F420040

General Info

Members Datasets Scaffolds Average Seq Length
355 202 344 412

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10089677|Ga0070681_100896772
Length 459
Sequence MGRSGNIVRRLTFVTRQLFVNLPPIVPAIMIRTIRIFCPAVSFLYILLSLPLFNVQACPAGGGAGASQKDYPPNGIWQASIIRKDGQFIRFNFEMKDSAGKKILYIMNGKERLLADNIRQQEDSLFIEMPFFDSRFALRIYDDDKLEGNWIKNYGHRQVIMPFRAFRNETKRFSVSRQPLFNITGRWSVHFREKNQTTEEAVGEFRQSGSEITGTFLTTTGDYRFLEGVVDGDSLRLSTFDGGHAYYFTAKIDAADKISGGAFYSGATSKEGWQAEKNEHAALPDEFSLTTLKNPHDDRLNFTFRSTDGPLVSINDKAFKNKVVIVQIMGSWCPNCMDETRFLSDYYKKNKARGIEIIALAYERTPNFDESRKSLQSFKNRFDVTYPVLVTPVALNDSLRTEKTLPQIKKILGFPTTIFIDKAGKVRKISTGFNGPGTGDHYEIFKKEFNELVNGLLKE

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
3 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
4 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
5 2914759650 Rhizosphaericola mali Isolate Rhizosphere
6 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
7 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
8 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
9 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
10 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
11 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
12 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
13 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
14 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
15 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
19 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
20 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
84 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
86 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
88 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
123 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
124 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
125 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
126 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
127 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
130 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
136 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
137 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
138 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
139 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
140 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
141 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
142 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
143 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
144 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
145 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
146 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
147 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
148 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
149 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
150 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
151 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
152 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
153 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
154 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
155 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
156 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
157 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
158 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
159 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
160 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
161 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
162 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
163 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
164 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
165 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
166 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
177 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
178 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
179 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
180 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
181 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
182 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
185 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
186 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
187 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
188 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
189 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
190 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
191 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
192 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
193 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
194 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
195 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
196 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
197 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
198 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
199 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
200 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
201 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
202 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.9
Metatranscriptomes 0
Isolates 3.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.32
Nodule 0
Rhizoplane 0.56
Rhizosphere 83.94
Stem 0
Stem Tuber 0
Unclassified 8.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10009113 3300001990 Bacteria 3307
2 JGI24735J21928_10000007 3300002067 Bacteria 333510
3 JGI24735J21928_10007016 3300002067 Bacteria 3682
4 JGI25162J39368_1000086 3300002737 Bacteria 107401
5 rootH1_10022655 3300003316 Unclassified 2391
6 rootH1_10055794 3300003316 Bacteria 3992
7 rootH1_10117279 3300003316 Unclassified 1555
8 rootH1_10123087 3300003316 Bacteria 3780
9 rootH2_10013019 3300003320 Bacteria 26132
10 rootH2_10047580 3300003320 Bacteria 23351
11 rootH2_10069535 3300003320 Bacteria 11638
12 rootH2_10115320 3300003320 Bacteria 2864
13 rootL2_10019581 3300003322 Bacteria 4375
14 rootL2_10026870 3300003322 Bacteria 9958
15 rootL2_10054063 3300003322 Bacteria 2667
16 rootL2_10069142 3300003322 Bacteria 8171
17 rootL2_10135105 3300003322 Bacteria 5007
18 rootL2_10195979 3300003322 Bacteria 3753
19 rootL2_10263470 3300003322 Bacteria 1583
20 rootH1_10008448 3300003323 Bacteria 25690
21 rootH1_10100719 3300003323 Bacteria 10062
22 JGI25160J50197_1000790 3300003354 Bacteria 17009
23 Ga0055535_1003565 3300003761 Bacteria 4314
24 Ga0065165_1001522 3300005262 Bacteria 24416
25 Ga0065714_10021152 3300005288 Bacteria 2043
26 Ga0065712_10068102 3300005290 Bacteria 14685
27 Ga0070658_10058439 3300005327 Unclassified 3139
28 Ga0070670_100032523 3300005331 Bacteria 4492
29 Ga0070680_100000075 3300005336 Bacteria 53328
30 Ga0070682_100000628 3300005337 Bacteria 21473
31 Ga0068868_100029988 3300005338 Unclassified 4169
32 Ga0070660_100003934 3300005339 Bacteria 10267
33 Ga0070660_100051817 3300005339 Bacteria 3162
34 Ga0070660_100088322 3300005339 Bacteria 2441
35 Ga0070689_100014800 3300005340 Bacteria 5675
36 Ga0070691_10000522 3300005341 Bacteria 14488
37 Ga0070674_100007210 3300005356 Bacteria 6544
38 Ga0070659_100000120 3300005366 Bacteria 59172
39 Ga0070659_100013534 3300005366 Bacteria 6074
40 Ga0070667_100037265 3300005367 Bacteria 4077
41 Ga0070667_100189070 3300005367 Bacteria 1823
42 Ga0070678_100039769 3300005456 Unclassified 3321
43 Ga0070678_100137368 3300005456 Bacteria 1951
44 Ga0070662_100071105 3300005457 Bacteria 2565
45 Ga0070681_10089677 3300005458 Bacteria 3026
46 Ga0070685_10000872 3300005466 Bacteria 16341
47 Ga0070685_10006752 3300005466 Bacteria 5854
48 Ga0070685_10015858 3300005466 Bacteria 4007
49 Ga0070698_100006230 3300005471 Bacteria 12981
50 Ga0070679_100000892 3300005530 Bacteria 25923
51 Ga0070679_100117630 3300005530 Bacteria 2643
52 Ga0070684_100002223 3300005535 Bacteria 14311
53 Ga0068853_100000393 3300005539 Bacteria 29967
54 Ga0068853_100004852 3300005539 Bacteria 10451
55 Ga0070672_100186805 3300005543 Bacteria 1729
56 Ga0068855_100000424 3300005563 Bacteria 52152
57 Ga0068855_100001368 3300005563 Bacteria 30198
58 Ga0068855_100002033 3300005563 Bacteria 25069
59 Ga0068855_100025564 3300005563 Bacteria 7062
60 Ga0068855_100036848 3300005563 Bacteria 5819
61 Ga0068855_100154396 3300005563 Bacteria 2609
62 Ga0068854_100027376 3300005578 Bacteria 3929
63 Ga0068854_100106775 3300005578 Bacteria 2107
64 Ga0068856_100000040 3300005614 Bacteria 114443
65 Ga0068856_100067175 3300005614 Bacteria 3543
66 Ga0068856_100088073 3300005614 Unclassified 3087
67 Ga0068852_100176858 3300005616 Bacteria 2004
68 Ga0068861_100024264 3300005719 Bacteria 4385
69 Ga0068861_100094601 3300005719 Bacteria 2364
70 Ga0068861_100246346 3300005719 Bacteria 1522
71 Ga0068863_100003469 3300005841 Bacteria 15551
72 Ga0068863_100309820 3300005841 Bacteria 1532
73 Ga0068858_100104828 3300005842 Bacteria 2638
74 Ga0068862_100230763 3300005844 Bacteria 1679
75 Ga0081540_1021413 3300005983 Bacteria 3850
76 Ga0075366_10006224 3300006195 Bacteria 6517
77 Ga0097621_100007287 3300006237 Bacteria 7904
78 Ga0097621_100047074 3300006237 Bacteria 3492
79 Ga0068871_100131051 3300006358 Unclassified 2126
80 Ga0075428_100004227 3300006844 Bacteria 15805
81 Ga0075428_100078709 3300006844 Bacteria 3599
82 Ga0075428_100151108 3300006844 Bacteria 2523
83 Ga0075430_100000903 3300006846 Bacteria 23286
84 Ga0075431_100001482 3300006847 Bacteria 21685
85 Ga0075429_100003075 3300006880 Bacteria 14153
86 Ga0075429_100007210 3300006880 Bacteria 9648
87 Ga0105240_10000486 3300009093 Bacteria 73492
88 Ga0105240_10001336 3300009093 Bacteria 42397
89 Ga0105240_10014457 3300009093 Bacteria 10777
90 Ga0105240_10038372 3300009093 Bacteria 6144
91 Ga0105240_10078599 3300009093 Bacteria 4062
92 Ga0105240_10153861 3300009093 Bacteria 2737
93 Ga0105240_10232607 3300009093 Bacteria 2141
94 Ga0105240_10366139 3300009093 Bacteria 1631
95 Ga0114129_10246787 3300009147 Bacteria 2398
96 Ga0114129_10257260 3300009147 Bacteria 2341
97 Ga0105241_10008261 3300009174 Bacteria 7666
98 Ga0105241_10261945 3300009174 Bacteria 1470
99 Ga0105242_10033854 3300009176 Bacteria 4094
100 Ga0105248_10226529 3300009177 Bacteria 2104
101 Ga0105237_10000400 3300009545 Bacteria 61626
102 Ga0105237_10002069 3300009545 Bacteria 25437
103 Ga0105237_10007738 3300009545 Bacteria 11732
104 Ga0105237_10012955 3300009545 Bacteria 8758
105 Ga0105237_10030263 3300009545 Bacteria 5500
106 Ga0105237_10031518 3300009545 Bacteria 5374
107 Ga0105237_10035921 3300009545 Bacteria 5012
108 Ga0105249_10000887 3300009553 Bacteria 26498
109 Ga0105249_10006490 3300009553 Bacteria 10175
110 Ga0105239_10000014 3300010375 Bacteria 325391
111 Ga0105239_10000457 3300010375 Bacteria 59635
112 Ga0105239_10001481 3300010375 Bacteria 31222
113 Ga0105239_10001703 3300010375 Bacteria 28972
114 Ga0105239_10003895 3300010375 Bacteria 18090
115 Ga0105239_10023003 3300010375 Bacteria 6871
116 Ga0105239_10032023 3300010375 Bacteria 5778
117 Ga0105239_10036772 3300010375 Bacteria 5371
118 Ga0105239_10200895 3300010375 Bacteria 2233
119 Ga0157373_10002671 3300013100 Bacteria 13525
120 Ga0157371_10000121 3300013102 Bacteria 118793
121 Ga0157371_10000943 3300013102 Bacteria 32475
122 Ga0157371_10014170 3300013102 Bacteria 6027
123 Ga0157371_10052757 3300013102 Bacteria 2887
124 Ga0157370_10000238 3300013104 Bacteria 70036
125 Ga0157370_10000426 3300013104 Bacteria 52773
126 Ga0157370_10011684 3300013104 Bacteria 9166
127 Ga0157370_10016232 3300013104 Bacteria 7545
128 Ga0157370_10026119 3300013104 Bacteria 5769
129 Ga0157370_10046733 3300013104 Bacteria 4150
130 Ga0157369_10075089 3300013105 Bacteria 3625
131 Ga0157369_10128628 3300013105 Bacteria 2684
132 Ga0157374_10000007 3300013296 Bacteria 595643
133 Ga0157374_10053557 3300013296 Bacteria 3762
134 Ga0157374_10113912 3300013296 Bacteria 2603
135 Ga0157378_10006118 3300013297 Bacteria 10537
136 Ga0163162_10002921 3300013306 Bacteria 16292
137 Ga0163162_10017517 3300013306 Bacteria 7009
138 Ga0163162_10022032 3300013306 Bacteria 6278
139 Ga0163162_10170425 3300013306 Bacteria 2302
140 Ga0157372_10000075 3300013307 Bacteria 105528
141 Ga0157372_10007751 3300013307 Bacteria 11407
142 Ga0157372_10155941 3300013307 Bacteria 2637
143 Ga0157375_10031613 3300013308 Bacteria 5007
144 Ga0157375_10033780 3300013308 Unclassified 4865
145 Ga0157375_10337726 3300013308 Bacteria 1672
146 Ga0163163_10025286 3300014325 Bacteria 5661
147 Ga0163163_10123618 3300014325 Bacteria 2623
148 Ga0163163_10168215 3300014325 Bacteria 2239
149 Ga0157380_10000012 3300014326 Bacteria 131332
150 Ga0157380_10039459 3300014326 Unclassified 3672
151 Ga0157380_10175915 3300014326 Bacteria 1875
152 Ga0157380_10218166 3300014326 Bacteria 1705
153 Ga0157377_10108100 3300014745 Bacteria 1668
154 Ga0157377_10108998 3300014745 Bacteria 1662
155 Ga0157379_10103360 3300014968 Bacteria 2557
156 Ga0157379_10223377 3300014968 Bacteria 1707
157 Ga0157376_10003394 3300014969 Bacteria 10966
158 Ga0157376_10006238 3300014969 Bacteria 8403
159 Ga0157376_10094455 3300014969 Bacteria 2598
160 Ga0157376_10247063 3300014969 Bacteria 1665
161 Ga0163161_10004535 3300017792 Bacteria 9665
162 Ga0163161_10125461 3300017792 Bacteria 1932
163 Ga0209437_100144 3300025233 Bacteria 164794
164 Ga0209258_100326 3300025242 Bacteria 72066
165 Ga0209646_1000829 3300025246 Bacteria 10399
166 Ga0209148_1000157 3300025254 Bacteria 142367
167 Ga0209233_1002514 3300025261 Bacteria 6701
168 Ga0209455_1001743 3300025272 Bacteria 9243
169 Ga0207426_1000019 3300025302 Bacteria 558579
170 Ga0207647_10000601 3300025904 Bacteria 28025
171 Ga0207645_10000713 3300025907 Bacteria 27669
172 Ga0207643_10037126 3300025908 Bacteria 2733
173 Ga0207705_10084079 3300025909 Bacteria 2323
174 Ga0207654_10078168 3300025911 Bacteria 1985
175 Ga0207654_10145485 3300025911 Bacteria 1516
176 Ga0207707_10000111 3300025912 Bacteria 82165
177 Ga0207695_10000130 3300025913 Bacteria 224214
178 Ga0207695_10000170 3300025913 Bacteria 192469
179 Ga0207695_10000267 3300025913 Bacteria 131133
180 Ga0207695_10004097 3300025913 Bacteria 20033
181 Ga0207695_10022478 3300025913 Bacteria 7156
182 Ga0207695_10059521 3300025913 Bacteria 3960
183 Ga0207695_10069270 3300025913 Bacteria 3610
184 Ga0207695_10118949 3300025913 Bacteria 2613
185 Ga0207671_10000244 3300025914 Bacteria 81258
186 Ga0207671_10005384 3300025914 Bacteria 11818
187 Ga0207671_10013461 3300025914 Bacteria 6512
188 Ga0207671_10015710 3300025914 Bacteria 5918
189 Ga0207671_10031769 3300025914 Bacteria 3933
190 Ga0207671_10074512 3300025914 Bacteria 2537
191 Ga0207660_10062136 3300025917 Bacteria 2690
192 Ga0207657_10002022 3300025919 Bacteria 21925
193 Ga0207657_10095424 3300025919 Bacteria 2475
194 Ga0207657_10153349 3300025919 Bacteria 1875
195 Ga0207652_10011666 3300025921 Bacteria 7090
196 Ga0207650_10035628 3300025925 Bacteria 3616
197 Ga0207650_10038722 3300025925 Bacteria 3483
198 Ga0207690_10000133 3300025932 Bacteria 60426
199 Ga0207706_10007072 3300025933 Bacteria 10376
200 Ga0207686_10003787 3300025934 Bacteria 8121
201 Ga0207669_10028212 3300025937 Unclassified 3085
202 Ga0207691_10027955 3300025940 Bacteria 5284
203 Ga0207689_10008218 3300025942 Bacteria 9094
204 Ga0207667_10004397 3300025949 Bacteria 17264
205 Ga0207667_10004780 3300025949 Bacteria 16560
206 Ga0207667_10030351 3300025949 Bacteria 5849
207 Ga0207667_10038464 3300025949 Bacteria 5110
208 Ga0207667_10120322 3300025949 Bacteria 2706
209 Ga0207667_10123545 3300025949 Bacteria 2667
210 Ga0207651_10053300 3300025960 Bacteria 2764
211 Ga0207651_10109560 3300025960 Unclassified 2069
212 Ga0207651_10167156 3300025960 Bacteria 1731
213 Ga0207712_10001189 3300025961 Bacteria 17987
214 Ga0207712_10002645 3300025961 Bacteria 11466
215 Ga0207712_10004451 3300025961 Bacteria 8847
216 Ga0207640_10009334 3300025981 Bacteria 5488
217 Ga0207658_10025912 3300025986 Bacteria 4108
218 Ga0207658_10101591 3300025986 Bacteria 2254
219 Ga0207677_10086163 3300026023 Bacteria 2270
220 Ga0207639_10016973 3300026041 Bacteria 5159
221 Ga0207702_10000042 3300026078 Bacteria 150673
222 Ga0207702_10043172 3300026078 Bacteria 3785
223 Ga0207702_10047656 3300026078 Bacteria 3612
224 Ga0207702_10066598 3300026078 Unclassified 3088
225 Ga0207641_10000601 3300026088 Bacteria 39530
226 Ga0207648_10006817 3300026089 Bacteria 11319
227 Ga0207676_10021656 3300026095 Bacteria 4719
228 Ga0207676_10040155 3300026095 Bacteria 3585
229 Ga0207675_100059328 3300026118 Bacteria 3570
230 Ga0207675_100266701 3300026118 Unclassified 1661
231 Ga0207683_10008436 3300026121 Bacteria 8820
232 Ga0268264_10346404 3300028381 Bacteria 1413
233 Ga0265334_10007635 3300028573 Bacteria 4634
234 Ga0307517_10006013 3300028786 Bacteria 18085
235 Ga0265327_10003797 3300031251 Bacteria 13989
236 Ga0307513_10265266 3300031456 Bacteria 1504
237 Ga0307516_10000683 3300031730 Bacteria 46007
238 Ga0307510_10010080 3300033180 Bacteria 11235
239 Ga0373937_0075296 3300036401 Bacteria 3116
240 Ga0316584_0016023 3300036712 Bacteria 5369
241 Ga0395899_0000050 3300037312 Bacteria 224591
242 Ga0395899_0000064 3300037312 Bacteria 207082
243 Ga0395899_0029301 3300037312 Bacteria 4140
244 Ga0395900_0053385 3300037418 Bacteria 4160
245 Ga0395898_0010807 3300037466 Bacteria 9537
246 Ga0395901_0001140 3300038443 Bacteria 28163
247 Ga0395901_0002041 3300038443 Bacteria 20730
248 Ga0436365_0062569 3300039437 Bacteria 9629
249 Ga0439431_0006375 3300041997 Bacteria 2609
250 Ga0466969_0065733 3300044656 Bacteria 1753
251 Ga0466972_0000040 3300044658 Bacteria 133427
252 Ga0466961_0018482 3300044693 Bacteria 4484
253 Ga0466971_0007139 3300044719 Bacteria 4862
254 Ga0466957_0001910 3300044842 Bacteria 11052
255 Ga0451576_0000003 3300045051 Bacteria 1550573
256 Ga0495592_0029157 3300046454 Unclassified 4178
257 Ga0495650_0000236 3300046471 Bacteria 111056
258 Ga0495580_0153923 3300046472 Bacteria 1593
259 Ga0495585_0000097 3300046492 Bacteria 93394
260 Ga0495585_0000111 3300046492 Bacteria 87559
261 Ga0495583_0008651 3300046506 Bacteria 6193
262 Ga0495606_0000036 3300046507 Bacteria 234596
263 Ga0495606_0006370 3300046507 Bacteria 10910
264 Ga0495606_0007729 3300046507 Bacteria 9521
265 Ga0495606_0015038 3300046507 Bacteria 5993
266 Ga0495610_0000500 3300046512 Bacteria 40127
267 Ga0495616_0000821 3300046513 Bacteria 22672
268 Ga0495616_0002784 3300046513 Bacteria 11417
269 Ga0495648_0001819 3300046524 Bacteria 20533
270 Ga0495648_0023734 3300046524 Bacteria 4192
271 Ga0495633_0017809 3300046558 Bacteria 3620
272 Ga0495668_0002689 3300046616 Bacteria 14265
273 Ga0495668_0045179 3300046616 Bacteria 2448
274 Ga0495611_0000252 3300046648 Bacteria 36998
275 Ga0495625_0000110 3300046660 Bacteria 125028
276 Ga0495625_0004018 3300046660 Bacteria 14070
277 Ga0495661_0006331 3300046665 Bacteria 8324
278 Ga0495661_0015450 3300046665 Bacteria 5096
279 Ga0495661_0027088 3300046665 Bacteria 3683
280 Ga0495658_0008802 3300046683 Bacteria 5017
281 Ga0495649_0000011 3300046694 Bacteria 416695
282 Ga0495649_0029817 3300046694 Bacteria 3015
283 Ga0495660_0003749 3300046810 Bacteria 9331
284 Ga0495672_0022252 3300047320 Bacteria 4124
285 Ga0495687_005362 3300047443 Bacteria 8197
286 Ga0495673_0024700 3300047469 Bacteria 2897
287 Ga0495686_0000034 3300047472 Bacteria 325038
288 Ga0495686_0000249 3300047472 Bacteria 96604
289 Ga0495686_0000748 3300047472 Bacteria 43100
290 Ga0496105_0162763 3300048908 Bacteria 1832
291 Ga0496121_0000028 3300048924 Bacteria 439193
292 Ga0495678_021035 3300049459 Bacteria 2878
293 Ga0501031_0004611 3300049568 Bacteria 8938
294 Ga0501032_0002963 3300049569 Bacteria 13182
295 Ga0501032_0004450 3300049569 Bacteria 10566
296 Ga0501032_0027857 3300049569 Bacteria 3883
297 Ga0501033_0000022 3300049570 Bacteria 190111
298 Ga0501033_0071609 3300049570 Unclassified 2546
299 Ga0501034_0000240 3300049571 Bacteria 101222
300 Ga0501034_0006140 3300049571 Bacteria 12952
301 Ga0501034_0009250 3300049571 Bacteria 10327
302 Ga0501034_0032340 3300049571 Bacteria 5313
303 Ga0501036_0025452 3300049572 Bacteria 4992
304 Ga0501036_0031237 3300049572 Bacteria 4500
305 Ga0501037_0004637 3300049573 Bacteria 9987
306 Ga0501038_0020146 3300049574 Bacteria 6002
307 Ga0501039_0010184 3300049575 Bacteria 7167
308 Ga0501043_0001058 3300049579 Bacteria 24179
309 Ga0501043_0005283 3300049579 Bacteria 10442
310 Ga0501046_0098238 3300049580 Bacteria 2249
311 Ga0501070_0205380 3300049586 Bacteria 1618
312 Ga0501073_0014748 3300049589 Bacteria 5676
313 Ga0501074_0067528 3300049590 Bacteria 2571
314 Ga0501080_0302417 3300049742 Bacteria 1450
315 Ga0501083_0048744 3300049744 Bacteria 2858
316 Ga0501241_000122 3300049758 Bacteria 16826
317 Ga0501035_0004585 3300049822 Bacteria 13102
318 Ga0501035_0029571 3300049822 Bacteria 4997
319 Ga0501044_0002612 3300049823 Bacteria 20469
320 Ga0501044_0005431 3300049823 Bacteria 14157
321 Ga0501044_0087688 3300049823 Bacteria 3143
322 Ga0501044_0128759 3300049823 Bacteria 2527
323 Ga0501044_0161270 3300049823 Bacteria 2219
324 Ga0501045_0000188 3300049824 Bacteria 34592
325 nmdc:mga0k408_15724_c1 3300050493 Bacteria 4189
326 nmdc:mga0k408_7375_c1 3300050493 Bacteria 5871
327 nmdc:mga05p37_263164_c1 3300050507 Bacteria 2063
328 nmdc:mga09592_7862_c1 3300050508 Bacteria 8668
329 nmdc:mga0qj67_21373_c1 3300050509 Bacteria 4965
330 nmdc:mga06r32_92176_c1 3300050510 Bacteria 2962
331 Ga0500635_0001239 3300053080 Bacteria 6093
332 Ga0500644_0000226 3300053088 Bacteria 32397
333 Ga0500646_0002691 3300053090 Bacteria 4589
334 Ga0500583_0000108 3300053092 Bacteria 41760
335 Ga0500569_000134 3300053109 Bacteria 11684
336 Ga0500607_049263 3300053121 Unclassified 2249
337 Ga0500658_0006274 3300053134 Bacteria 4419
338 Ga0500577_0000759 3300053142 Bacteria 8294
339 Ga0500604_0004242 3300053151 Bacteria 3809
340 Ga0500622_0000026 3300053156 Bacteria 235660
341 Ga0500622_0000339 3300053156 Bacteria 46037
342 Ga0500624_000346 3300053157 Bacteria 15210
343 Ga0500634_0037534 3300053161 Bacteria 2635
344 Ga0501082_0234955 3300060353 Bacteria 1595

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046665 Ga0495661_0027088 Ga0495661_0027088_2671_3669 332
2 3300003316 rootH1_10117279 rootH1_101172792 345
3 3300049822 Ga0501035_0029571 Ga0501035_0029571_31_1101 352
4 3300013104 Ga0157370_10046733 Ga0157370_100467333 363
5 3300038443 Ga0395901_0001140 Ga0395901_0001140_15374_16558 367
6 3300049568 Ga0501031_0004611 Ga0501031_0004611_1026_2174 377
7 3300049569 Ga0501032_0002963 Ga0501032_0002963_2014_3162 377
8 3300049570 Ga0501033_0000022 Ga0501033_0000022_74960_76108 377
9 3300049571 Ga0501034_0000240 Ga0501034_0000240_89326_90474 377
10 3300049572 Ga0501036_0031237 Ga0501036_0031237_2410_3558 377
11 3300049573 Ga0501037_0004637 Ga0501037_0004637_1340_2488 377
12 3300049575 Ga0501039_0010184 Ga0501039_0010184_4289_5437 377
13 3300049579 Ga0501043_0001058 Ga0501043_0001058_15351_16499 377
14 3300049822 Ga0501035_0004585 Ga0501035_0004585_5052_6200 377
15 3300049823 Ga0501044_0002612 Ga0501044_0002612_11640_12788 377
16 3300049824 Ga0501045_0000188 Ga0501045_0000188_26891_28039 377
17 3300003316 rootH1_10022655 rootH1_100226553 379
18 3300013102 Ga0157371_10052757 Ga0157371_100527573 379
19 3300053151 Ga0500604_0004242 Ga0500604_0004242_1467_2699 379
20 3300028381 Ga0268264_10346404 Ga0268264_103464042 380
21 3300014326 Ga0157380_10000012 Ga0157380_1000001261 381
22 3300049586 Ga0501070_0205380 Ga0501070_0205380_425_1606 382
23 3300031730 Ga0307516_10000683 Ga0307516_100006833 383
24 3300005327 Ga0070658_10058439 Ga0070658_100584391 384
25 3300005367 Ga0070667_100037265 Ga0070667_1000372654 385
26 3300025986 Ga0207658_10025912 Ga0207658_100259124 385
27 3300046454 Ga0495592_0029157 Ga0495592_0029157_2068_3321 386
28 3300049570 Ga0501033_0071609 Ga0501033_0071609_1285_2481 386
29 3300049571 Ga0501034_0032340 Ga0501034_0032340_3834_5030 386
30 3300031251 Ga0265327_10003797 Ga0265327_1000379711 387
31 3300003320 rootH2_10069535 rootH2_100695358 388
32 3300003322 rootL2_10263470 rootL2_102634701 388
33 3300005456 Ga0070678_100137368 Ga0070678_1001373682 388
34 3300005719 Ga0068861_100024264 Ga0068861_1000242641 388
35 3300026118 Ga0207675_100266701 Ga0207675_1002667011 388
36 3300053156 Ga0500622_0000026 Ga0500622_0000026_40170_41396 389
37 3300014325 Ga0163163_10168215 Ga0163163_101682151 390
38 3300003322 rootL2_10026870 rootL2_100268707 391
39 3300013308 Ga0157375_10031613 Ga0157375_100316133 391
40 3300014325 Ga0163163_10025286 Ga0163163_100252862 391
41 3300053092 Ga0500583_0000108 Ga0500583_0000108_33079_34317 392
42 3300005331 Ga0070670_100032523 Ga0070670_1000325234 393
43 3300005563 Ga0068855_100025564 Ga0068855_1000255643 393
44 3300005983 Ga0081540_1021413 Ga0081540_10214133 393
45 3300009545 Ga0105237_10012955 Ga0105237_100129554 393
46 3300009553 Ga0105249_10000887 Ga0105249_1000088721 393
47 3300010375 Ga0105239_10000457 Ga0105239_100004578 393
48 3300013102 Ga0157371_10014170 Ga0157371_100141702 393
49 3300014325 Ga0163163_10123618 Ga0163163_101236183 393
50 3300025914 Ga0207671_10005384 Ga0207671_100053847 393
51 3300025949 Ga0207667_10123545 Ga0207667_101235451 393
52 3300025961 Ga0207712_10002645 Ga0207712_100026452 393
53 3300026095 Ga0207676_10021656 Ga0207676_100216562 393
54 3300049758 Ga0501241_000122 Ga0501241_000122_5504_6718 393
55 3300013296 Ga0157374_10000007 Ga0157374_10000007166 394
56 3300013307 Ga0157372_10007751 Ga0157372_100077512 394
57 3300014969 Ga0157376_10003394 Ga0157376_100033946 394
58 3300044656 Ga0466969_0065733 Ga0466969_0065733_96_1334 394
59 3300044693 Ga0466961_0018482 Ga0466961_0018482_303_1541 394
60 3300044719 Ga0466971_0007139 Ga0466971_0007139_1028_2266 394
61 3300046694 Ga0495649_0029817 Ga0495649_0029817_1580_2815 394
62 3300003320 rootH2_10047580 rootH2_1004758016 395
63 3300005535 Ga0070684_100002223 Ga0070684_1000022237 395
64 3300005563 Ga0068855_100000424 Ga0068855_10000042436 395
65 3300005578 Ga0068854_100106775 Ga0068854_1001067752 395
66 3300005616 Ga0068852_100176858 Ga0068852_1001768582 395
67 3300010375 Ga0105239_10036772 Ga0105239_100367724 395
68 3300013104 Ga0157370_10011684 Ga0157370_100116847 395
69 3300025913 Ga0207695_10000130 Ga0207695_1000013052 395
70 3300025949 Ga0207667_10004780 Ga0207667_100047804 395
71 3300028573 Ga0265334_10007635 Ga0265334_100076352 395
72 3300047472 Ga0495686_0000034 Ga0495686_0000034_198960_200183 395
73 3300050493 nmdc:mga0k408_7375_c1 nmdc:mga0k408_7375_c1_201_1442 395
74 iso_pu_bacteria 2896109856 2896112116 395
75 iso_pu_bacteria 2911138879 2911143902 395
76 3300005466 Ga0070685_10006752 Ga0070685_100067522 396
77 3300031456 Ga0307513_10265266 Ga0307513_102652661 396
78 3300049571 Ga0501034_0006140 Ga0501034_0006140_4556_5782 396
79 iso_pu_bacteria 2896085136 2896088151 396
80 3300003323 rootH1_10008448 rootH1_100084485 397
81 3300005841 Ga0068863_100309820 Ga0068863_1003098201 397
82 3300006844 Ga0075428_100151108 Ga0075428_1001511083 397
83 3300009093 Ga0105240_10000486 Ga0105240_1000048660 397
84 3300009093 Ga0105240_10001336 Ga0105240_1000133630 397
85 3300025913 Ga0207695_10000170 Ga0207695_10000170115 397
86 3300025913 Ga0207695_10004097 Ga0207695_100040973 397
87 3300037312 Ga0395899_0000064 Ga0395899_0000064_73745_74953 397
88 3300039437 Ga0436365_0062569 Ga0436365_0062569_6276_7508 397
89 iso_pu_bacteria 2914759650 2914760053 397
90 iso_pu_bacteria 2929239360 2929244694 397
91 3300003354 JGI25160J50197_1000790 JGI25160J50197_100079011 398
92 3300025302 Ga0207426_1000019 Ga0207426_1000019152 398
93 3300050508 nmdc:mga09592_7862_c1 nmdc:mga09592_7862_c1_3808_5025 398
94 3300050509 nmdc:mga0qj67_21373_c1 nmdc:mga0qj67_21373_c1_2739_3956 398
95 3300050510 nmdc:mga06r32_92176_c1 nmdc:mga06r32_92176_c1_830_2047 398
96 3300053156 Ga0500622_0000339 Ga0500622_0000339_18892_20130 398
97 3300003323 rootH1_10100719 rootH1_101007199 399
98 3300005614 Ga0068856_100067175 Ga0068856_1000671752 399
99 3300010375 Ga0105239_10001481 Ga0105239_1000148115 399
100 3300013306 Ga0163162_10017517 Ga0163162_100175178 399
101 3300025913 Ga0207695_10069270 Ga0207695_100692702 399
102 3300026041 Ga0207639_10016973 Ga0207639_100169733 399
103 3300026078 Ga0207702_10047656 Ga0207702_100476562 399
104 3300028786 Ga0307517_10006013 Ga0307517_100060134 399
105 3300044658 Ga0466972_0000040 Ga0466972_0000040_99585_100832 399
106 3300047320 Ga0495672_0022252 Ga0495672_0022252_2490_3737 399
107 iso_pu_bacteria 2977232053 2977234687 399
108 3300003320 rootH2_10115320 rootH2_101153202 400
109 3300003761 Ga0055535_1003565 Ga0055535_10035653 400
110 3300005262 Ga0065165_1001522 Ga0065165_10015227 400
111 3300005539 Ga0068853_100000393 Ga0068853_10000039321 400
112 3300005719 Ga0068861_100094601 Ga0068861_1000946012 400
113 3300006237 Ga0097621_100047074 Ga0097621_1000470741 400
114 3300013104 Ga0157370_10026119 Ga0157370_100261192 400
115 3300025242 Ga0209258_100326 Ga0209258_10032647 400
116 3300025254 Ga0209148_1000157 Ga0209148_100015724 400
117 3300025925 Ga0207650_10035628 Ga0207650_100356282 400
118 3300033180 Ga0307510_10010080 Ga0307510_100100805 400
119 3300036401 Ga0373937_0075296 Ga0373937_0075296_669_1940 400
120 3300041997 Ga0439431_0006375 Ga0439431_0006375_283_1512 400
121 3300045051 Ga0451576_0000003 Ga0451576_0000003_165686_166906 400
122 3300046507 Ga0495606_0007729 Ga0495606_0007729_26_1228 400
123 3300048924 Ga0496121_0000028 Ga0496121_0000028_94342_95580 400
124 3300049569 Ga0501032_0004450 Ga0501032_0004450_8187_9449 400
125 3300053088 Ga0500644_0000226 Ga0500644_0000226_20685_21926 400
126 3300053090 Ga0500646_0002691 Ga0500646_0002691_2491_3732 400
127 3300053109 Ga0500569_000134 Ga0500569_000134_7749_8990 400
128 3300053121 Ga0500607_049263 Ga0500607_049263_532_1773 400
129 3300053134 Ga0500658_0006274 Ga0500658_0006274_1746_2987 400
130 3300053142 Ga0500577_0000759 Ga0500577_0000759_5814_7055 400
131 3300053161 Ga0500634_0037534 Ga0500634_0037534_594_1835 400
132 3300003322 rootL2_10135105 rootL2_101351052 401
133 3300003322 rootL2_10195979 rootL2_101959792 401
134 3300013296 Ga0157374_10113912 Ga0157374_101139122 401
135 3300036712 Ga0316584_0016023 Ga0316584_0016023_651_1907 401
136 3300046616 Ga0495668_0002689 Ga0495668_0002689_8867_10120 401
137 3300049574 Ga0501038_0020146 Ga0501038_0020146_3615_4871 401
138 3300049823 Ga0501044_0161270 Ga0501044_0161270_695_1933 401
139 3300003316 rootH1_10123087 rootH1_101230873 402
140 3300003322 rootL2_10019581 rootL2_100195813 402
141 3300003322 rootL2_10069142 rootL2_100691426 402
142 3300005614 Ga0068856_100088073 Ga0068856_1000880732 402
143 3300009545 Ga0105237_10002069 Ga0105237_100020692 402
144 3300025914 Ga0207671_10031769 Ga0207671_100317692 402
145 3300026078 Ga0207702_10066598 Ga0207702_100665982 402
146 3300005844 Ga0068862_100230763 Ga0068862_1002307632 403
147 3300006844 Ga0075428_100004227 Ga0075428_1000042279 403
148 3300006846 Ga0075430_100000903 Ga0075430_10000090311 403
149 3300006847 Ga0075431_100001482 Ga0075431_10000148222 403
150 3300006880 Ga0075429_100003075 Ga0075429_1000030759 403
151 3300009147 Ga0114129_10257260 Ga0114129_102572602 403
152 3300013308 Ga0157375_10033780 Ga0157375_100337803 403
153 3300014326 Ga0157380_10175915 Ga0157380_101759151 403
154 3300014745 Ga0157377_10108998 Ga0157377_101089982 403
155 3300014968 Ga0157379_10103360 Ga0157379_101033602 403
156 3300014969 Ga0157376_10247063 Ga0157376_102470632 403
157 3300025246 Ga0209646_1000829 Ga0209646_10008295 403
158 3300048908 Ga0496105_0162763 Ga0496105_0162763_83_1363 403
159 3300003322 rootL2_10054063 rootL2_100540632 404
160 3300005290 Ga0065712_10068102 Ga0065712_100681026 404
161 3300005338 Ga0068868_100029988 Ga0068868_1000299883 404
162 3300005339 Ga0070660_100088322 Ga0070660_1000883222 404
163 3300005340 Ga0070689_100014800 Ga0070689_1000148003 404
164 3300005356 Ga0070674_100007210 Ga0070674_1000072105 404
165 3300005366 Ga0070659_100000120 Ga0070659_10000012048 404
166 3300005367 Ga0070667_100189070 Ga0070667_1001890702 404
167 3300005456 Ga0070678_100039769 Ga0070678_1000397693 404
168 3300005457 Ga0070662_100071105 Ga0070662_1000711052 404
169 3300005466 Ga0070685_10000872 Ga0070685_1000087210 404
170 3300005466 Ga0070685_10015858 Ga0070685_100158585 404
171 3300005471 Ga0070698_100006230 Ga0070698_1000062308 404
172 3300005543 Ga0070672_100186805 Ga0070672_1001868052 404
173 3300005719 Ga0068861_100246346 Ga0068861_1002463462 404
174 3300005841 Ga0068863_100003469 Ga0068863_1000034699 404
175 3300005842 Ga0068858_100104828 Ga0068858_1001048283 404
176 3300006844 Ga0075428_100078709 Ga0075428_1000787094 404
177 3300006880 Ga0075429_100007210 Ga0075429_1000072105 404
178 3300009147 Ga0114129_10246787 Ga0114129_102467872 404
179 3300009176 Ga0105242_10033854 Ga0105242_100338543 404
180 3300009177 Ga0105248_10226529 Ga0105248_102265292 404
181 3300009553 Ga0105249_10006490 Ga0105249_100064906 404
182 3300013296 Ga0157374_10053557 Ga0157374_100535573 404
183 3300013297 Ga0157378_10006118 Ga0157378_100061186 404
184 3300013306 Ga0163162_10170425 Ga0163162_101704252 404
185 3300013308 Ga0157375_10337726 Ga0157375_103377262 404
186 3300014326 Ga0157380_10039459 Ga0157380_100394593 404
187 3300014326 Ga0157380_10218166 Ga0157380_102181662 404
188 3300014745 Ga0157377_10108100 Ga0157377_101081001 404
189 3300014968 Ga0157379_10223377 Ga0157379_102233772 404
190 3300017792 Ga0163161_10004535 Ga0163161_100045352 404
191 3300017792 Ga0163161_10125461 Ga0163161_101254612 404
192 3300025907 Ga0207645_10000713 Ga0207645_1000071320 404
193 3300025908 Ga0207643_10037126 Ga0207643_100371262 404
194 3300025919 Ga0207657_10095424 Ga0207657_100954242 404
195 3300025925 Ga0207650_10038722 Ga0207650_100387224 404
196 3300025932 Ga0207690_10000133 Ga0207690_1000013333 404
197 3300025933 Ga0207706_10007072 Ga0207706_100070729 404
198 3300025934 Ga0207686_10003787 Ga0207686_100037874 404
199 3300025937 Ga0207669_10028212 Ga0207669_100282121 404
200 3300025940 Ga0207691_10027955 Ga0207691_100279553 404
201 3300025942 Ga0207689_10008218 Ga0207689_100082185 404
202 3300025960 Ga0207651_10053300 Ga0207651_100533003 404
203 3300025960 Ga0207651_10109560 Ga0207651_101095601 404
204 3300025960 Ga0207651_10167156 Ga0207651_101671561 404
205 3300025961 Ga0207712_10001189 Ga0207712_100011898 404
206 3300025961 Ga0207712_10004451 Ga0207712_100044518 404
207 3300025986 Ga0207658_10101591 Ga0207658_101015912 404
208 3300026023 Ga0207677_10086163 Ga0207677_100861632 404
209 3300026088 Ga0207641_10000601 Ga0207641_1000060127 404
210 3300026089 Ga0207648_10006817 Ga0207648_100068173 404
211 3300026095 Ga0207676_10040155 Ga0207676_100401552 404
212 3300026118 Ga0207675_100059328 Ga0207675_1000593283 404
213 3300026121 Ga0207683_10008436 Ga0207683_100084363 404
214 3300044842 Ga0466957_0001910 Ga0466957_0001910_585_1847 404
215 3300049823 Ga0501044_0087688 Ga0501044_0087688_38_1285 404
216 3300050507 nmdc:mga05p37_263164_c1 nmdc:mga05p37_263164_c1_461_1702 404
217 3300003320 rootH2_10013019 rootH2_100130196 405
218 3300006237 Ga0097621_100007287 Ga0097621_1000072875 405
219 3300006358 Ga0068871_100131051 Ga0068871_1001310512 405
220 3300013306 Ga0163162_10022032 Ga0163162_100220323 405
221 3300014969 Ga0157376_10006238 Ga0157376_100062386 405
222 3300014969 Ga0157376_10094455 Ga0157376_100944552 405
223 3300046648 Ga0495611_0000252 Ga0495611_0000252_6744_8021 405
224 3300005614 Ga0068856_100000040 Ga0068856_100000040101 406
225 3300009174 Ga0105241_10261945 Ga0105241_102619451 406
226 3300009545 Ga0105237_10035921 Ga0105237_100359213 406
227 3300010375 Ga0105239_10032023 Ga0105239_100320235 406
228 3300025911 Ga0207654_10145485 Ga0207654_101454852 406
229 3300025914 Ga0207671_10074512 Ga0207671_100745122 406
230 3300026078 Ga0207702_10000042 Ga0207702_1000004273 406
231 3300037312 Ga0395899_0000050 Ga0395899_0000050_145911_147137 406
232 3300046472 Ga0495580_0153923 Ga0495580_0153923_216_1502 406
233 3300037418 Ga0395900_0053385 Ga0395900_0053385_1815_3071 407
234 3300049569 Ga0501032_0027857 Ga0501032_0027857_1749_3041 407
235 3300049571 Ga0501034_0009250 Ga0501034_0009250_2629_3921 407
236 3300049572 Ga0501036_0025452 Ga0501036_0025452_2104_3396 407
237 3300049579 Ga0501043_0005283 Ga0501043_0005283_2083_3375 407
238 3300049823 Ga0501044_0005431 Ga0501044_0005431_10877_12169 407
239 3300005336 Ga0070680_100000075 Ga0070680_10000007530 408
240 3300005337 Ga0070682_100000628 Ga0070682_10000062820 408
241 3300005339 Ga0070660_100051817 Ga0070660_1000518173 408
242 3300005341 Ga0070691_10000522 Ga0070691_100005228 408
243 3300005366 Ga0070659_100013534 Ga0070659_1000135343 408
244 3300005458 Ga0070681_10089677 Ga0070681_100896772 408
245 3300005530 Ga0070679_100000892 Ga0070679_10000089211 408
246 3300005530 Ga0070679_100117630 Ga0070679_1001176302 408
247 3300005539 Ga0068853_100004852 Ga0068853_1000048523 408
248 3300005563 Ga0068855_100001368 Ga0068855_10000136810 408
249 3300005563 Ga0068855_100002033 Ga0068855_1000020335 408
250 3300005563 Ga0068855_100154396 Ga0068855_1001543961 408
251 3300009093 Ga0105240_10038372 Ga0105240_100383723 408
252 3300009174 Ga0105241_10008261 Ga0105241_100082612 408
253 3300013102 Ga0157371_10000943 Ga0157371_1000094317 408
254 3300013104 Ga0157370_10000238 Ga0157370_1000023827 408
255 3300013104 Ga0157370_10000426 Ga0157370_1000042630 408
256 3300025911 Ga0207654_10078168 Ga0207654_100781681 408
257 3300025912 Ga0207707_10000111 Ga0207707_1000011130 408
258 3300025913 Ga0207695_10022478 Ga0207695_100224786 408
259 3300025917 Ga0207660_10062136 Ga0207660_100621362 408
260 3300025919 Ga0207657_10153349 Ga0207657_101533492 408
261 3300025921 Ga0207652_10011666 Ga0207652_100116662 408
262 3300025949 Ga0207667_10004397 Ga0207667_1000439710 408
263 3300025949 Ga0207667_10038464 Ga0207667_100384642 408
264 3300025949 Ga0207667_10120322 Ga0207667_101203221 408
265 3300037312 Ga0395899_0029301 Ga0395899_0029301_1931_3202 408
266 3300037466 Ga0395898_0010807 Ga0395898_0010807_939_2210 408
267 3300038443 Ga0395901_0002041 Ga0395901_0002041_10664_11935 408
268 3300046665 Ga0495661_0006331 Ga0495661_0006331_1421_2656 408
269 3300049580 Ga0501046_0098238 Ga0501046_0098238_150_1445 408
270 3300049589 Ga0501073_0014748 Ga0501073_0014748_3008_4303 408
271 3300049590 Ga0501074_0067528 Ga0501074_0067528_914_2209 408
272 3300049742 Ga0501080_0302417 Ga0501080_0302417_18_1313 408
273 3300049744 Ga0501083_0048744 Ga0501083_0048744_468_1763 408
274 3300049823 Ga0501044_0128759 Ga0501044_0128759_269_1564 408
275 3300053080 Ga0500635_0001239 Ga0500635_0001239_2923_4149 408
276 3300060353 Ga0501082_0234955 Ga0501082_0234955_284_1579 408
277 3300002067 JGI24735J21928_10007016 JGI24735J21928_100070165 409
278 3300005339 Ga0070660_100003934 Ga0070660_1000039349 409
279 3300009093 Ga0105240_10153861 Ga0105240_101538612 409
280 3300010375 Ga0105239_10000014 Ga0105239_1000001488 409
281 3300013100 Ga0157373_10002671 Ga0157373_1000267111 409
282 3300013102 Ga0157371_10000121 Ga0157371_1000012191 409
283 3300013104 Ga0157370_10016232 Ga0157370_100162325 409
284 3300013105 Ga0157369_10128628 Ga0157369_101286283 409
285 3300013307 Ga0157372_10000075 Ga0157372_1000007578 409
286 3300013307 Ga0157372_10155941 Ga0157372_101559412 409
287 3300025261 Ga0209233_1002514 Ga0209233_10025145 409
288 3300025904 Ga0207647_10000601 Ga0207647_100006014 409
289 3300025909 Ga0207705_10084079 Ga0207705_100840791 409
290 3300025913 Ga0207695_10059521 Ga0207695_100595213 409
291 3300025919 Ga0207657_10002022 Ga0207657_100020225 409
292 3300047472 Ga0495686_0000748 Ga0495686_0000748_21115_22344 409
293 iso_pu_bacteria 2599185184 2599479801 409
294 iso_pu_bacteria 2919437846 2919439514 409
295 iso_pu_bacteria 2928078545 2928084105 409
296 iso_pu_bacteria 2928147474 2928153069 409
297 iso_pu_bacteria 2932082852 2932086976 409
298 3300005288 Ga0065714_10021152 Ga0065714_100211521 410
299 3300026078 Ga0207702_10043172 Ga0207702_100431724 410
300 3300046507 Ga0495606_0006370 Ga0495606_0006370_2707_3942 410
301 3300053157 Ga0500624_000346 Ga0500624_000346_11647_12879 410
302 3300009093 Ga0105240_10014457 Ga0105240_1001445712 411
303 3300009093 Ga0105240_10232607 Ga0105240_102326071 411
304 3300009545 Ga0105237_10000400 Ga0105237_100004002 411
305 3300009545 Ga0105237_10007738 Ga0105237_1000773813 411
306 3300010375 Ga0105239_10001703 Ga0105239_100017037 411
307 3300025272 Ga0209455_1001743 Ga0209455_10017434 411
308 3300025913 Ga0207695_10000267 Ga0207695_1000026758 411
309 3300025914 Ga0207671_10000244 Ga0207671_1000024444 411
310 3300002737 JGI25162J39368_1000086 JGI25162J39368_1000086104 412
311 3300005578 Ga0068854_100027376 Ga0068854_1000273763 412
312 3300009093 Ga0105240_10078599 Ga0105240_100785992 412
313 3300009093 Ga0105240_10366139 Ga0105240_103661392 412
314 3300009545 Ga0105237_10030263 Ga0105237_100302632 412
315 3300009545 Ga0105237_10031518 Ga0105237_100315182 412
316 3300010375 Ga0105239_10003895 Ga0105239_100038957 412
317 3300010375 Ga0105239_10023003 Ga0105239_100230036 412
318 3300025233 Ga0209437_100144 Ga0209437_1001445 412
319 3300025913 Ga0207695_10118949 Ga0207695_101189493 412
320 3300025914 Ga0207671_10013461 Ga0207671_100134612 412
321 3300025914 Ga0207671_10015710 Ga0207671_100157104 412
322 3300025981 Ga0207640_10009334 Ga0207640_100093345 412
323 3300046492 Ga0495585_0000097 Ga0495585_0000097_35750_36988 412
324 3300046810 Ga0495660_0003749 Ga0495660_0003749_3690_4928 412
325 3300047472 Ga0495686_0000249 Ga0495686_0000249_67360_68604 412
326 3300001990 JGI24737J22298_10009113 JGI24737J22298_100091133 413
327 3300002067 JGI24735J21928_10000007 JGI24735J21928_10000007160 413
328 3300003316 rootH1_10055794 rootH1_100557944 413
329 3300005563 Ga0068855_100036848 Ga0068855_1000368482 413
330 3300006195 Ga0075366_10006224 Ga0075366_100062245 413
331 3300010375 Ga0105239_10200895 Ga0105239_102008952 413
332 3300013105 Ga0157369_10075089 Ga0157369_100750892 413
333 3300013306 Ga0163162_10002921 Ga0163162_1000292113 413
334 3300025949 Ga0207667_10030351 Ga0207667_100303516 413
335 3300046471 Ga0495650_0000236 Ga0495650_0000236_37476_38717 413
336 3300046492 Ga0495585_0000111 Ga0495585_0000111_84570_85829 413
337 3300046506 Ga0495583_0008651 Ga0495583_0008651_4934_6175 413
338 3300046507 Ga0495606_0000036 Ga0495606_0000036_106008_107249 413
339 3300046507 Ga0495606_0015038 Ga0495606_0015038_2943_4184 413
340 3300046512 Ga0495610_0000500 Ga0495610_0000500_15716_16957 413
341 3300046513 Ga0495616_0000821 Ga0495616_0000821_16600_17844 413
342 3300046513 Ga0495616_0002784 Ga0495616_0002784_5760_7007 413
343 3300046524 Ga0495648_0001819 Ga0495648_0001819_164_1417 413
344 3300046524 Ga0495648_0023734 Ga0495648_0023734_2328_3578 413
345 3300046558 Ga0495633_0017809 Ga0495633_0017809_1424_2665 413
346 3300046616 Ga0495668_0045179 Ga0495668_0045179_539_1786 413
347 3300046660 Ga0495625_0000110 Ga0495625_0000110_119325_120572 413
348 3300046660 Ga0495625_0004018 Ga0495625_0004018_12654_13907 413
349 3300046665 Ga0495661_0015450 Ga0495661_0015450_2630_3871 413
350 3300046683 Ga0495658_0008802 Ga0495658_0008802_3747_5000 413
351 3300046694 Ga0495649_0000011 Ga0495649_0000011_368173_369420 413
352 3300047443 Ga0495687_005362 Ga0495687_005362_759_2000 413
353 3300047469 Ga0495673_0024700 Ga0495673_0024700_330_1577 413
354 3300049459 Ga0495678_021035 Ga0495678_021035_54_1298 413
355 3300050493 nmdc:mga0k408_15724_c1 nmdc:mga0k408_15724_c1_1065_2306 413

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

295

429

0.84

PF08534

Redoxin

Redoxin

295

444

0.84

PF13905

Thioredoxin_8

Thioredoxin-like

321

426

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
3or5-assembly1.cif.gz_A crystal structure of thiol:disulfide interchange protein, thioredoxin family protein from chlorobium tepidum tls 0.8271 249 407
2h1g-assembly1.cif.gz_A resa c74a/c77a 0.8241 248 395
2h19-assembly2.cif.gz_B crystal structure of resa cys77ala variant 0.8157 248 396
1st9-assembly2.cif.gz_B crystal structure of a soluble domain of resa in the oxidised form 0.8105 248 396
3c71-assembly1.cif.gz_A structure of a resa variant with a dsba-like active site motif (cphc) 0.8048 248 395
ID Description Score Start End Superfamily
3gl3B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8262 244 409 3.40.30.10
3gl3B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8207 244 409 3.40.30.10
3or5A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8109 249 406 3.40.30.10
1st9A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8069 248 396 3.40.30.10
af_Q54IQ1_93_203_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7947 272 408 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A494W717-F1-model_v4 TlpA family protein disulfide reductase 0.9873 16 413 GO:0016491
GO:0017004
AF-A0A7W1EZ68-F1-model_v4 TlpA family protein disulfide reductase 0.9816 241 409 GO:0016491
GO:0017004
AF-A0A7W1SMK8-F1-model_v4 TlpA family protein disulfide reductase 0.9816 257 410 GO:0016491
GO:0017004
AF-A0A4Q5QFV3-F1-model_v4 TlpA family protein disulfide reductase 0.9798 23 211
AF-A0A4Q6E026-F1-model_v4 TlpA family protein disulfide reductase 0.9792 121 409 GO:0016491
GO:0017004

Feature Viewer

pLDDT pTM Quality
92 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map