F420044

General Info

Members Datasets Scaffolds Average Seq Length
355 201 710 178

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100025692|Ga0070699_1000256922
Length 211
Sequence MSLAERRECVEQLAYAGRGSHEVLGERGTKNTPVTMIFKETNLAGVIEVTLDHRSDERGFFARSWCETEFADHGLNPRLVQCNVSFNVSKGTLRGMHYQDEPYPEAKLVRCTQGAIYDVAMDLRRQSATFKRWFGAVLSAENRHMLYIPEGCAHGFLTLTDNTEVFYQMSEFYQPESARGVRFDDPAFRIVWPEKVEVISERDRTYPNFEA

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
58 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
59 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
75 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
78 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
79 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
80 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
81 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
82 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
83 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
84 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
85 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
86 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
87 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
88 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
89 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
90 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
91 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
92 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
93 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
94 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
95 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
96 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
99 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
100 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
101 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
102 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
106 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
107 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
108 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
110 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
111 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
112 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
113 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
118 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
119 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
120 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
121 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
122 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
123 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
124 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
125 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
126 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
127 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
128 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
129 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
130 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
133 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
134 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
135 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
136 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
137 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
138 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
139 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
140 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
141 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
142 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
143 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
144 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
145 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
146 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
151 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
152 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
165 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
166 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
167 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
168 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
169 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
170 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
171 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
172 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
173 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
174 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
175 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
176 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
179 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
182 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
187 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
188 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
189 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
190 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
191 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
192 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
193 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
194 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
195 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
196 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
197 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
198 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
199 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
200 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
201 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0
Isolates 0.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.82
Nodule 0
Rhizoplane 1.13
Rhizosphere 94.37
Stem 0
Stem Tuber 0
Unclassified 12.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_100025692 3300005518 Bacteria 5076
2 JGI24751J29686_10019127 3300002459 Bacteria 1418
3 JGI25407J50210_10004743 3300003373 Bacteria 3318
4 Ga0070670_100008590 3300005331 Bacteria 8713
5 Ga0070689_100489165 3300005340 Unclassified 1052
6 Ga0070687_100081226 3300005343 Bacteria 1769
7 Ga0070671_100715476 3300005355 Unclassified 869
8 Ga0070709_10084445 3300005434 Unclassified 2080
9 Ga0070709_10647457 3300005434 Bacteria 818
10 Ga0070714_100061676 3300005435 Bacteria 3221
11 Ga0070713_100036833 3300005436 Bacteria 3952
12 Ga0070711_100094735 3300005439 Unclassified 2159
13 Ga0070705_100096945 3300005440 Bacteria 1852
14 Ga0070705_100641188 3300005440 Bacteria 827
15 Ga0070694_100003717 3300005444 Bacteria 9097
16 Ga0070708_100064449 3300005445 Bacteria 3283
17 Ga0070708_100704559 3300005445 Unclassified 950
18 Ga0070663_100483642 3300005455 Unclassified 1025
19 Ga0070706_100004114 3300005467 Bacteria 14152
20 Ga0070706_100880984 3300005467 Bacteria 827
21 Ga0070707_100003707 3300005468 Bacteria 14408
22 Ga0070707_100098810 3300005468 Unclassified 2827
23 Ga0070707_100234774 3300005468 Bacteria 1785
24 Ga0070698_100000421 3300005471 Bacteria 45224
25 Ga0070698_100012476 3300005471 Bacteria 8994
26 Ga0070698_100053517 3300005471 Unclassified 4102
27 Ga0070699_100007663 3300005518 Bacteria 9386
28 Ga0070699_100011287 3300005518 Bacteria 7717
29 Ga0070699_100025905 3300005518 Bacteria 5056
30 Ga0070699_100049956 3300005518 Bacteria 3620
31 Ga0070699_100613233 3300005518 Bacteria 992
32 Ga0070697_100009482 3300005536 Bacteria 7608
33 Ga0070697_100038588 3300005536 Bacteria 3860
34 Ga0070697_100131130 3300005536 Bacteria 2102
35 Ga0070697_100225118 3300005536 Viruses 1599
36 Ga0070696_100000070 3300005546 Bacteria 49576
37 Ga0070696_100041904 3300005546 Bacteria 3165
38 Ga0070693_100000653 3300005547 Bacteria 15287
39 Ga0070704_100003430 3300005549 Bacteria 9086
40 Ga0070704_100166071 3300005549 Unclassified 1750
41 Ga0070704_100255965 3300005549 Bacteria 1440
42 Ga0068857_100173038 3300005577 Bacteria 1963
43 Ga0068861_100018447 3300005719 Bacteria 4971
44 Ga0068870_10037227 3300005840 Bacteria 2507
45 Ga0068860_100298752 3300005843 Bacteria 1577
46 Ga0068862_101591409 3300005844 Bacteria 660
47 Ga0081455_10002275 3300005937 Bacteria 22911
48 Ga0081455_10006967 3300005937 Bacteria 12010
49 Ga0081455_10007276 3300005937 Bacteria 11682
50 Ga0081455_10014788 3300005937 Bacteria 7614
51 Ga0081538_10001180 3300005981 Bacteria 27546
52 Ga0081538_10008658 3300005981 Bacteria 8602
53 Ga0081538_10024992 3300005981 Bacteria 4234
54 Ga0081539_10058578 3300005985 Bacteria 2125
55 Ga0075432_10122453 3300006058 Unclassified 978
56 Ga0070715_10090659 3300006163 Bacteria 1406
57 Ga0070715_10218522 3300006163 Unclassified 978
58 Ga0070716_100084645 3300006173 Bacteria 1902
59 Ga0070716_100093545 3300006173 Unclassified 1825
60 Ga0075366_10073644 3300006195 Bacteria 2036
61 Ga0075428_100046298 3300006844 Bacteria 4778
62 Ga0075428_100229562 3300006844 Bacteria 2003
63 Ga0075430_100378732 3300006846 Bacteria 1168
64 Ga0075430_100439003 3300006846 Bacteria 1077
65 Ga0075430_100487359 3300006846 Bacteria 1017
66 Ga0075431_100030386 3300006847 Bacteria 5565
67 Ga0075431_100113559 3300006847 Bacteria 2796
68 Ga0075431_100165163 3300006847 Unclassified 2276
69 Ga0075431_101304321 3300006847 Bacteria 687
70 Ga0075433_10007886 3300006852 Bacteria 8468
71 Ga0075433_10093422 3300006852 Bacteria 2661
72 Ga0075433_10192590 3300006852 Bacteria 1814
73 Ga0075433_10810956 3300006852 Unclassified 818
74 Ga0075434_100036850 3300006871 Bacteria 4838
75 Ga0075434_100063066 3300006871 Bacteria 3689
76 Ga0075434_100084558 3300006871 Bacteria 3172
77 Ga0075434_100257948 3300006871 Unclassified 1762
78 Ga0075434_101180538 3300006871 Bacteria 778
79 Ga0075429_100008472 3300006880 Bacteria 8952
80 Ga0075429_100141737 3300006880 Bacteria 2104
81 Ga0075436_100005554 3300006914 Bacteria 8666
82 Ga0075436_100449256 3300006914 Unclassified 938
83 Ga0075435_100144526 3300007076 Bacteria 1997
84 Ga0075435_100247518 3300007076 Bacteria 1517
85 Ga0075435_100545207 3300007076 Bacteria 1004
86 Ga0105240_10059398 3300009093 Unclassified 4773
87 Ga0111539_10002204 3300009094 Bacteria 26011
88 Ga0111539_10010935 3300009094 Bacteria 11423
89 Ga0111539_10013138 3300009094 Bacteria 10357
90 Ga0111539_10360570 3300009094 Unclassified 1692
91 Ga0111539_11184092 3300009094 Bacteria 888
92 Ga0111539_12538748 3300009094 Bacteria 594
93 Ga0114129_10013718 3300009147 Bacteria 11548
94 Ga0114129_10014963 3300009147 Bacteria 11053
95 Ga0114129_10019473 3300009147 Bacteria 9664
96 Ga0114129_10053539 3300009147 Bacteria 5660
97 Ga0114129_10075872 3300009147 Bacteria 4681
98 Ga0114129_10104064 3300009147 Bacteria 3923
99 Ga0114129_10142048 3300009147 Bacteria 3290
100 Ga0114129_10320353 3300009147 Bacteria 2061
101 Ga0114129_10589334 3300009147 Bacteria 1442
102 Ga0114129_11010126 3300009147 Bacteria 1047
103 Ga0105243_10069015 3300009148 Bacteria 2850
104 Ga0105241_10869402 3300009174 Unclassified 835
105 Ga0105242_10082681 3300009176 Bacteria 2688
106 Ga0105248_10502261 3300009177 Unclassified 1367
107 Ga0105248_11096497 3300009177 Unclassified 900
108 Ga0105237_10249847 3300009545 Bacteria 1775
109 Ga0105238_11349945 3300009551 Unclassified 739
110 Ga0105249_10595022 3300009553 Bacteria 1160
111 Ga0105246_10353168 3300011119 Bacteria 1205
112 Ga0157374_10343604 3300013296 Bacteria 1482
113 Ga0157375_10302600 3300013308 Bacteria 1763
114 Ga0157375_10701852 3300013308 Bacteria 1165
115 Ga0157376_10028152 3300014969 Bacteria 4463
116 Ga0213872_10009438 3300021361 Unclassified 4678
117 Ga0213876_10257606 3300021384 Bacteria 927
118 Ga0207699_10055315 3300025906 Unclassified 2360
119 Ga0207699_10062036 3300025906 Unclassified 2252
120 Ga0207643_10006388 3300025908 Bacteria 6311
121 Ga0207684_10026968 3300025910 Bacteria 4898
122 Ga0207684_10036018 3300025910 Bacteria 4201
123 Ga0207684_11075796 3300025910 Bacteria 670
124 Ga0207663_10077944 3300025916 Unclassified 2159
125 Ga0207646_10004780 3300025922 Bacteria 14543
126 Ga0207646_10009041 3300025922 Bacteria 9898
127 Ga0207646_10042761 3300025922 Bacteria 4070
128 Ga0207646_10384028 3300025922 Bacteria 1269
129 Ga0207650_10011743 3300025925 Bacteria 6039
130 Ga0207664_10063211 3300025929 Bacteria 2958
131 Ga0207644_10653712 3300025931 Unclassified 875
132 Ga0207709_10038274 3300025935 Bacteria 2855
133 Ga0207665_10006478 3300025939 Bacteria 7769
134 Ga0207689_10470070 3300025942 Bacteria 1052
135 Ga0207667_10001271 3300025949 Bacteria 31677
136 Ga0207712_10640492 3300025961 Unclassified 923
137 Ga0207674_10215909 3300026116 Bacteria 1866
138 Ga0207675_100043532 3300026118 Bacteria 4192
139 Ga0207428_10007306 3300027907 Bacteria 10092
140 Ga0207428_10015102 3300027907 Bacteria 6686
141 Ga0207428_10038696 3300027907 Bacteria 3875
142 Ga0207428_10087840 3300027907 Unclassified 2418
143 Ga0207428_10425233 3300027907 Bacteria 970
144 Ga0268265_10251047 3300028380 Bacteria 1567
145 Ga0268265_10437188 3300028380 Bacteria 1219
146 Ga0268265_11348863 3300028380 Bacteria 714
147 Ga0268264_10488918 3300028381 Bacteria 1198
148 Ga0265326_10000135 3300028558 Archaea 38204
149 Ga0265319_1021456 3300028563 Bacteria 2372
150 Ga0265319_1062807 3300028563 Bacteria 1202
151 Ga0265334_10001044 3300028573 Archaea 13647
152 Ga0265334_10047759 3300028573 Bacteria 1650
153 Ga0265318_10177878 3300028577 Bacteria 779
154 Ga0265323_10007219 3300028653 Bacteria 4632
155 Ga0265336_10000249 3300028666 Archaea 38232
156 Ga0265336_10015488 3300028666 Bacteria 2505
157 Ga0307515_10031589 3300028794 Bacteria 8819
158 Ga0265338_10000406 3300028800 Archaea 77267
159 Ga0265338_10015145 3300028800 Bacteria 8505
160 Ga0265338_10274699 3300028800 Bacteria 1234
161 Ga0265338_10340300 3300028800 Bacteria 1081
162 Ga0265324_10000272 3300029957 Archaea 38220
163 Ga0265330_10002824 3300031235 Bacteria 9299
164 Ga0265320_10006623 3300031240 Bacteria 7280
165 Ga0265325_10011178 3300031241 Bacteria 5166
166 Ga0265325_10045715 3300031241 Bacteria 2274
167 Ga0265340_10000040 3300031247 Archaea 58470
168 Ga0265340_10107517 3300031247 Unclassified 1292
169 Ga0265339_10003266 3300031249 Archaea 11356
170 Ga0265339_10005415 3300031249 Bacteria 8503
171 Ga0265339_10226327 3300031249 Bacteria 913
172 Ga0265331_10000071 3300031250 Archaea 150739
173 Ga0265316_10002063 3300031344 Bacteria 21156
174 Ga0265316_10024631 3300031344 Bacteria 5035
175 Ga0265316_10030045 3300031344 Bacteria 4461
176 Ga0265316_10419771 3300031344 Bacteria 962
177 Ga0307408_100110079 3300031548 Bacteria 2114
178 Ga0307408_100489060 3300031548 Bacteria 1075
179 Ga0265313_10001858 3300031595 Bacteria 19223
180 Ga0265314_10009502 3300031711 Archaea 8200
181 Ga0265314_10035247 3300031711 Bacteria 3649
182 Ga0265342_10001393 3300031712 Bacteria 22613
183 Ga0265342_10002794 3300031712 Bacteria 14771
184 Ga0265342_10042948 3300031712 Archaea 2729
185 Ga0265342_10348742 3300031712 Unclassified 771
186 Ga0307405_10011066 3300031731 Bacteria 4710
187 Ga0307405_10190300 3300031731 Bacteria 1482
188 Ga0316577_10098841 3300031733 Bacteria 1635
189 Ga0307410_10070226 3300031852 Bacteria 2425
190 Ga0307406_10004934 3300031901 Bacteria 7270
191 Ga0307406_10388253 3300031901 Bacteria 1103
192 Ga0307407_10058035 3300031903 Bacteria 2248
193 Ga0307407_10592180 3300031903 Bacteria 825
194 Ga0307412_10378952 3300031911 Bacteria 1145
195 Ga0307412_10672887 3300031911 Bacteria 885
196 Ga0307409_100000840 3300031995 Bacteria 14150
197 Ga0307409_100167672 3300031995 Bacteria 1929
198 Ga0307416_100041393 3300032002 Bacteria 3588
199 Ga0307416_100167307 3300032002 Bacteria 2041
200 Ga0307414_10067788 3300032004 Bacteria 2558
201 Ga0307414_10401062 3300032004 Bacteria 1191
202 Ga0307415_100007195 3300032126 Bacteria 6071
203 Ga0307415_100067191 3300032126 Bacteria 2504
204 Ga0373926_0015607 3300035083 Bacteria 2590
205 Ga0373923_0445956 3300035111 Unclassified 627
206 Ga0373945_0219165 3300035116 Unclassified 795
207 Ga0373956_0206032 3300035119 Unclassified 932
208 Ga0373943_0069322 3300035170 Bacteria 1782
209 Ga0373935_0102878 3300035692 Bacteria 1885
210 Ga0373933_0000404 3300035724 Bacteria 27329
211 Ga0373937_0001737 3300036401 Bacteria 18330
212 Ga0373937_0050861 3300036401 Bacteria 3797
213 Ga0395905_0407548 3300037471 Bacteria 1255
214 Ga0395905_0432434 3300037471 Bacteria 1213
215 Ga0395901_0334214 3300038443 Bacteria 1566
216 Ga0395901_0995164 3300038443 Bacteria 815
217 Ga0400484_00615 3300038725 Bacteria 15949
218 Ga0400484_27425 3300038725 Bacteria 2237
219 Ga0400488_45007 3300038741 Bacteria 4880
220 Ga0436365_0522242 3300039437 Bacteria 1774
221 Ga0436361_0048153 3300039447 Bacteria 35068
222 Ga0439448_0041167 3300042005 Bacteria 1494
223 Ga0439448_0042255 3300042005 Bacteria 1477
224 Ga0439448_0267776 3300042005 Bacteria 604
225 Ga0439450_120352 3300042008 Unclassified 676
226 Ga0439455_0034666 3300042012 Bacteria 1271
227 Ga0439458_0044397 3300042157 Bacteria 1085
228 Ga0450916_004390 3300042530 Bacteria 1590
229 Ga0439440_0043548 3300042993 Bacteria 1101
230 Ga0439440_0127217 3300042993 Bacteria 714
231 Ga0466969_0092899 3300044656 Unclassified 1428
232 Ga0453683_0056340 3300044673 Bacteria 2460
233 Ga0453683_0068094 3300044673 Bacteria 2225
234 Ga0453683_0147763 3300044673 Bacteria 1484
235 Ga0453683_0630609 3300044673 Bacteria 700
236 Ga0466963_0708939 3300044694 Unclassified 710
237 Ga0453684_0000003 3300044712 Bacteria 1481694
238 Ga0453684_0186996 3300044712 Unclassified 2426
239 Ga0453684_0796260 3300044712 Bacteria 1020
240 Ga0451576_0000454 3300045051 Bacteria 93047
241 Ga0495590_0000594 3300046457 Bacteria 17084
242 Ga0495638_0001299 3300046460 Bacteria 23183
243 Ga0495650_0009567 3300046471 Bacteria 5500
244 Ga0495580_0533989 3300046472 Bacteria 780
245 Ga0495583_0218412 3300046506 Unclassified 771
246 Ga0495610_0007755 3300046512 Bacteria 7084
247 Ga0495631_0014535 3300046518 Bacteria 3797
248 Ga0495637_0082473 3300046520 Bacteria 1280
249 Ga0495652_0492147 3300046529 Bacteria 852
250 Ga0495597_0039404 3300046542 Bacteria 2116
251 Ga0495668_0005138 3300046616 Bacteria 8996
252 Ga0495588_0167498 3300046674 Bacteria 1162
253 Ga0495623_0255428 3300046679 Unclassified 984
254 Ga0495675_0054062 3300047444 Bacteria 2549
255 Ga0495686_0001132 3300047472 Bacteria 31511
256 Ga0495686_0020318 3300047472 Bacteria 4429
257 Ga0496102_0094668 3300048905 Bacteria 2768
258 Ga0496107_0229997 3300048910 Bacteria 1380
259 Ga0496112_0559645 3300048915 Bacteria 1077
260 Ga0496115_0127896 3300048918 Bacteria 2093
261 Ga0495678_010621 3300049459 Bacteria 4461
262 Ga0501031_0000761 3300049568 Bacteria 19398
263 Ga0501033_0036977 3300049570 Bacteria 3657
264 Ga0501036_0000024 3300049572 Bacteria 110026
265 Ga0501036_0721609 3300049572 Unclassified 823
266 Ga0501037_0025201 3300049573 Bacteria 4395
267 Ga0501038_0003033 3300049574 Bacteria 15665
268 Ga0501038_0270214 3300049574 Bacteria 1341
269 Ga0501039_0001763 3300049575 Bacteria 15968
270 Ga0501039_0079373 3300049575 Bacteria 2553
271 Ga0501039_0255045 3300049575 Bacteria 1379
272 Ga0501040_0008548 3300049576 Bacteria 6644
273 Ga0501040_0318875 3300049576 Bacteria 1112
274 Ga0501041_0004336 3300049577 Bacteria 8203
275 Ga0501041_0243797 3300049577 Bacteria 1129
276 Ga0501042_0000661 3300049578 Bacteria 18527
277 Ga0501042_0132066 3300049578 Bacteria 1799
278 Ga0501042_0251650 3300049578 Bacteria 1275
279 Ga0501042_0274982 3300049578 Bacteria 1216
280 Ga0501043_0024895 3300049579 Bacteria 4696
281 Ga0501046_0000495 3300049580 Bacteria 39248
282 Ga0501048_0000192 3300049582 Bacteria 39421
283 Ga0501048_0110298 3300049582 Bacteria 1943
284 Ga0501067_0006892 3300049583 Bacteria 6305
285 Ga0501068_0012296 3300049584 Bacteria 4845
286 Ga0501070_0423275 3300049586 Bacteria 1075
287 Ga0501071_0000269 3300049587 Bacteria 24497
288 Ga0501071_0023696 3300049587 Bacteria 4288
289 Ga0501071_0081252 3300049587 Bacteria 2372
290 Ga0501071_1000788 3300049587 Bacteria 646
291 Ga0501072_0001510 3300049588 Bacteria 17434
292 Ga0501072_0013750 3300049588 Bacteria 6197
293 Ga0501073_0001056 3300049589 Bacteria 19872
294 Ga0501074_0001129 3300049590 Bacteria 17480
295 Ga0501075_0000132 3300049591 Bacteria 37143
296 Ga0501075_0007249 3300049591 Bacteria 7688
297 Ga0501075_0153916 3300049591 Bacteria 1753
298 Ga0501076_0008195 3300049592 Bacteria 7653
299 Ga0501076_0077364 3300049592 Bacteria 2669
300 Ga0501077_0001549 3300049593 Bacteria 13860
301 Ga0501077_0016257 3300049593 Bacteria 4687
302 Ga0501077_0649548 3300049593 Bacteria 678
303 Ga0501080_0039480 3300049742 Bacteria 4405
304 Ga0501081_0006838 3300049743 Bacteria 7418
305 Ga0501081_0076879 3300049743 Bacteria 2332
306 Ga0501035_0002557 3300049822 Bacteria 17793
307 Ga0501035_0630793 3300049822 Bacteria 871
308 Ga0501044_0226752 3300049823 Bacteria 1818
309 Ga0501045_0000216 3300049824 Bacteria 33098
310 nmdc:mga0k408_278341_c1 3300050493 Bacteria 999
311 nmdc:mga05p37_10372_c1 3300050507 Bacteria 11061
312 nmdc:mga05p37_10682_c1 3300050507 Bacteria 10898
313 nmdc:mga05p37_11280_c1 3300050507 Bacteria 10628
314 nmdc:mga05p37_1137176_c1 3300050507 Bacteria 814
315 nmdc:mga05p37_286671_c1 3300050507 Bacteria 1961
316 nmdc:mga05p37_52837_c1 3300050507 Bacteria 4996
317 nmdc:mga05p37_571600_c1 3300050507 Bacteria 1282
318 nmdc:mga05p37_612593_c1 3300050507 Unclassified 1227
319 nmdc:mga09592_4085_c1 3300050508 Bacteria 11785
320 nmdc:mga09592_75465_c1 3300050508 Unclassified 2866
321 nmdc:mga0qj67_316319_c1 3300050509 Bacteria 1264
322 nmdc:mga0qj67_364194_c1 3300050509 Bacteria 1168
323 nmdc:mga06r32_346043_c1 3300050510 Bacteria 1471
324 nmdc:mga06r32_40284_c1 3300050510 Bacteria 4434
325 nmdc:mga06r32_549261_c1 3300050510 Bacteria 1129
326 nmdc:mga08y16_1454_c1 3300050511 Bacteria 23727
327 nmdc:mga08y16_62637_c1 3300050511 Bacteria 3885
328 nmdc:mga08y16_752277_c1 3300050511 Bacteria 971
329 nmdc:mga08y16_9117_c1 3300050511 Bacteria 10414
330 nmdc:mga0n895_162378_c1 3300050512 Unclassified 2266
331 nmdc:mga0n895_26283_c1 3300050512 Bacteria 5511
332 nmdc:mga0n895_725948_c1 3300050512 Bacteria 988
333 nmdc:mga0rr50_130717_c1 3300050513 Bacteria 2010
334 nmdc:mga0rr50_23108_c1 3300050513 Bacteria 4281
335 nmdc:mga0rr50_411270_c1 3300050513 Bacteria 1144
336 nmdc:mga0rr50_546745_c1 3300050513 Bacteria 986
337 nmdc:mga0a205_45076_c1 3300050515 Bacteria 4252
338 nmdc:mga0a205_559116_c1 3300050515 Bacteria 999
339 nmdc:mga0a205_6351_c1 3300050515 Bacteria 10674
340 Ga0495601_0503920 3300053077 Unclassified 781
341 Ga0495655_0008563 3300053083 Bacteria 1949
342 Ga0500578_0000895 3300053086 Bacteria 33760
343 Ga0500644_0003310 3300053088 Bacteria 3984
344 Ga0500646_0209818 3300053090 Bacteria 672
345 Ga0500641_0031334 3300053096 Bacteria 2096
346 Ga0500562_002922 3300053108 Bacteria 4268
347 Ga0500594_0000062 3300053118 Bacteria 33367
348 Ga0500559_0303061 3300053136 Bacteria 750
349 Ga0500622_0009854 3300053156 Bacteria 5272
350 Ga0501084_0003198 3300054114 Bacteria 13258
351 Ga0501084_0029363 3300054114 Bacteria 4600
352 Ga0501082_0002116 3300060353 Bacteria 17493
353 Ga0530510_0000013 3300061734 Bacteria 110065
354 Ga0530510_0106893 3300061734 Bacteria 2048
355 2585150262 2582581279 Bacteria 4980720
356 Ga0070699_100025692
357 JGI24751J29686_10019127
358 JGI25407J50210_10004743
359 Ga0070670_100008590
360 Ga0070689_100489165
361 Ga0070687_100081226
362 Ga0070671_100715476
363 Ga0070709_10084445
364 Ga0070709_10647457
365 Ga0070714_100061676
366 Ga0070713_100036833
367 Ga0070711_100094735
368 Ga0070705_100096945
369 Ga0070705_100641188
370 Ga0070694_100003717
371 Ga0070708_100064449
372 Ga0070708_100704559
373 Ga0070663_100483642
374 Ga0070706_100004114
375 Ga0070706_100880984
376 Ga0070707_100003707
377 Ga0070707_100098810
378 Ga0070707_100234774
379 Ga0070698_100000421
380 Ga0070698_100012476
381 Ga0070698_100053517
382 Ga0070699_100007663
383 Ga0070699_100011287
384 Ga0070699_100025905
385 Ga0070699_100049956
386 Ga0070699_100613233
387 Ga0070697_100009482
388 Ga0070697_100038588
389 Ga0070697_100131130
390 Ga0070697_100225118
391 Ga0070696_100000070
392 Ga0070696_100041904
393 Ga0070693_100000653
394 Ga0070704_100003430
395 Ga0070704_100166071
396 Ga0070704_100255965
397 Ga0068857_100173038
398 Ga0068861_100018447
399 Ga0068870_10037227
400 Ga0068860_100298752
401 Ga0068862_101591409
402 Ga0081455_10002275
403 Ga0081455_10006967
404 Ga0081455_10007276
405 Ga0081455_10014788
406 Ga0081538_10001180
407 Ga0081538_10008658
408 Ga0081538_10024992
409 Ga0081539_10058578
410 Ga0075432_10122453
411 Ga0070715_10090659
412 Ga0070715_10218522
413 Ga0070716_100084645
414 Ga0070716_100093545
415 Ga0075366_10073644
416 Ga0075428_100046298
417 Ga0075428_100229562
418 Ga0075430_100378732
419 Ga0075430_100439003
420 Ga0075430_100487359
421 Ga0075431_100030386
422 Ga0075431_100113559
423 Ga0075431_100165163
424 Ga0075431_101304321
425 Ga0075433_10007886
426 Ga0075433_10093422
427 Ga0075433_10192590
428 Ga0075433_10810956
429 Ga0075434_100036850
430 Ga0075434_100063066
431 Ga0075434_100084558
432 Ga0075434_100257948
433 Ga0075434_101180538
434 Ga0075429_100008472
435 Ga0075429_100141737
436 Ga0075436_100005554
437 Ga0075436_100449256
438 Ga0075435_100144526
439 Ga0075435_100247518
440 Ga0075435_100545207
441 Ga0105240_10059398
442 Ga0111539_10002204
443 Ga0111539_10010935
444 Ga0111539_10013138
445 Ga0111539_10360570
446 Ga0111539_11184092
447 Ga0111539_12538748
448 Ga0114129_10013718
449 Ga0114129_10014963
450 Ga0114129_10019473
451 Ga0114129_10053539
452 Ga0114129_10075872
453 Ga0114129_10104064
454 Ga0114129_10142048
455 Ga0114129_10320353
456 Ga0114129_10589334
457 Ga0114129_11010126
458 Ga0105243_10069015
459 Ga0105241_10869402
460 Ga0105242_10082681
461 Ga0105248_10502261
462 Ga0105248_11096497
463 Ga0105237_10249847
464 Ga0105238_11349945
465 Ga0105249_10595022
466 Ga0105246_10353168
467 Ga0157374_10343604
468 Ga0157375_10302600
469 Ga0157375_10701852
470 Ga0157376_10028152
471 Ga0213872_10009438
472 Ga0213876_10257606
473 Ga0207699_10055315
474 Ga0207699_10062036
475 Ga0207643_10006388
476 Ga0207684_10026968
477 Ga0207684_10036018
478 Ga0207684_11075796
479 Ga0207663_10077944
480 Ga0207646_10004780
481 Ga0207646_10009041
482 Ga0207646_10042761
483 Ga0207646_10384028
484 Ga0207650_10011743
485 Ga0207664_10063211
486 Ga0207644_10653712
487 Ga0207709_10038274
488 Ga0207665_10006478
489 Ga0207689_10470070
490 Ga0207667_10001271
491 Ga0207712_10640492
492 Ga0207674_10215909
493 Ga0207675_100043532
494 Ga0207428_10007306
495 Ga0207428_10015102
496 Ga0207428_10038696
497 Ga0207428_10087840
498 Ga0207428_10425233
499 Ga0268265_10251047
500 Ga0268265_10437188
501 Ga0268265_11348863
502 Ga0268264_10488918
503 Ga0265326_10000135
504 Ga0265319_1021456
505 Ga0265319_1062807
506 Ga0265334_10001044
507 Ga0265334_10047759
508 Ga0265318_10177878
509 Ga0265323_10007219
510 Ga0265336_10000249
511 Ga0265336_10015488
512 Ga0307515_10031589
513 Ga0265338_10000406
514 Ga0265338_10015145
515 Ga0265338_10274699
516 Ga0265338_10340300
517 Ga0265324_10000272
518 Ga0265330_10002824
519 Ga0265320_10006623
520 Ga0265325_10011178
521 Ga0265325_10045715
522 Ga0265340_10000040
523 Ga0265340_10107517
524 Ga0265339_10003266
525 Ga0265339_10005415
526 Ga0265339_10226327
527 Ga0265331_10000071
528 Ga0265316_10002063
529 Ga0265316_10024631
530 Ga0265316_10030045
531 Ga0265316_10419771
532 Ga0307408_100110079
533 Ga0307408_100489060
534 Ga0265313_10001858
535 Ga0265314_10009502
536 Ga0265314_10035247
537 Ga0265342_10001393
538 Ga0265342_10002794
539 Ga0265342_10042948
540 Ga0265342_10348742
541 Ga0307405_10011066
542 Ga0307405_10190300
543 Ga0316577_10098841
544 Ga0307410_10070226
545 Ga0307406_10004934
546 Ga0307406_10388253
547 Ga0307407_10058035
548 Ga0307407_10592180
549 Ga0307412_10378952
550 Ga0307412_10672887
551 Ga0307409_100000840
552 Ga0307409_100167672
553 Ga0307416_100041393
554 Ga0307416_100167307
555 Ga0307414_10067788
556 Ga0307414_10401062
557 Ga0307415_100007195
558 Ga0307415_100067191
559 Ga0373926_0015607
560 Ga0373923_0445956
561 Ga0373945_0219165
562 Ga0373956_0206032
563 Ga0373943_0069322
564 Ga0373935_0102878
565 Ga0373933_0000404
566 Ga0373937_0001737
567 Ga0373937_0050861
568 Ga0395905_0407548
569 Ga0395905_0432434
570 Ga0395901_0334214
571 Ga0395901_0995164
572 Ga0400484_00615
573 Ga0400484_27425
574 Ga0400488_45007
575 Ga0436365_0522242
576 Ga0436361_0048153
577 Ga0439448_0041167
578 Ga0439448_0042255
579 Ga0439448_0267776
580 Ga0439450_120352
581 Ga0439455_0034666
582 Ga0439458_0044397
583 Ga0450916_004390
584 Ga0439440_0043548
585 Ga0439440_0127217
586 Ga0466969_0092899
587 Ga0453683_0056340
588 Ga0453683_0068094
589 Ga0453683_0147763
590 Ga0453683_0630609
591 Ga0466963_0708939
592 Ga0453684_0000003
593 Ga0453684_0186996
594 Ga0453684_0796260
595 Ga0451576_0000454
596 Ga0495590_0000594
597 Ga0495638_0001299
598 Ga0495650_0009567
599 Ga0495580_0533989
600 Ga0495583_0218412
601 Ga0495610_0007755
602 Ga0495631_0014535
603 Ga0495637_0082473
604 Ga0495652_0492147
605 Ga0495597_0039404
606 Ga0495668_0005138
607 Ga0495588_0167498
608 Ga0495623_0255428
609 Ga0495675_0054062
610 Ga0495686_0001132
611 Ga0495686_0020318
612 Ga0496102_0094668
613 Ga0496107_0229997
614 Ga0496112_0559645
615 Ga0496115_0127896
616 Ga0495678_010621
617 Ga0501031_0000761
618 Ga0501033_0036977
619 Ga0501036_0000024
620 Ga0501036_0721609
621 Ga0501037_0025201
622 Ga0501038_0003033
623 Ga0501038_0270214
624 Ga0501039_0001763
625 Ga0501039_0079373
626 Ga0501039_0255045
627 Ga0501040_0008548
628 Ga0501040_0318875
629 Ga0501041_0004336
630 Ga0501041_0243797
631 Ga0501042_0000661
632 Ga0501042_0132066
633 Ga0501042_0251650
634 Ga0501042_0274982
635 Ga0501043_0024895
636 Ga0501046_0000495
637 Ga0501048_0000192
638 Ga0501048_0110298
639 Ga0501067_0006892
640 Ga0501068_0012296
641 Ga0501070_0423275
642 Ga0501071_0000269
643 Ga0501071_0023696
644 Ga0501071_0081252
645 Ga0501071_1000788
646 Ga0501072_0001510
647 Ga0501072_0013750
648 Ga0501073_0001056
649 Ga0501074_0001129
650 Ga0501075_0000132
651 Ga0501075_0007249
652 Ga0501075_0153916
653 Ga0501076_0008195
654 Ga0501076_0077364
655 Ga0501077_0001549
656 Ga0501077_0016257
657 Ga0501077_0649548
658 Ga0501080_0039480
659 Ga0501081_0006838
660 Ga0501081_0076879
661 Ga0501035_0002557
662 Ga0501035_0630793
663 Ga0501044_0226752
664 Ga0501045_0000216
665 nmdc:mga0k408_278341_c1
666 nmdc:mga05p37_10372_c1
667 nmdc:mga05p37_10682_c1
668 nmdc:mga05p37_11280_c1
669 nmdc:mga05p37_1137176_c1
670 nmdc:mga05p37_286671_c1
671 nmdc:mga05p37_52837_c1
672 nmdc:mga05p37_571600_c1
673 nmdc:mga05p37_612593_c1
674 nmdc:mga09592_4085_c1
675 nmdc:mga09592_75465_c1
676 nmdc:mga0qj67_316319_c1
677 nmdc:mga0qj67_364194_c1
678 nmdc:mga06r32_346043_c1
679 nmdc:mga06r32_40284_c1
680 nmdc:mga06r32_549261_c1
681 nmdc:mga08y16_1454_c1
682 nmdc:mga08y16_62637_c1
683 nmdc:mga08y16_752277_c1
684 nmdc:mga08y16_9117_c1
685 nmdc:mga0n895_162378_c1
686 nmdc:mga0n895_26283_c1
687 nmdc:mga0n895_725948_c1
688 nmdc:mga0rr50_130717_c1
689 nmdc:mga0rr50_23108_c1
690 nmdc:mga0rr50_411270_c1
691 nmdc:mga0rr50_546745_c1
692 nmdc:mga0a205_45076_c1
693 nmdc:mga0a205_559116_c1
694 nmdc:mga0a205_6351_c1
695 Ga0495601_0503920
696 Ga0495655_0008563
697 Ga0500578_0000895
698 Ga0500644_0003310
699 Ga0500646_0209818
700 Ga0500641_0031334
701 Ga0500562_002922
702 Ga0500594_0000062
703 Ga0500559_0303061
704 Ga0500622_0009854
705 Ga0501084_0003198
706 Ga0501084_0029363
707 Ga0501082_0002116
708 Ga0530510_0000013
709 Ga0530510_0106893
710 2585150262

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00908

dTDP_sugar_isom

dTDP-4-dehydrorhamnose 3,5-epimerase

40

211

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6c46-assembly3.cif.gz_E-2 crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase from elizabethkingia anophelis nuhp1 0.9705 1 174
6c46-assembly2.cif.gz_C crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase from elizabethkingia anophelis nuhp1 0.9641 1 174
7pvi-assembly1.cif.gz_BBB dtdp-sugar epimerase 0.9578 2 170
1dzt-assembly1.cif.gz_B rmlc from salmonella typhimurium 0.9552 2 173
3ryk-assembly1.cif.gz_B 1.63 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase (rfbc) from bacillus anthracis str. ames with tdp and ppi bound 0.9525 2 174
ID Description Score Start End Superfamily
5buvB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9429 2 174 2.60.120.10
2c0zA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9396 1 170 2.60.120.10
1epzA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9394 2 173 2.60.120.10
6dinA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9349 2 174 2.60.120.10
2ixcB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9327 1 173 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A536SWI1-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9992 1 173 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A1Q6VP32-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase 0.9975 1 145 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A1R3X2U9-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9954 2 173 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A383T4G5-F1-model_v4 deleted 0.9931 45 175
AF-W4SGX0-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) (dTDP-4-keto-6-deoxyglucose 3,5-epimerase) (dTDP-6-deoxy-D-xylo-4-hexulose 3,5-epimerase) 0.993 45 175 GO:0005829
GO:0008830
GO:0019305
GO:0045226

Map