Ga0157370_10011684 | 3300013104 | Bacteria | 9166 |
| 127 | Ga0157370_10016232 | 3300013104 | Bacteria | 7545 |
| 128 | Ga0157370_10026119 | 3300013104 | Bacteria | 5769 |
| 129 | Ga0157370_10046733 | 3300013104 | Bacteria | 4150 |
| 130 | Ga0157369_10075089 | 3300013105 | Bacteria | 3625 |
| 131 | Ga0157369_10128628 | 3300013105 | Bacteria | 2684 |
| 132 | Ga0157374_10000007 | 3300013296 | Bacteria | 595643 |
| 133 | Ga0157374_10053557 | 3300013296 | Bacteria | 3762 |
| 134 | Ga0157374_10113912 | 3300013296 | Bacteria | 2603 |
| 135 | Ga0157378_10006118 | 3300013297 | Bacteria | 10537 |
| 136 | Ga0163162_10002921 | 3300013306 | Bacteria | 16292 |
| 137 | Ga0163162_10017517 | 3300013306 | Bacteria | 7009 |
| 138 | Ga0163162_10022032 | 3300013306 | Bacteria | 6278 |
| 139 | Ga0163162_10170425 | 3300013306 | Bacteria | 2302 |
| 140 | Ga0157372_10000075 | 3300013307 | Bacteria | 105528 |
| 141 | Ga0157372_10007751 | 3300013307 | Bacteria | 11407 |
| 142 | Ga0157372_10155941 | 3300013307 | Bacteria | 2637 |
| 143 | Ga0157375_10031613 | 3300013308 | Bacteria | 5007 |
| 144 | Ga0157375_10033780 | 3300013308 | Unclassified | 4865 |
| 145 | Ga0157375_10337726 | 3300013308 | Bacteria | 1672 |
| 146 | Ga0163163_10025286 | 3300014325 | Bacteria | 5661 |
| 147 | Ga0163163_10123618 | 3300014325 | Bacteria | 2623 |
| 148 | Ga0163163_10168215 | 3300014325 | Bacteria | 2239 |
| 149 | Ga0157380_10000012 | 3300014326 | Bacteria | 131332 |
| 150 | Ga0157380_10039459 | 3300014326 | Unclassified | 3672 |
| 151 | Ga0157380_10175915 | 3300014326 | Bacteria | 1875 |
| 152 | Ga0157380_10218166 | 3300014326 | Bacteria | 1705 |
| 153 | Ga0157377_10108100 | 3300014745 | Bacteria | 1668 |
| 154 | Ga0157377_10108998 | 3300014745 | Bacteria | 1662 |
| 155 | Ga0157379_10103360 | 3300014968 | Bacteria | 2557 |
| 156 | Ga0157379_10223377 | 3300014968 | Bacteria | 1707 |
| 157 | Ga0157376_10003394 | 3300014969 | Bacteria | 10966 |
| 158 | Ga0157376_10006238 | 3300014969 | Bacteria | 8403 |
| 159 | Ga0157376_10094455 | 3300014969 | Bacteria | 2598 |
| 160 | Ga0157376_10247063 | 3300014969 | Bacteria | 1665 |
| 161 | Ga0163161_10004535 | 3300017792 | Bacteria | 9665 |
| 162 | Ga0163161_10125461 | 3300017792 | Bacteria | 1932 |
| 163 | Ga0209437_100144 | 3300025233 | Bacteria | 164794 |
| 164 | Ga0209258_100326 | 3300025242 | Bacteria | 72066 |
| 165 | Ga0209646_1000829 | 3300025246 | Bacteria | 10399 |
| 166 | Ga0209148_1000157 | 3300025254 | Bacteria | 142367 |
| 167 | Ga0209233_1002514 | 3300025261 | Bacteria | 6701 |
| 168 | Ga0209455_1001743 | 3300025272 | Bacteria | 9243 |
| 169 | Ga0207426_1000019 | 3300025302 | Bacteria | 558579 |
| 170 | Ga0207647_10000601 | 3300025904 | Bacteria | 28025 |
| 171 | Ga0207645_10000713 | 3300025907 | Bacteria | 27669 |
| 172 | Ga0207643_10037126 | 3300025908 | Bacteria | 2733 |
| 173 | Ga0207705_10084079 | 3300025909 | Bacteria | 2323 |
| 174 | Ga0207654_10078168 | 3300025911 | Bacteria | 1985 |
| 175 | Ga0207654_10145485 | 3300025911 | Bacteria | 1516 |
| 176 | Ga0207707_10000111 | 3300025912 | Bacteria | 82165 |
| 177 | Ga0207695_10000130 | 3300025913 | Bacteria | 224214 |
| 178 | Ga0207695_10000170 | 3300025913 | Bacteria | 192469 |
| 179 | Ga0207695_10000267 | 3300025913 | Bacteria | 131133 |
| 180 | Ga0207695_10004097 | 3300025913 | Bacteria | 20033 |
| 181 | Ga0207695_10022478 | 3300025913 | Bacteria | 7156 |
| 182 | Ga0207695_10059521 | 3300025913 | Bacteria | 3960 |
| 183 | Ga0207695_10069270 | 3300025913 | Bacteria | 3610 |
| 184 | Ga0207695_10118949 | 3300025913 | Bacteria | 2613 |
| 185 | Ga0207671_10000244 | 3300025914 | Bacteria | 81258 |
| 186 | Ga0207671_10005384 | 3300025914 | Bacteria | 11818 |
| 187 | Ga0207671_10013461 | 3300025914 | Bacteria | 6512 |
| 188 | Ga0207671_10015710 | 3300025914 | Bacteria | 5918 |
| 189 | Ga0207671_10031769 | 3300025914 | Bacteria | 3933 |
| 190 | Ga0207671_10074512 | 3300025914 | Bacteria | 2537 |
| 191 | Ga0207660_10062136 | 3300025917 | Bacteria | 2690 |
| 192 | Ga0207657_10002022 | 3300025919 | Bacteria | 21925 |
| 193 | Ga0207657_10095424 | 3300025919 | Bacteria | 2475 |
| 194 | Ga0207657_10153349 | 3300025919 | Bacteria | 1875 |
| 195 | Ga0207652_10011666 | 3300025921 | Bacteria | 7090 |
| 196 | Ga0207650_10035628 | 3300025925 | Bacteria | 3616 |
| 197 | Ga0207650_10038722 | 3300025925 | Bacteria | 3483 |
| 198 | Ga0207690_10000133 | 3300025932 | Bacteria | 60426 |
| 199 | Ga0207706_10007072 | 3300025933 | Bacteria | 10376 |
| 200 | Ga0207686_10003787 | 3300025934 | Bacteria | 8121 |
| 201 | Ga0207669_10028212 | 3300025937 | Unclassified | 3085 |
| 202 | Ga0207691_10027955 | 3300025940 | Bacteria | 5284 |
| 203 | Ga0207689_10008218 | 3300025942 | Bacteria | 9094 |
| 204 | Ga0207667_10004397 | 3300025949 | Bacteria | 17264 |
| 205 | Ga0207667_10004780 | 3300025949 | Bacteria | 16560 |
| 206 | Ga0207667_10030351 | 3300025949 | Bacteria | 5849 |
| 207 | Ga0207667_10038464 | 3300025949 | Bacteria | 5110 |
| 208 | Ga0207667_10120322 | 3300025949 | Bacteria | 2706 |
| 209 | Ga0207667_10123545 | 3300025949 | Bacteria | 2667 |
| 210 | Ga0207651_10053300 | 3300025960 | Bacteria | 2764 |
| 211 | Ga0207651_10109560 | 3300025960 | Unclassified | 2069 |
| 212 | Ga0207651_10167156 | 3300025960 | Bacteria | 1731 |
| 213 | Ga0207712_10001189 | 3300025961 | Bacteria | 17987 |
| 214 | Ga0207712_10002645 | 3300025961 | Bacteria | 11466 |
| 215 | Ga0207712_10004451 | 3300025961 | Bacteria | 8847 |
| 216 | Ga0207640_10009334 | 3300025981 | Bacteria | 5488 |
| 217 | Ga0207658_10025912 | 3300025986 | Bacteria | 4108 |
| 218 | Ga0207658_10101591 | 3300025986 | Bacteria | 2254 |
| 219 | Ga0207677_10086163 | 3300026023 | Bacteria | 2270 |
| 220 | Ga0207639_10016973 | 3300026041 | Bacteria | 5159 |
| 221 | Ga0207702_10000042 | 3300026078 | Bacteria | 150673 |
| 222 | Ga0207702_10043172 | 3300026078 | Bacteria | 3785 |
| 223 | Ga0207702_10047656 | 3300026078 | Bacteria | 3612 |
| 224 | Ga0207702_10066598 | 3300026078 | Unclassified | 3088 |
| 225 | Ga0207641_10000601 | 3300026088 | Bacteria | 39530 |
| 226 | Ga0207648_10006817 | 3300026089 | Bacteria | 11319 |
| 227 | Ga0207676_10021656 | 3300026095 | Bacteria | 4719 |
| 228 | Ga0207676_10040155 | 3300026095 | Bacteria | 3585 |
| 229 | Ga0207675_100059328 | 3300026118 | Bacteria | 3570 |
| 230 | Ga0207675_100266701 | 3300026118 | Unclassified | 1661 |
| 231 | Ga0207683_10008436 | 3300026121 | Bacteria | 8820 |
| 232 | Ga0268264_10346404 | 3300028381 | Bacteria | 1413 |
| 233 | Ga0265334_10007635 | 3300028573 | Bacteria | 4634 |
| 234 | Ga0307517_10006013 | 3300028786 | Bacteria | 18085 |
| 235 | Ga0265327_10003797 | 3300031251 | Bacteria | 13989 |
| 236 | Ga0307513_10265266 | 3300031456 | Bacteria | 1504 |
| 237 | Ga0307516_10000683 | 3300031730 | Bacteria | 46007 |
| 238 | Ga0307510_10010080 | 3300033180 | Bacteria | 11235 |
| 239 | Ga0373937_0075296 | 3300036401 | Bacteria | 3116 |
| 240 | Ga0316584_0016023 | 3300036712 | Bacteria | 5369 |
| 241 | Ga0395899_0000050 | 3300037312 | Bacteria | 224591 |
| 242 | Ga0395899_0000064 | 3300037312 | Bacteria | 207082 |
| 243 | Ga0395899_0029301 | 3300037312 | Bacteria | 4140 |
| 244 | Ga0395900_0053385 | 3300037418 | Bacteria | 4160 |
| 245 | Ga0395898_0010807 | 3300037466 | Bacteria | 9537 |
| 246 | Ga0395901_0001140 | 3300038443 | Bacteria | 28163 |
| 247 | Ga0395901_0002041 | 3300038443 | Bacteria | 20730 |
| 248 | Ga0436365_0062569 | 3300039437 | Bacteria | 9629 |
| 249 | Ga0439431_0006375 | 3300041997 | Bacteria | 2609 |
| 250 | Ga0466969_0065733 | 3300044656 | Bacteria | 1753 |
| 251 | Ga0466972_0000040 | 3300044658 | Bacteria | 133427 |
| 252 | Ga0466961_0018482 | 3300044693 | Bacteria | 4484 |
| 253 | Ga0466971_0007139 | 3300044719 | Bacteria | 4862 |
| 254 | Ga0466957_0001910 | 3300044842 | Bacteria | 11052 |
| 255 | Ga0451576_0000003 | 3300045051 | Bacteria | 1550573 |
| 256 | Ga0495592_0029157 | 3300046454 | Unclassified | 4178 |
| 257 | Ga0495650_0000236 | 3300046471 | Bacteria | 111056 |
| 258 | Ga0495580_0153923 | 3300046472 | Bacteria | 1593 |
| 259 | Ga0495585_0000097 | 3300046492 | Bacteria | 93394 |
| 260 | Ga0495585_0000111 | 3300046492 | Bacteria | 87559 |
| 261 | Ga0495583_0008651 | 3300046506 | Bacteria | 6193 |
| 262 | Ga0495606_0000036 | 3300046507 | Bacteria | 234596 |
| 263 | Ga0495606_0006370 | 3300046507 | Bacteria | 10910 |
| 264 | Ga0495606_0007729 | 3300046507 | Bacteria | 9521 |
| 265 | Ga0495606_0015038 | 3300046507 | Bacteria | 5993 |
| 266 | Ga0495610_0000500 | 3300046512 | Bacteria | 40127 |
| 267 | Ga0495616_0000821 | 3300046513 | Bacteria | 22672 |
| 268 | Ga0495616_0002784 | 3300046513 | Bacteria | 11417 |
| 269 | Ga0495648_0001819 | 3300046524 | Bacteria | 20533 |
| 270 | Ga0495648_0023734 | 3300046524 | Bacteria | 4192 |
| 271 | Ga0495633_0017809 | 3300046558 | Bacteria | 3620 |
| 272 | Ga0495668_0002689 | 3300046616 | Bacteria | 14265 |
| 273 | Ga0495668_0045179 | 3300046616 | Bacteria | 2448 |
| 274 | Ga0495611_0000252 | 3300046648 | Bacteria | 36998 |
| 275 | Ga0495625_0000110 | 3300046660 | Bacteria | 125028 |
| 276 | Ga0495625_0004018 | 3300046660 | Bacteria | 14070 |
| 277 | Ga0495661_0006331 | 3300046665 | Bacteria | 8324 |
| 278 | Ga0495661_0015450 | 3300046665 | Bacteria | 5096 |
| 279 | Ga0495661_0027088 | 3300046665 | Bacteria | 3683 |
| 280 | Ga0495658_0008802 | 3300046683 | Bacteria | 5017 |
| 281 | Ga0495649_0000011 | 3300046694 | Bacteria | 416695 |
| 282 | Ga0495649_0029817 | 3300046694 | Bacteria | 3015 |
| 283 | Ga0495660_0003749 | 3300046810 | Bacteria | 9331 |
| 284 | Ga0495672_0022252 | 3300047320 | Bacteria | 4124 |
| 285 | Ga0495687_005362 | 3300047443 | Bacteria | 8197 |
| 286 | Ga0495673_0024700 | 3300047469 | Bacteria | 2897 |
| 287 | Ga0495686_0000034 | 3300047472 | Bacteria | 325038 |
| 288 | Ga0495686_0000249 | 3300047472 | Bacteria | 96604 |
| 289 | Ga0495686_0000748 | 3300047472 | Bacteria | 43100 |
| 290 | Ga0496105_0162763 | 3300048908 | Bacteria | 1832 |
| 291 | Ga0496121_0000028 | 3300048924 | Bacteria | 439193 |
| 292 | Ga0495678_021035 | 3300049459 | Bacteria | 2878 |
| 293 | Ga0501031_0004611 | 3300049568 | Bacteria | 8938 |
| 294 | Ga0501032_0002963 | 3300049569 | Bacteria | 13182 |
| 295 | Ga0501032_0004450 | 3300049569 | Bacteria | 10566 |
| 296 | Ga0501032_0027857 | 3300049569 | Bacteria | 3883 |
| 297 | Ga0501033_0000022 | 3300049570 | Bacteria | 190111 |
| 298 | Ga0501033_0071609 | 3300049570 | Unclassified | 2546 |
| 299 | Ga0501034_0000240 | 3300049571 | Bacteria | 101222 |
| 300 | Ga0501034_0006140 | 3300049571 | Bacteria | 12952 |
| 301 | Ga0501034_0009250 | 3300049571 | Bacteria | 10327 |
| 302 | Ga0501034_0032340 | 3300049571 | Bacteria | 5313 |
| 303 | Ga0501036_0025452 | 3300049572 | Bacteria | 4992 |
| 304 | Ga0501036_0031237 | 3300049572 | Bacteria | 4500 |
| 305 | Ga0501037_0004637 | 3300049573 | Bacteria | 9987 |
| 306 | Ga0501038_0020146 | 3300049574 | Bacteria | 6002 |
| 307 | Ga0501039_0010184 | 3300049575 | Bacteria | 7167 |
| 308 | Ga0501043_0001058 | 3300049579 | Bacteria | 24179 |
| 309 | Ga0501043_0005283 | 3300049579 | Bacteria | 10442 |
| 310 | Ga0501046_0098238 | 3300049580 | Bacteria | 2249 |
| 311 | Ga0501070_0205380 | 3300049586 | Bacteria | 1618 |
| 312 | Ga0501073_0014748 | 3300049589 | Bacteria | 5676 |
| 313 | Ga0501074_0067528 | 3300049590 | Bacteria | 2571 |
| 314 | Ga0501080_0302417 | 3300049742 | Bacteria | 1450 |
| 315 | Ga0501083_0048744 | 3300049744 | Bacteria | 2858 |
| 316 | Ga0501241_000122 | 3300049758 | Bacteria | 16826 |
| 317 | Ga0501035_0004585 | 3300049822 | Bacteria | 13102 |
| 318 | Ga0501035_0029571 | 3300049822 | Bacteria | 4997 |
| 319 | Ga0501044_0002612 | 3300049823 | Bacteria | 20469 |
| 320 | Ga0501044_0005431 | 3300049823 | Bacteria | 14157 |
| 321 | Ga0501044_0087688 | 3300049823 | Bacteria | 3143 |
| 322 | Ga0501044_0128759 | 3300049823 | Bacteria | 2527 |
| 323 | Ga0501044_0161270 | 3300049823 | Bacteria | 2219 |
| 324 | Ga0501045_0000188 | 3300049824 | Bacteria | 34592 |
| 325 | nmdc:mga0k408_15724_c1 | 3300050493 | Bacteria | 4189 |
| 326 | nmdc:mga0k408_7375_c1 | 3300050493 | Bacteria | 5871 |
| 327 | nmdc:mga05p37_263164_c1 | 3300050507 | Bacteria | 2063 |
| 328 | nmdc:mga09592_7862_c1 | 3300050508 | Bacteria | 8668 |
| 329 | nmdc:mga0qj67_21373_c1 | 3300050509 | Bacteria | 4965 |
| 330 | nmdc:mga06r32_92176_c1 | 3300050510 | Bacteria | 2962 |
| 331 | Ga0500635_0001239 | 3300053080 | Bacteria | 6093 |
| 332 | Ga0500644_0000226 | 3300053088 | Bacteria | 32397 |
| 333 | Ga0500646_0002691 | 3300053090 | Bacteria | 4589 |
| 334 | Ga0500583_0000108 | 3300053092 | Bacteria | 41760 |
| 335 | Ga0500569_000134 | 3300053109 | Bacteria | 11684 |
| 336 | Ga0500607_049263 | 3300053121 | Unclassified | 2249 |
| 337 | Ga0500658_0006274 | 3300053134 | Bacteria | 4419 |
| 338 | Ga0500577_0000759 | 3300053142 | Bacteria | 8294 |
| 339 | Ga0500604_0004242 | 3300053151 | Bacteria | 3809 |
| 340 | Ga0500622_0000026 | 3300053156 | Bacteria | 235660 |
| 341 | Ga0500622_0000339 | 3300053156 | Bacteria | 46037 |
| 342 | Ga0500624_000346 | 3300053157 | Bacteria | 15210 |
| 343 | Ga0500634_0037534 | 3300053161 | Bacteria | 2635 |
| 344 | Ga0501082_0234955 | 3300060353 | Bacteria | 1595 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046665 | Ga0495661_0027088 | Ga0495661_0027088_2671_3669 | 332 |
| 2 | 3300003316 | rootH1_10117279 | rootH1_101172792 | 345 |
| 3 | 3300049822 | Ga0501035_0029571 | Ga0501035_0029571_31_1101 | 352 |
| 4 | 3300013104 | Ga0157370_10046733 | Ga0157370_100467333 | 363 |
| 5 | 3300038443 | Ga0395901_0001140 | Ga0395901_0001140_15374_16558 | 367 |
| 6 | 3300049568 | Ga0501031_0004611 | Ga0501031_0004611_1026_2174 | 377 |
| 7 | 3300049569 | Ga0501032_0002963 | Ga0501032_0002963_2014_3162 | 377 |
| 8 | 3300049570 | Ga0501033_0000022 | Ga0501033_0000022_74960_76108 | 377 |
| 9 | 3300049571 | Ga0501034_0000240 | Ga0501034_0000240_89326_90474 | 377 |
| 10 | 3300049572 | Ga0501036_0031237 | Ga0501036_0031237_2410_3558 | 377 |
| 11 | 3300049573 | Ga0501037_0004637 | Ga0501037_0004637_1340_2488 | 377 |
| 12 | 3300049575 | Ga0501039_0010184 | Ga0501039_0010184_4289_5437 | 377 |
| 13 | 3300049579 | Ga0501043_0001058 | Ga0501043_0001058_15351_16499 | 377 |
| 14 | 3300049822 | Ga0501035_0004585 | Ga0501035_0004585_5052_6200 | 377 |
| 15 | 3300049823 | Ga0501044_0002612 | Ga0501044_0002612_11640_12788 | 377 |
| 16 | 3300049824 | Ga0501045_0000188 | Ga0501045_0000188_26891_28039 | 377 |
| 17 | 3300003316 | rootH1_10022655 | rootH1_100226553 | 379 |
| 18 | 3300013102 | Ga0157371_10052757 | Ga0157371_100527573 | 379 |
| 19 | 3300053151 | Ga0500604_0004242 | Ga0500604_0004242_1467_2699 | 379 |
| 20 | 3300028381 | Ga0268264_10346404 | Ga0268264_103464042 | 380 |
| 21 | 3300014326 | Ga0157380_10000012 | Ga0157380_1000001261 | 381 |
| 22 | 3300049586 | Ga0501070_0205380 | Ga0501070_0205380_425_1606 | 382 |
| 23 | 3300031730 | Ga0307516_10000683 | Ga0307516_100006833 | 383 |
| 24 | 3300005327 | Ga0070658_10058439 | Ga0070658_100584391 | 384 |
| 25 | 3300005367 | Ga0070667_100037265 | Ga0070667_1000372654 | 385 |
| 26 | 3300025986 | Ga0207658_10025912 | Ga0207658_100259124 | 385 |
| 27 | 3300046454 | Ga0495592_0029157 | Ga0495592_0029157_2068_3321 | 386 |
| 28 | 3300049570 | Ga0501033_0071609 | Ga0501033_0071609_1285_2481 | 386 |
| 29 | 3300049571 | Ga0501034_0032340 | Ga0501034_0032340_3834_5030 | 386 |
| 30 | 3300031251 | Ga0265327_10003797 | Ga0265327_1000379711 | 387 |
| 31 | 3300003320 | rootH2_10069535 | rootH2_100695358 | 388 |
| 32 | 3300003322 | rootL2_10263470 | rootL2_102634701 | 388 |
| 33 | 3300005456 | Ga0070678_100137368 | Ga0070678_1001373682 | 388 |
| 34 | 3300005719 | Ga0068861_100024264 | Ga0068861_1000242641 | 388 |
| 35 | 3300026118 | Ga0207675_100266701 | Ga0207675_1002667011 | 388 |
| 36 | 3300053156 | Ga0500622_0000026 | Ga0500622_0000026_40170_41396 | 389 |
| 37 | 3300014325 | Ga0163163_10168215 | Ga0163163_101682151 | 390 |
| 38 | 3300003322 | rootL2_10026870 | rootL2_100268707 | 391 |
| 39 | 3300013308 | Ga0157375_10031613 | Ga0157375_100316133 | 391 |
| 40 | 3300014325 | Ga0163163_10025286 | Ga0163163_100252862 | 391 |
| 41 | 3300053092 | Ga0500583_0000108 | Ga0500583_0000108_33079_34317 | 392 |
| 42 | 3300005331 | Ga0070670_100032523 | Ga0070670_1000325234 | 393 |
| 43 | 3300005563 | Ga0068855_100025564 | Ga0068855_1000255643 | 393 |
| 44 | 3300005983 | Ga0081540_1021413 | Ga0081540_10214133 | 393 |
| 45 | 3300009545 | Ga0105237_10012955 | Ga0105237_100129554 | 393 |
| 46 | 3300009553 | Ga0105249_10000887 | Ga0105249_1000088721 | 393 |
| 47 | 3300010375 | Ga0105239_10000457 | Ga0105239_100004578 | 393 |
| 48 | 3300013102 | Ga0157371_10014170 | Ga0157371_100141702 | 393 |
| 49 | 3300014325 | Ga0163163_10123618 | Ga0163163_101236183 | 393 |
| 50 | 3300025914 | Ga0207671_10005384 | Ga0207671_100053847 | 393 |
| 51 | 3300025949 | Ga0207667_10123545 | Ga0207667_101235451 | 393 |
| 52 | 3300025961 | Ga0207712_10002645 | Ga0207712_100026452 | 393 |
| 53 | 3300026095 | Ga0207676_10021656 | Ga0207676_100216562 | 393 |
| 54 | 3300049758 | Ga0501241_000122 | Ga0501241_000122_5504_6718 | 393 |
| 55 | 3300013296 | Ga0157374_10000007 | Ga0157374_10000007166 | 394 |
| 56 | 3300013307 | Ga0157372_10007751 | Ga0157372_100077512 | 394 |
| 57 | 3300014969 | Ga0157376_10003394 | Ga0157376_100033946 | 394 |
| 58 | 3300044656 | Ga0466969_0065733 | Ga0466969_0065733_96_1334 | 394 |
| 59 | 3300044693 | Ga0466961_0018482 | Ga0466961_0018482_303_1541 | 394 |
| 60 | 3300044719 | Ga0466971_0007139 | Ga0466971_0007139_1028_2266 | 394 |
| 61 | 3300046694 | Ga0495649_0029817 | Ga0495649_0029817_1580_2815 | 394 |
| 62 | 3300003320 | rootH2_10047580 | rootH2_1004758016 | 395 |
| 63 | 3300005535 | Ga0070684_100002223 | Ga0070684_1000022237 | 395 |
| 64 | 3300005563 | Ga0068855_100000424 | Ga0068855_10000042436 | 395 |
| 65 | 3300005578 | Ga0068854_100106775 | Ga0068854_1001067752 | 395 |
| 66 | 3300005616 | Ga0068852_100176858 | Ga0068852_1001768582 | 395 |
| 67 | 3300010375 | Ga0105239_10036772 | Ga0105239_100367724 | 395 |
| 68 | 3300013104 | Ga0157370_10011684 | Ga0157370_100116847 | 395 |
| 69 | 3300025913 | Ga0207695_10000130 | Ga0207695_1000013052 | 395 |
| 70 | 3300025949 | Ga0207667_10004780 | Ga0207667_100047804 | 395 |
| 71 | 3300028573 | Ga0265334_10007635 | Ga0265334_100076352 | 395 |
| 72 | 3300047472 | Ga0495686_0000034 | Ga0495686_0000034_198960_200183 | 395 |
| 73 | 3300050493 | nmdc:mga0k408_7375_c1 | nmdc:mga0k408_7375_c1_201_1442 | 395 |
| 74 | iso_pu_bacteria | 2896109856 | 2896112116 | 395 |
| 75 | iso_pu_bacteria | 2911138879 | 2911143902 | 395 |
| 76 | 3300005466 | Ga0070685_10006752 | Ga0070685_100067522 | 396 |
| 77 | 3300031456 | Ga0307513_10265266 | Ga0307513_102652661 | 396 |
| 78 | 3300049571 | Ga0501034_0006140 | Ga0501034_0006140_4556_5782 | 396 |
| 79 | iso_pu_bacteria | 2896085136 | 2896088151 | 396 |
| 80 | 3300003323 | rootH1_10008448 | rootH1_100084485 | 397 |
| 81 | 3300005841 | Ga0068863_100309820 | Ga0068863_1003098201 | 397 |
| 82 | 3300006844 | Ga0075428_100151108 | Ga0075428_1001511083 | 397 |
| 83 | 3300009093 | Ga0105240_10000486 | Ga0105240_1000048660 | 397 |
| 84 | 3300009093 | Ga0105240_10001336 | Ga0105240_1000133630 | 397 |
| 85 | 3300025913 | Ga0207695_10000170 | Ga0207695_10000170115 | 397 |
| 86 | 3300025913 | Ga0207695_10004097 | Ga0207695_100040973 | 397 |
| 87 | 3300037312 | Ga0395899_0000064 | Ga0395899_0000064_73745_74953 | 397 |
| 88 | 3300039437 | Ga0436365_0062569 | Ga0436365_0062569_6276_7508 | 397 |
| 89 | iso_pu_bacteria | 2914759650 | 2914760053 | 397 |
| 90 | iso_pu_bacteria | 2929239360 | 2929244694 | 397 |
| 91 | 3300003354 | JGI25160J50197_1000790 | JGI25160J50197_100079011 | 398 |
| 92 | 3300025302 | Ga0207426_1000019 | Ga0207426_1000019152 | 398 |
| 93 | 3300050508 | nmdc:mga09592_7862_c1 | nmdc:mga09592_7862_c1_3808_5025 | 398 |
| 94 | 3300050509 | nmdc:mga0qj67_21373_c1 | nmdc:mga0qj67_21373_c1_2739_3956 | 398 |
| 95 | 3300050510 | nmdc:mga06r32_92176_c1 | nmdc:mga06r32_92176_c1_830_2047 | 398 |
| 96 | 3300053156 | Ga0500622_0000339 | Ga0500622_0000339_18892_20130 | 398 |
| 97 | 3300003323 | rootH1_10100719 | rootH1_101007199 | 399 |
| 98 | 3300005614 | Ga0068856_100067175 | Ga0068856_1000671752 | 399 |
| 99 | 3300010375 | Ga0105239_10001481 | Ga0105239_1000148115 | 399 |
| 100 | 3300013306 | Ga0163162_10017517 | Ga0163162_100175178 | 399 |
| 101 | 3300025913 | Ga0207695_10069270 | Ga0207695_100692702 | 399 |
| 102 | 3300026041 | Ga0207639_10016973 | Ga0207639_100169733 | 399 |
| 103 | 3300026078 | Ga0207702_10047656 | Ga0207702_100476562 | 399 |
| 104 | 3300028786 | Ga0307517_10006013 | Ga0307517_100060134 | 399 |
| 105 | 3300044658 | Ga0466972_0000040 | Ga0466972_0000040_99585_100832 | 399 |
| 106 | 3300047320 | Ga0495672_0022252 | Ga0495672_0022252_2490_3737 | 399 |
| 107 | iso_pu_bacteria | 2977232053 | 2977234687 | 399 |
| 108 | 3300003320 | rootH2_10115320 | rootH2_101153202 | 400 |
| 109 | 3300003761 | Ga0055535_1003565 | Ga0055535_10035653 | 400 |
| 110 | 3300005262 | Ga0065165_1001522 | Ga0065165_10015227 | 400 |
| 111 | 3300005539 | Ga0068853_100000393 | Ga0068853_10000039321 | 400 |
| 112 | 3300005719 | Ga0068861_100094601 | Ga0068861_1000946012 | 400 |
| 113 | 3300006237 | Ga0097621_100047074 | Ga0097621_1000470741 | 400 |
| 114 | 3300013104 | Ga0157370_10026119 | Ga0157370_100261192 | 400 |
| 115 | 3300025242 | Ga0209258_100326 | Ga0209258_10032647 | 400 |
| 116 | 3300025254 | Ga0209148_1000157 | Ga0209148_100015724 | 400 |
| 117 | 3300025925 | Ga0207650_10035628 | Ga0207650_100356282 | 400 |
| 118 | 3300033180 | Ga0307510_10010080 | Ga0307510_100100805 | 400 |
| 119 | 3300036401 | Ga0373937_0075296 | Ga0373937_0075296_669_1940 | 400 |
| 120 | 3300041997 | Ga0439431_0006375 | Ga0439431_0006375_283_1512 | 400 |
| 121 | 3300045051 | Ga0451576_0000003 | Ga0451576_0000003_165686_166906 | 400 |
| 122 | 3300046507 | Ga0495606_0007729 | Ga0495606_0007729_26_1228 | 400 |
| 123 | 3300048924 | Ga0496121_0000028 | Ga0496121_0000028_94342_95580 | 400 |
| 124 | 3300049569 | Ga0501032_0004450 | Ga0501032_0004450_8187_9449 | 400 |
| 125 | 3300053088 | Ga0500644_0000226 | Ga0500644_0000226_20685_21926 | 400 |
| 126 | 3300053090 | Ga0500646_0002691 | Ga0500646_0002691_2491_3732 | 400 |
| 127 | 3300053109 | Ga0500569_000134 | Ga0500569_000134_7749_8990 | 400 |
| 128 | 3300053121 | Ga0500607_049263 | Ga0500607_049263_532_1773 | 400 |
| 129 | 3300053134 | Ga0500658_0006274 | Ga0500658_0006274_1746_2987 | 400 |
| 130 | 3300053142 | Ga0500577_0000759 | Ga0500577_0000759_5814_7055 | 400 |
| 131 | 3300053161 | Ga0500634_0037534 | Ga0500634_0037534_594_1835 | 400 |
| 132 | 3300003322 | rootL2_10135105 | rootL2_101351052 | 401 |
| 133 | 3300003322 | rootL2_10195979 | rootL2_101959792 | 401 |
| 134 | 3300013296 | Ga0157374_10113912 | Ga0157374_101139122 | 401 |
| 135 | 3300036712 | Ga0316584_0016023 | Ga0316584_0016023_651_1907 | 401 |
| 136 | 3300046616 | Ga0495668_0002689 | Ga0495668_0002689_8867_10120 | 401 |
| 137 | 3300049574 | Ga0501038_0020146 | Ga0501038_0020146_3615_4871 | 401 |
| 138 | 3300049823 | Ga0501044_0161270 | Ga0501044_0161270_695_1933 | 401 |
| 139 | 3300003316 | rootH1_10123087 | rootH1_101230873 | 402 |
| 140 | 3300003322 | rootL2_10019581 | rootL2_100195813 | 402 |
| 141 | 3300003322 | rootL2_10069142 | rootL2_100691426 | 402 |
| 142 | 3300005614 | Ga0068856_100088073 | Ga0068856_1000880732 | 402 |
| 143 | 3300009545 | Ga0105237_10002069 | Ga0105237_100020692 | 402 |
| 144 | 3300025914 | Ga0207671_10031769 | Ga0207671_100317692 | 402 |
| 145 | 3300026078 | Ga0207702_10066598 | Ga0207702_100665982 | 402 |
| 146 | 3300005844 | Ga0068862_100230763 | Ga0068862_1002307632 | 403 |
| 147 | 3300006844 | Ga0075428_100004227 | Ga0075428_1000042279 | 403 |
| 148 | 3300006846 | Ga0075430_100000903 | Ga0075430_10000090311 | 403 |
| 149 | 3300006847 | Ga0075431_100001482 | Ga0075431_10000148222 | 403 |
| 150 | 3300006880 | Ga0075429_100003075 | Ga0075429_1000030759 | 403 |
| 151 | 3300009147 | Ga0114129_10257260 | Ga0114129_102572602 | 403 |
| 152 | 3300013308 | Ga0157375_10033780 | Ga0157375_100337803 | 403 |
| 153 | 3300014326 | Ga0157380_10175915 | Ga0157380_101759151 | 403 |
| 154 | 3300014745 | Ga0157377_10108998 | Ga0157377_101089982 | 403 |
| 155 | 3300014968 | Ga0157379_10103360 | Ga0157379_101033602 | 403 |
| 156 | 3300014969 | Ga0157376_10247063 | Ga0157376_102470632 | 403 |
| 157 | 3300025246 | Ga0209646_1000829 | Ga0209646_10008295 | 403 |
| 158 | 3300048908 | Ga0496105_0162763 | Ga0496105_0162763_83_1363 | 403 |
| 159 | 3300003322 | rootL2_10054063 | rootL2_100540632 | 404 |
| 160 | 3300005290 | Ga0065712_10068102 | Ga0065712_100681026 | 404 |
| 161 | 3300005338 | Ga0068868_100029988 | Ga0068868_1000299883 | 404 |
| 162 | 3300005339 | Ga0070660_100088322 | Ga0070660_1000883222 | 404 |
| 163 | 3300005340 | Ga0070689_100014800 | Ga0070689_1000148003 | 404 |
| 164 | 3300005356 | Ga0070674_100007210 | Ga0070674_1000072105 | 404 |
| 165 | 3300005366 | Ga0070659_100000120 | Ga0070659_10000012048 | 404 |
| 166 | 3300005367 | Ga0070667_100189070 | Ga0070667_1001890702 | 404 |
| 167 | 3300005456 | Ga0070678_100039769 | Ga0070678_1000397693 | 404 |
| 168 | 3300005457 | Ga0070662_100071105 | Ga0070662_1000711052 | 404 |
| 169 | 3300005466 | Ga0070685_10000872 | Ga0070685_1000087210 | 404 |
| 170 | 3300005466 | Ga0070685_10015858 | Ga0070685_100158585 | 404 |
| 171 | 3300005471 | Ga0070698_100006230 | Ga0070698_1000062308 | 404 |
| 172 | 3300005543 | Ga0070672_100186805 | Ga0070672_1001868052 | 404 |
| 173 | 3300005719 | Ga0068861_100246346 | Ga0068861_1002463462 | 404 |
| 174 | 3300005841 | Ga0068863_100003469 | Ga0068863_1000034699 | 404 |
| 175 | 3300005842 | Ga0068858_100104828 | Ga0068858_1001048283 | 404 |
| 176 | 3300006844 | Ga0075428_100078709 | Ga0075428_1000787094 | 404 |
| 177 | 3300006880 | Ga0075429_100007210 | Ga0075429_1000072105 | 404 |
| 178 | 3300009147 | Ga0114129_10246787 | Ga0114129_102467872 | 404 |
| 179 | 3300009176 | Ga0105242_10033854 | Ga0105242_100338543 | 404 |
| 180 | 3300009177 | Ga0105248_10226529 | Ga0105248_102265292 | 404 |
| 181 | 3300009553 | Ga0105249_10006490 | Ga0105249_100064906 | 404 |
| 182 | 3300013296 | Ga0157374_10053557 | Ga0157374_100535573 | 404 |
| 183 | 3300013297 | Ga0157378_10006118 | Ga0157378_100061186 | 404 |
| 184 | 3300013306 | Ga0163162_10170425 | Ga0163162_101704252 | 404 |
| 185 | 3300013308 | Ga0157375_10337726 | Ga0157375_103377262 | 404 |
| 186 | 3300014326 | Ga0157380_10039459 | Ga0157380_100394593 | 404 |
| 187 | 3300014326 | Ga0157380_10218166 | Ga0157380_102181662 | 404 |
| 188 | 3300014745 | Ga0157377_10108100 | Ga0157377_101081001 | 404 |
| 189 | 3300014968 | Ga0157379_10223377 | Ga0157379_102233772 | 404 |
| 190 | 3300017792 | Ga0163161_10004535 | Ga0163161_100045352 | 404 |
| 191 | 3300017792 | Ga0163161_10125461 | Ga0163161_101254612 | 404 |
| 192 | 3300025907 | Ga0207645_10000713 | Ga0207645_1000071320 | 404 |
| 193 | 3300025908 | Ga0207643_10037126 | Ga0207643_100371262 | 404 |
| 194 | 3300025919 | Ga0207657_10095424 | Ga0207657_100954242 | 404 |
| 195 | 3300025925 | Ga0207650_10038722 | Ga0207650_100387224 | 404 |
| 196 | 3300025932 | Ga0207690_10000133 | Ga0207690_1000013333 | 404 |
| 197 | 3300025933 | Ga0207706_10007072 | Ga0207706_100070729 | 404 |
| 198 | 3300025934 | Ga0207686_10003787 | Ga0207686_100037874 | 404 |
| 199 | 3300025937 | Ga0207669_10028212 | Ga0207669_100282121 | 404 |
| 200 | 3300025940 | Ga0207691_10027955 | Ga0207691_100279553 | 404 |
| 201 | 3300025942 | Ga0207689_10008218 | Ga0207689_100082185 | 404 |
| 202 | 3300025960 | Ga0207651_10053300 | Ga0207651_100533003 | 404 |
| 203 | 3300025960 | Ga0207651_10109560 | Ga0207651_101095601 | 404 |
| 204 | 3300025960 | Ga0207651_10167156 | Ga0207651_101671561 | 404 |
| 205 | 3300025961 | Ga0207712_10001189 | Ga0207712_100011898 | 404 |
| 206 | 3300025961 | Ga0207712_10004451 | Ga0207712_100044518 | 404 |
| 207 | 3300025986 | Ga0207658_10101591 | Ga0207658_101015912 | 404 |
| 208 | 3300026023 | Ga0207677_10086163 | Ga0207677_100861632 | 404 |
| 209 | 3300026088 | Ga0207641_10000601 | Ga0207641_1000060127 | 404 |
| 210 | 3300026089 | Ga0207648_10006817 | Ga0207648_100068173 | 404 |
| 211 | 3300026095 | Ga0207676_10040155 | Ga0207676_100401552 | 404 |
| 212 | 3300026118 | Ga0207675_100059328 | Ga0207675_1000593283 | 404 |
| 213 | 3300026121 | Ga0207683_10008436 | Ga0207683_100084363 | 404 |
| 214 | 3300044842 | Ga0466957_0001910 | Ga0466957_0001910_585_1847 | 404 |
| 215 | 3300049823 | Ga0501044_0087688 | Ga0501044_0087688_38_1285 | 404 |
| 216 | 3300050507 | nmdc:mga05p37_263164_c1 | nmdc:mga05p37_263164_c1_461_1702 | 404 |
| 217 | 3300003320 | rootH2_10013019 | rootH2_100130196 | 405 |
| 218 | 3300006237 | Ga0097621_100007287 | Ga0097621_1000072875 | 405 |
| 219 | 3300006358 | Ga0068871_100131051 | Ga0068871_1001310512 | 405 |
| 220 | 3300013306 | Ga0163162_10022032 | Ga0163162_100220323 | 405 |
| 221 | 3300014969 | Ga0157376_10006238 | Ga0157376_100062386 | 405 |
| 222 | 3300014969 | Ga0157376_10094455 | Ga0157376_100944552 | 405 |
| 223 | 3300046648 | Ga0495611_0000252 | Ga0495611_0000252_6744_8021 | 405 |
| 224 | 3300005614 | Ga0068856_100000040 | Ga0068856_100000040101 | 406 |
| 225 | 3300009174 | Ga0105241_10261945 | Ga0105241_102619451 | 406 |
| 226 | 3300009545 | Ga0105237_10035921 | Ga0105237_100359213 | 406 |
| 227 | 3300010375 | Ga0105239_10032023 | Ga0105239_100320235 | 406 |
| 228 | 3300025911 | Ga0207654_10145485 | Ga0207654_101454852 | 406 |
| 229 | 3300025914 | Ga0207671_10074512 | Ga0207671_100745122 | 406 |
| 230 | 3300026078 | Ga0207702_10000042 | Ga0207702_1000004273 | 406 |
| 231 | 3300037312 | Ga0395899_0000050 | Ga0395899_0000050_145911_147137 | 406 |
| 232 | 3300046472 | Ga0495580_0153923 | Ga0495580_0153923_216_1502 | 406 |
| 233 | 3300037418 | Ga0395900_0053385 | Ga0395900_0053385_1815_3071 | 407 |
| 234 | 3300049569 | Ga0501032_0027857 | Ga0501032_0027857_1749_3041 | 407 |
| 235 | 3300049571 | Ga0501034_0009250 | Ga0501034_0009250_2629_3921 | 407 |
| 236 | 3300049572 | Ga0501036_0025452 | Ga0501036_0025452_2104_3396 | 407 |
| 237 | 3300049579 | Ga0501043_0005283 | Ga0501043_0005283_2083_3375 | 407 |
| 238 | 3300049823 | Ga0501044_0005431 | Ga0501044_0005431_10877_12169 | 407 |
| 239 | 3300005336 | Ga0070680_100000075 | Ga0070680_10000007530 | 408 |
| 240 | 3300005337 | Ga0070682_100000628 | Ga0070682_10000062820 | 408 |
| 241 | 3300005339 | Ga0070660_100051817 | Ga0070660_1000518173 | 408 |
| 242 | 3300005341 | Ga0070691_10000522 | Ga0070691_100005228 | 408 |
| 243 | 3300005366 | Ga0070659_100013534 | Ga0070659_1000135343 | 408 |
| 244 | 3300005458 | Ga0070681_10089677 | Ga0070681_100896772 | 408 |
| 245 | 3300005530 | Ga0070679_100000892 | Ga0070679_10000089211 | 408 |
| 246 | 3300005530 | Ga0070679_100117630 | Ga0070679_1001176302 | 408 |
| 247 | 3300005539 | Ga0068853_100004852 | Ga0068853_1000048523 | 408 |
| 248 | 3300005563 | Ga0068855_100001368 | Ga0068855_10000136810 | 408 |
| 249 | 3300005563 | Ga0068855_100002033 | Ga0068855_1000020335 | 408 |
| 250 | 3300005563 | Ga0068855_100154396 | Ga0068855_1001543961 | 408 |
| 251 | 3300009093 | Ga0105240_10038372 | Ga0105240_100383723 | 408 |
| 252 | 3300009174 | Ga0105241_10008261 | Ga0105241_100082612 | 408 |
| 253 | 3300013102 | Ga0157371_10000943 | Ga0157371_1000094317 | 408 |
| 254 | 3300013104 | Ga0157370_10000238 | Ga0157370_1000023827 | 408 |
| 255 | 3300013104 | Ga0157370_10000426 | Ga0157370_1000042630 | 408 |
| 256 | 3300025911 | Ga0207654_10078168 | Ga0207654_100781681 | 408 |
| 257 | 3300025912 | Ga0207707_10000111 | Ga0207707_1000011130 | 408 |
| 258 | 3300025913 | Ga0207695_10022478 | Ga0207695_100224786 | 408 |
| 259 | 3300025917 | Ga0207660_10062136 | Ga0207660_100621362 | 408 |
| 260 | 3300025919 | Ga0207657_10153349 | Ga0207657_101533492 | 408 |
| 261 | 3300025921 | Ga0207652_10011666 | Ga0207652_100116662 | 408 |
| 262 | 3300025949 | Ga0207667_10004397 | Ga0207667_1000439710 | 408 |
| 263 | 3300025949 | Ga0207667_10038464 | Ga0207667_100384642 | 408 |
| 264 | 3300025949 | Ga0207667_10120322 | Ga0207667_101203221 | 408 |
| 265 | 3300037312 | Ga0395899_0029301 | Ga0395899_0029301_1931_3202 | 408 |
| 266 | 3300037466 | Ga0395898_0010807 | Ga0395898_0010807_939_2210 | 408 |
| 267 | 3300038443 | Ga0395901_0002041 | Ga0395901_0002041_10664_11935 | 408 |
| 268 | 3300046665 | Ga0495661_0006331 | Ga0495661_0006331_1421_2656 | 408 |
| 269 | 3300049580 | Ga0501046_0098238 | Ga0501046_0098238_150_1445 | 408 |
| 270 | 3300049589 | Ga0501073_0014748 | Ga0501073_0014748_3008_4303 | 408 |
| 271 | 3300049590 | Ga0501074_0067528 | Ga0501074_0067528_914_2209 | 408 |
| 272 | 3300049742 | Ga0501080_0302417 | Ga0501080_0302417_18_1313 | 408 |
| 273 | 3300049744 | Ga0501083_0048744 | Ga0501083_0048744_468_1763 | 408 |
| 274 | 3300049823 | Ga0501044_0128759 | Ga0501044_0128759_269_1564 | 408 |
| 275 | 3300053080 | Ga0500635_0001239 | Ga0500635_0001239_2923_4149 | 408 |
| 276 | 3300060353 | Ga0501082_0234955 | Ga0501082_0234955_284_1579 | 408 |
| 277 | 3300002067 | JGI24735J21928_10007016 | JGI24735J21928_100070165 | 409 |
| 278 | 3300005339 | Ga0070660_100003934 | Ga0070660_1000039349 | 409 |
| 279 | 3300009093 | Ga0105240_10153861 | Ga0105240_101538612 | 409 |
| 280 | 3300010375 | Ga0105239_10000014 | Ga0105239_1000001488 | 409 |
| 281 | 3300013100 | Ga0157373_10002671 | Ga0157373_1000267111 | 409 |
| 282 | 3300013102 | Ga0157371_10000121 | Ga0157371_1000012191 | 409 |
| 283 | 3300013104 | Ga0157370_10016232 | Ga0157370_100162325 | 409 |
| 284 | 3300013105 | Ga0157369_10128628 | Ga0157369_101286283 | 409 |
| 285 | 3300013307 | Ga0157372_10000075 | Ga0157372_1000007578 | 409 |
| 286 | 3300013307 | Ga0157372_10155941 | Ga0157372_101559412 | 409 |
| 287 | 3300025261 | Ga0209233_1002514 | Ga0209233_10025145 | 409 |
| 288 | 3300025904 | Ga0207647_10000601 | Ga0207647_100006014 | 409 |
| 289 | 3300025909 | Ga0207705_10084079 | Ga0207705_100840791 | 409 |
| 290 | 3300025913 | Ga0207695_10059521 | Ga0207695_100595213 | 409 |
| 291 | 3300025919 | Ga0207657_10002022 | Ga0207657_100020225 | 409 |
| 292 | 3300047472 | Ga0495686_0000748 | Ga0495686_0000748_21115_22344 | 409 |
| 293 | iso_pu_bacteria | 2599185184 | 2599479801 | 409 |
| 294 | iso_pu_bacteria | 2919437846 | 2919439514 | 409 |
| 295 | iso_pu_bacteria | 2928078545 | 2928084105 | 409 |
| 296 | iso_pu_bacteria | 2928147474 | 2928153069 | 409 |
| 297 | iso_pu_bacteria | 2932082852 | 2932086976 | 409 |
| 298 | 3300005288 | Ga0065714_10021152 | Ga0065714_100211521 | 410 |
| 299 | 3300026078 | Ga0207702_10043172 | Ga0207702_100431724 | 410 |
| 300 | 3300046507 | Ga0495606_0006370 | Ga0495606_0006370_2707_3942 | 410 |
| 301 | 3300053157 | Ga0500624_000346 | Ga0500624_000346_11647_12879 | 410 |
| 302 | 3300009093 | Ga0105240_10014457 | Ga0105240_1001445712 | 411 |
| 303 | 3300009093 | Ga0105240_10232607 | Ga0105240_102326071 | 411 |
| 304 | 3300009545 | Ga0105237_10000400 | Ga0105237_100004002 | 411 |
| 305 | 3300009545 | Ga0105237_10007738 | Ga0105237_1000773813 | 411 |
| 306 | 3300010375 | Ga0105239_10001703 | Ga0105239_100017037 | 411 |
| 307 | 3300025272 | Ga0209455_1001743 | Ga0209455_10017434 | 411 |
| 308 | 3300025913 | Ga0207695_10000267 | Ga0207695_1000026758 | 411 |
| 309 | 3300025914 | Ga0207671_10000244 | Ga0207671_1000024444 | 411 |
| 310 | 3300002737 | JGI25162J39368_1000086 | JGI25162J39368_1000086104 | 412 |
| 311 | 3300005578 | Ga0068854_100027376 | Ga0068854_1000273763 | 412 |
| 312 | 3300009093 | Ga0105240_10078599 | Ga0105240_100785992 | 412 |
| 313 | 3300009093 | Ga0105240_10366139 | Ga0105240_103661392 | 412 |
| 314 | 3300009545 | Ga0105237_10030263 | Ga0105237_100302632 | 412 |
| 315 | 3300009545 | Ga0105237_10031518 | Ga0105237_100315182 | 412 |
| 316 | 3300010375 | Ga0105239_10003895 | Ga0105239_100038957 | 412 |
| 317 | 3300010375 | Ga0105239_10023003 | Ga0105239_100230036 | 412 |
| 318 | 3300025233 | Ga0209437_100144 | Ga0209437_1001445 | 412 |
| 319 | 3300025913 | Ga0207695_10118949 | Ga0207695_101189493 | 412 |
| 320 | 3300025914 | Ga0207671_10013461 | Ga0207671_100134612 | 412 |
| 321 | 3300025914 | Ga0207671_10015710 | Ga0207671_100157104 | 412 |
| 322 | 3300025981 | Ga0207640_10009334 | Ga0207640_100093345 | 412 |
| 323 | 3300046492 | Ga0495585_0000097 | Ga0495585_0000097_35750_36988 | 412 |
| 324 | 3300046810 | Ga0495660_0003749 | Ga0495660_0003749_3690_4928 | 412 |
| 325 | 3300047472 | Ga0495686_0000249 | Ga0495686_0000249_67360_68604 | 412 |
| 326 | 3300001990 | JGI24737J22298_10009113 | JGI24737J22298_100091133 | 413 |
| 327 | 3300002067 | JGI24735J21928_10000007 | JGI24735J21928_10000007160 | 413 |
| 328 | 3300003316 | rootH1_10055794 | rootH1_100557944 | 413 |
| 329 | 3300005563 | Ga0068855_100036848 | Ga0068855_1000368482 | 413 |
| 330 | 3300006195 | Ga0075366_10006224 | Ga0075366_100062245 | 413 |
| 331 | 3300010375 | Ga0105239_10200895 | Ga0105239_102008952 | 413 |
| 332 | 3300013105 | Ga0157369_10075089 | Ga0157369_100750892 | 413 |
| 333 | 3300013306 | Ga0163162_10002921 | Ga0163162_1000292113 | 413 |
| 334 | 3300025949 | Ga0207667_10030351 | Ga0207667_100303516 | 413 |
| 335 | 3300046471 | Ga0495650_0000236 | Ga0495650_0000236_37476_38717 | 413 |
| 336 | 3300046492 | Ga0495585_0000111 | Ga0495585_0000111_84570_85829 | 413 |
| 337 | 3300046506 | Ga0495583_0008651 | Ga0495583_0008651_4934_6175 | 413 |
| 338 | 3300046507 | Ga0495606_0000036 | Ga0495606_0000036_106008_107249 | 413 |
| 339 | 3300046507 | Ga0495606_0015038 | Ga0495606_0015038_2943_4184 | 413 |
| 340 | 3300046512 | Ga0495610_0000500 | Ga0495610_0000500_15716_16957 | 413 |
| 341 | 3300046513 | Ga0495616_0000821 | Ga0495616_0000821_16600_17844 | 413 |
| 342 | 3300046513 | Ga0495616_0002784 | Ga0495616_0002784_5760_7007 | 413 |
| 343 | 3300046524 | Ga0495648_0001819 | Ga0495648_0001819_164_1417 | 413 |
| 344 | 3300046524 | Ga0495648_0023734 | Ga0495648_0023734_2328_3578 | 413 |
| 345 | 3300046558 | Ga0495633_0017809 | Ga0495633_0017809_1424_2665 | 413 |
| 346 | 3300046616 | Ga0495668_0045179 | Ga0495668_0045179_539_1786 | 413 |
| 347 | 3300046660 | Ga0495625_0000110 | Ga0495625_0000110_119325_120572 | 413 |
| 348 | 3300046660 | Ga0495625_0004018 | Ga0495625_0004018_12654_13907 | 413 |
| 349 | 3300046665 | Ga0495661_0015450 | Ga0495661_0015450_2630_3871 | 413 |
| 350 | 3300046683 | Ga0495658_0008802 | Ga0495658_0008802_3747_5000 | 413 |
| 351 | 3300046694 | Ga0495649_0000011 | Ga0495649_0000011_368173_369420 | 413 |
| 352 | 3300047443 | Ga0495687_005362 | Ga0495687_005362_759_2000 | 413 |
| 353 | 3300047469 | Ga0495673_0024700 | Ga0495673_0024700_330_1577 | 413 |
| 354 | 3300049459 | Ga0495678_021035 | Ga0495678_021035_54_1298 | 413 |
| 355 | 3300050493 | nmdc:mga0k408_15724_c1 | nmdc:mga0k408_15724_c1_1065_2306 | 413 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3or5-assembly1.cif.gz_A | crystal structure of thiol:disulfide interchange protein, thioredoxin family protein from chlorobium tepidum tls | 0.8271 | 249 | 407 |
| 2h1g-assembly1.cif.gz_A | resa c74a/c77a | 0.8241 | 248 | 395 |
| 2h19-assembly2.cif.gz_B | crystal structure of resa cys77ala variant | 0.8157 | 248 | 396 |
| 1st9-assembly2.cif.gz_B | crystal structure of a soluble domain of resa in the oxidised form | 0.8105 | 248 | 396 |
| 3c71-assembly1.cif.gz_A | structure of a resa variant with a dsba-like active site motif (cphc) | 0.8048 | 248 | 395 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3gl3B00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8262 | 244 | 409 | 3.40.30.10 |
| 3gl3B00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8207 | 244 | 409 | 3.40.30.10 |
| 3or5A00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8109 | 249 | 406 | 3.40.30.10 |
| 1st9A00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8069 | 248 | 396 | 3.40.30.10 |
| af_Q54IQ1_93_203_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.7947 | 272 | 408 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A494W717-F1-model_v4 | TlpA family protein disulfide reductase | 0.9873 | 16 | 413 |
GO:0016491
GO:0017004 |
| AF-A0A7W1EZ68-F1-model_v4 | TlpA family protein disulfide reductase | 0.9816 | 241 | 409 |
GO:0016491
GO:0017004 |
| AF-A0A7W1SMK8-F1-model_v4 | TlpA family protein disulfide reductase | 0.9816 | 257 | 410 |
GO:0016491
GO:0017004 |
| AF-A0A4Q5QFV3-F1-model_v4 | TlpA family protein disulfide reductase | 0.9798 | 23 | 211 |
|
| AF-A0A4Q6E026-F1-model_v4 | TlpA family protein disulfide reductase | 0.9792 | 121 | 409 |
GO:0016491
GO:0017004 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar