F420054

General Info

Members Datasets Scaffolds Average Seq Length
355 224 355 203

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100805425|Ga0070665_1008054251
Length 240
Sequence MPDRCAPCTAGHRYAAEHGARAASRHDRVRVDRALMRIRHLVITLLAVGAIAVAGLTWAQLGGLSARANPSLPERVLARAARGLAVPRSGRDAVNPIAFSPEVWADGRAHFADHCASCHGNDGRGHTELGRNLYPKAPDMRLPDTQGLTDGEIYWIIENGIRLTGMPAWGDGTGHDADTWKLVHFIRHLNDQTAERLEEMEALNPRSRSELEEERQDRDFLDGKDSGLPSTTGSHHQHKE

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
164 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
166 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
167 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
168 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
169 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
170 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
171 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
172 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
173 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
174 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
175 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
176 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
177 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
178 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
179 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
180 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
181 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
182 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
183 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
184 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
185 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
186 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
187 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
188 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
189 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
208 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
209 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
210 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
211 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
212 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
213 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
214 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
215 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
216 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
217 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
218 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
219 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
220 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
221 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
222 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
223 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
224 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.79
Nodule 0
Rhizoplane 4.79
Rhizosphere 90.42
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_6667382 2162886011 Bacteria 1700
2 MBSR1b_contig_2196287 2162886012 Unclassified 2608
3 JGI24752J21851_1000709 3300001976 Bacteria 4446
4 JGI24737J22298_10031290 3300001990 Bacteria 1662
5 JGI24743J22301_10005537 3300001991 Bacteria 2112
6 JGI24751J29686_10064038 3300002459 Unclassified 757
7 Ga0065712_10107819 3300005290 Bacteria 1888
8 Ga0065715_10116040 3300005293 Bacteria 2394
9 Ga0065707_10093378 3300005295 Bacteria 3635
10 Ga0070676_10011026 3300005328 Bacteria 4912
11 Ga0070676_10039091 3300005328 Bacteria 2742
12 Ga0070683_100000704 3300005329 Bacteria 24281
13 Ga0070690_100010528 3300005330 Bacteria 5385
14 Ga0070690_100070523 3300005330 Bacteria 2269
15 Ga0070690_100074175 3300005330 Bacteria 2215
16 Ga0070670_100008800 3300005331 Bacteria 8616
17 Ga0070670_100152163 3300005331 Unclassified 2002
18 Ga0070677_10026661 3300005333 Bacteria 2169
19 Ga0068869_100112293 3300005334 Bacteria 2074
20 Ga0070666_10110621 3300005335 Bacteria 1900
21 Ga0070666_10114205 3300005335 Bacteria 1869
22 Ga0070680_100256851 3300005336 Unclassified 1478
23 Ga0070682_100010330 3300005337 Bacteria 5297
24 Ga0068868_100058000 3300005338 Bacteria 3059
25 Ga0068868_100093741 3300005338 Bacteria 2421
26 Ga0068868_100224441 3300005338 Bacteria 1574
27 Ga0070660_100007072 3300005339 Bacteria 7797
28 Ga0070660_100428305 3300005339 Unclassified 1096
29 Ga0070689_100006365 3300005340 Bacteria 8162
30 Ga0070691_10145834 3300005341 Bacteria 1210
31 Ga0070687_100002702 3300005343 Bacteria 6711
32 Ga0070661_100016366 3300005344 Bacteria 5241
33 Ga0070661_100247434 3300005344 Bacteria 1375
34 Ga0070668_100019796 3300005347 Bacteria 5069
35 Ga0070669_100088606 3300005353 Bacteria 2316
36 Ga0070675_100066873 3300005354 Unclassified 2973
37 Ga0070675_100207349 3300005354 Bacteria 1703
38 Ga0070671_100083790 3300005355 Bacteria 2666
39 Ga0070671_100194506 3300005355 Unclassified 1719
40 Ga0070674_100105237 3300005356 Bacteria 2063
41 Ga0070673_100002350 3300005364 Bacteria 11487
42 Ga0070673_100003194 3300005364 Bacteria 10151
43 Ga0070673_100014720 3300005364 Bacteria 5463
44 Ga0070673_100278771 3300005364 Bacteria 1466
45 Ga0070688_100000576 3300005365 Bacteria 18506
46 Ga0070688_100027779 3300005365 Unclassified 3371
47 Ga0070688_100030420 3300005365 Bacteria 3241
48 Ga0070688_100362566 3300005365 Bacteria 1064
49 Ga0070659_100000527 3300005366 Bacteria 27961
50 Ga0070659_100144490 3300005366 Bacteria 1938
51 Ga0070667_100029452 3300005367 Bacteria 4574
52 Ga0070667_100329942 3300005367 Unclassified 1378
53 Ga0070701_10014973 3300005438 Bacteria 3568
54 Ga0070700_100032267 3300005441 Bacteria 3146
55 Ga0070694_100023260 3300005444 Bacteria 3983
56 Ga0070663_100023193 3300005455 Unclassified 4157
57 Ga0070678_100028638 3300005456 Bacteria 3802
58 Ga0070678_100087515 3300005456 Bacteria 2379
59 Ga0068867_100011810 3300005459 Bacteria 6167
60 Ga0068867_100047915 3300005459 Unclassified 3143
61 Ga0068867_100088697 3300005459 Bacteria 2344
62 Ga0070707_100187765 3300005468 Unclassified 2015
63 Ga0070698_100065853 3300005471 Bacteria 3648
64 Ga0070698_100570986 3300005471 Bacteria 1071
65 Ga0070679_100140810 3300005530 Bacteria 2392
66 Ga0070684_100003207 3300005535 Bacteria 12234
67 Ga0070684_100766310 3300005535 Unclassified 901
68 Ga0070672_100025241 3300005543 Bacteria 4406
69 Ga0070686_100003422 3300005544 Bacteria 8712
70 Ga0070686_100015135 3300005544 Bacteria 4460
71 Ga0070686_100489346 3300005544 Bacteria 953
72 Ga0070695_100074202 3300005545 Bacteria 2235
73 Ga0070695_100591326 3300005545 Unclassified 870
74 Ga0070693_100634669 3300005547 Bacteria 775
75 Ga0070665_100004823 3300005548 Bacteria 14011
76 Ga0070665_100805425 3300005548 Bacteria 952
77 Ga0070704_100101207 3300005549 Bacteria 2171
78 Ga0068855_100033465 3300005563 Bacteria 6134
79 Ga0070664_100029173 3300005564 Unclassified 4598
80 Ga0068857_100012765 3300005577 Bacteria 7322
81 Ga0068854_100054570 3300005578 Bacteria 2875
82 Ga0068854_100331230 3300005578 Bacteria 1240
83 Ga0068856_100020436 3300005614 Bacteria 6431
84 Ga0070702_100007041 3300005615 Bacteria 5363
85 Ga0070702_100064246 3300005615 Bacteria 2146
86 Ga0070702_100536405 3300005615 Bacteria 866
87 Ga0070702_100962739 3300005615 Archaea 673
88 Ga0068852_100016986 3300005616 Bacteria 5696
89 Ga0068852_100587067 3300005616 Bacteria 1117
90 Ga0068859_100051071 3300005617 Unclassified 4155
91 Ga0068859_100221327 3300005617 Bacteria 1980
92 Ga0068859_100543553 3300005617 Bacteria 1256
93 Ga0068864_100023048 3300005618 Bacteria 5226
94 Ga0068866_10001573 3300005718 Bacteria 9693
95 Ga0068861_100076398 3300005719 Bacteria 2610
96 Ga0068861_100159705 3300005719 Bacteria 1858
97 Ga0068861_100413588 3300005719 Bacteria 1200
98 Ga0068861_100824190 3300005719 Unclassified 873
99 Ga0068851_10002796 3300005834 Bacteria 7690
100 Ga0068851_10058382 3300005834 Bacteria 1972
101 Ga0068870_10059718 3300005840 Bacteria 2045
102 Ga0068870_10060028 3300005840 Unclassified 2040
103 Ga0068863_100037728 3300005841 Unclassified 4598
104 Ga0068863_100716181 3300005841 Unclassified 995
105 Ga0068858_100034730 3300005842 Bacteria 4677
106 Ga0068860_100210400 3300005843 Bacteria 1886
107 Ga0068862_100010080 3300005844 Bacteria 7801
108 Ga0075363_100081373 3300006048 Bacteria 1772
109 Ga0075364_10227076 3300006051 Unclassified 1268
110 Ga0075364_10308095 3300006051 Unclassified 1078
111 Ga0070712_100257141 3300006175 Unclassified 1398
112 Ga0075367_10025046 3300006178 Unclassified 3370
113 Ga0075367_10047877 3300006178 Bacteria 2516
114 Ga0075367_10132948 3300006178 Bacteria 1538
115 Ga0075366_10011131 3300006195 Bacteria 5071
116 Ga0075366_10012114 3300006195 Bacteria 4884
117 Ga0097621_100053189 3300006237 Bacteria 3300
118 Ga0097621_100155364 3300006237 Bacteria 1963
119 Ga0097621_100295314 3300006237 Unclassified 1430
120 Ga0075370_10091563 3300006353 Bacteria 1754
121 Ga0068871_100001669 3300006358 Bacteria 14925
122 Ga0068871_100047786 3300006358 Bacteria 3452
123 Ga0068871_100079140 3300006358 Bacteria 2719
124 Ga0068871_100272790 3300006358 Unclassified 1478
125 Ga0075428_100018009 3300006844 Bacteria 7805
126 Ga0075428_100046822 3300006844 Bacteria 4750
127 Ga0075428_100654558 3300006844 Bacteria 1120
128 Ga0075431_100841576 3300006847 Unclassified 889
129 Ga0075433_10098870 3300006852 Bacteria 2583
130 Ga0075434_100024356 3300006871 Bacteria 5917
131 Ga0075434_100042664 3300006871 Bacteria 4498
132 Ga0075434_100249885 3300006871 Unclassified 1793
133 Ga0075429_100067497 3300006880 Bacteria 3112
134 Ga0068865_100078682 3300006881 Bacteria 2359
135 Ga0068865_100083062 3300006881 Unclassified 2305
136 Ga0075436_100140998 3300006914 Unclassified 1694
137 Ga0097620_100051077 3300006931 Unclassified 4155
138 Ga0097620_100221330 3300006931 Bacteria 1980
139 Ga0097620_100543588 3300006931 Bacteria 1256
140 Ga0097620_101046152 3300006931 Bacteria 897
141 Ga0075435_100044135 3300007076 Unclassified 3570
142 Ga0105250_10009930 3300009092 Unclassified 3992
143 Ga0111539_10049698 3300009094 Bacteria 4999
144 Ga0111539_10112936 3300009094 Bacteria 3187
145 Ga0111539_10289846 3300009094 Bacteria 1905
146 Ga0105245_10004290 3300009098 Bacteria 12641
147 Ga0105245_10036187 3300009098 Bacteria 4384
148 Ga0105245_10138420 3300009098 Bacteria 2290
149 Ga0114129_10048638 3300009147 Bacteria 5959
150 Ga0114129_10055836 3300009147 Bacteria 5534
151 Ga0105243_10331556 3300009148 Bacteria 1390
152 Ga0105242_10003580 3300009176 Bacteria 12082
153 Ga0105242_10023757 3300009176 Bacteria 4835
154 Ga0105242_10024569 3300009176 Bacteria 4760
155 Ga0105242_10050949 3300009176 Bacteria 3373
156 Ga0105248_10111799 3300009177 Bacteria 3081
157 Ga0105248_10140449 3300009177 Bacteria 2725
158 Ga0105248_10157447 3300009177 Bacteria 2563
159 Ga0105238_10099538 3300009551 Bacteria 2890
160 Ga0105249_10302419 3300009553 Bacteria 1605
161 Ga0105249_10409826 3300009553 Bacteria 1387
162 Ga0105239_10015229 3300010375 Bacteria 8520
163 Ga0105239_10251002 3300010375 Unclassified 1987
164 Ga0105246_10008798 3300011119 Bacteria 6211
165 Ga0157373_10002204 3300013100 Bacteria 14745
166 Ga0157371_10113506 3300013102 Bacteria 1924
167 Ga0157378_10225728 3300013297 Bacteria 1782
168 Ga0157378_10606031 3300013297 Unclassified 1107
169 Ga0163162_10158196 3300013306 Bacteria 2386
170 Ga0157372_10203772 3300013307 Bacteria 2292
171 Ga0157375_10109291 3300013308 Bacteria 2861
172 Ga0157375_10687629 3300013308 Bacteria 1177
173 Ga0157375_10786662 3300013308 Bacteria 1101
174 Ga0163163_10002687 3300014325 Bacteria 15031
175 Ga0163163_10130094 3300014325 Bacteria 2557
176 Ga0157380_10184994 3300014326 Unclassified 1834
177 Ga0157377_10002421 3300014745 Bacteria 8236
178 Ga0157379_10368626 3300014968 Bacteria 1317
179 Ga0157376_10070172 3300014969 Unclassified 2973
180 Ga0157376_10471511 3300014969 Bacteria 1228
181 Ga0163161_10003741 3300017792 Bacteria 10660
182 Ga0207656_10018108 3300025321 Unclassified 2767
183 Ga0207682_10015763 3300025893 Bacteria 2946
184 Ga0207710_10014150 3300025900 Unclassified 3361
185 Ga0207688_10004315 3300025901 Bacteria 7758
186 Ga0207688_10296702 3300025901 Unclassified 987
187 Ga0207680_10025702 3300025903 Bacteria 3251
188 Ga0207647_10003722 3300025904 Bacteria 11402
189 Ga0207645_10003011 3300025907 Bacteria 13020
190 Ga0207645_10023638 3300025907 Bacteria 3990
191 Ga0207643_10000930 3300025908 Bacteria 17568
192 Ga0207662_10000289 3300025918 Bacteria 23273
193 Ga0207662_10004113 3300025918 Bacteria 7608
194 Ga0207657_10001839 3300025919 Bacteria 22917
195 Ga0207649_10002401 3300025920 Bacteria 10505
196 Ga0207649_10144102 3300025920 Bacteria 1633
197 Ga0207652_10507841 3300025921 Bacteria 1085
198 Ga0207646_10155565 3300025922 Unclassified 2062
199 Ga0207646_10481074 3300025922 Unclassified 1119
200 Ga0207646_10816916 3300025922 Bacteria 830
201 Ga0207650_10000150 3300025925 Bacteria 83380
202 Ga0207659_10009794 3300025926 Bacteria 5996
203 Ga0207687_10019877 3300025927 Bacteria 4454
204 Ga0207687_10556676 3300025927 Unclassified 963
205 Ga0207644_10095511 3300025931 Bacteria 2223
206 Ga0207644_10157893 3300025931 Bacteria 1760
207 Ga0207644_10478315 3300025931 Bacteria 1025
208 Ga0207690_10013258 3300025932 Unclassified 4949
209 Ga0207706_10000790 3300025933 Bacteria 32752
210 Ga0207706_10100647 3300025933 Bacteria 2542
211 Ga0207686_10027408 3300025934 Bacteria 3337
212 Ga0207686_10036458 3300025934 Bacteria 2961
213 Ga0207670_10100678 3300025936 Bacteria 2063
214 Ga0207670_10400408 3300025936 Bacteria 1097
215 Ga0207669_10068995 3300025937 Bacteria 2210
216 Ga0207669_10286192 3300025937 Bacteria 1246
217 Ga0207704_10031954 3300025938 Bacteria 2972
218 Ga0207704_10796093 3300025938 Unclassified 789
219 Ga0207691_10001778 3300025940 Bacteria 21200
220 Ga0207691_10033741 3300025940 Bacteria 4765
221 Ga0207711_10012597 3300025941 Bacteria 7023
222 Ga0207711_10048227 3300025941 Unclassified 3644
223 Ga0207711_10403470 3300025941 Bacteria 1270
224 Ga0207689_10001791 3300025942 Bacteria 20289
225 Ga0207689_10107800 3300025942 Bacteria 2289
226 Ga0207689_10545069 3300025942 Bacteria 974
227 Ga0207661_10000422 3300025944 Bacteria 27313
228 Ga0207661_10365539 3300025944 Bacteria 1304
229 Ga0207679_10000359 3300025945 Bacteria 33269
230 Ga0207651_10022038 3300025960 Bacteria 3885
231 Ga0207651_10034422 3300025960 Bacteria 3281
232 Ga0207651_10076918 3300025960 Bacteria 2387
233 Ga0207712_10018895 3300025961 Unclassified 4495
234 Ga0207668_10097529 3300025972 Bacteria 2175
235 Ga0207668_11156134 3300025972 Bacteria 695
236 Ga0207640_10013195 3300025981 Bacteria 4730
237 Ga0207640_10162430 3300025981 Bacteria 1654
238 Ga0207640_10307204 3300025981 Bacteria 1257
239 Ga0207658_10004692 3300025986 Bacteria 9468
240 Ga0207658_10070193 3300025986 Bacteria 2650
241 Ga0207677_10038081 3300026023 Bacteria 3149
242 Ga0207703_10078363 3300026035 Unclassified 2745
243 Ga0207639_10109690 3300026041 Bacteria 2246
244 Ga0207678_10000498 3300026067 Bacteria 35724
245 Ga0207678_10084679 3300026067 Bacteria 2711
246 Ga0207708_10023723 3300026075 Bacteria 4637
247 Ga0207641_10000147 3300026088 Bacteria 99902
248 Ga0207641_10621283 3300026088 Unclassified 1059
249 Ga0207648_10001035 3300026089 Bacteria 31211
250 Ga0207648_10015628 3300026089 Bacteria 6973
251 Ga0207648_10022226 3300026089 Bacteria 5699
252 Ga0207676_10001035 3300026095 Bacteria 21311
253 Ga0207674_10000432 3300026116 Bacteria 54683
254 Ga0207675_100040089 3300026118 Unclassified 4371
255 Ga0207675_100042471 3300026118 Bacteria 4245
256 Ga0207675_100840753 3300026118 Unclassified 933
257 Ga0207683_10000692 3300026121 Bacteria 30940
258 Ga0207683_10058983 3300026121 Bacteria 3370
259 Ga0207683_10073104 3300026121 Bacteria 3033
260 Ga0207683_10082687 3300026121 Bacteria 2853
261 Ga0207698_10038766 3300026142 Bacteria 3524
262 Ga0207698_10159764 3300026142 Bacteria 1969
263 Ga0209813_10085993 3300027866 Unclassified 1048
264 Ga0207428_10081708 3300027907 Bacteria 2523
265 Ga0268266_10011689 3300028379 Bacteria 7617
266 Ga0268266_10020641 3300028379 Bacteria 5613
267 Ga0268266_10377232 3300028379 Bacteria 1337
268 Ga0268265_10010314 3300028380 Bacteria 6308
269 Ga0268265_10406289 3300028380 Unclassified 1260
270 Ga0268264_10034611 3300028381 Bacteria 4156
271 Ga0268264_10156443 3300028381 Unclassified 2049
272 Ga0268264_10455575 3300028381 Unclassified 1240
273 Ga0307408_100771582 3300031548 Bacteria 870
274 Ga0265314_10053004 3300031711 Unclassified 2816
275 Ga0307405_10535689 3300031731 Bacteria 945
276 Ga0307409_100237840 3300031995 Bacteria 1656
277 Ga0307416_101421595 3300032002 Unclassified 799
278 Ga0307414_10740340 3300032004 Unclassified 893
279 Ga0373938_0097878 3300034957 Bacteria 734
280 Ga0373923_0140779 3300035111 Unclassified 1090
281 Ga0373943_0002591 3300035170 Bacteria 8219
282 Ga0373946_0022207 3300035171 Unclassified 2468
283 Ga0373931_0215900 3300035691 Bacteria 1153
284 Ga0373933_0654095 3300035724 Unclassified 691
285 Ga0373925_0052224 3300037068 Unclassified 3054
286 Ga0373925_0128544 3300037068 Bacteria 1973
287 Ga0439446_0006742 3300042156 Bacteria 3005
288 Ga0439434_0150678 3300042435 Unclassified 770
289 Ga0451577_0122001 3300042876 Bacteria 2335
290 Ga0453684_0410017 3300044712 Bacteria 1516
291 Ga0453684_0844614 3300044712 Unclassified 984
292 Ga0495592_0021253 3300046454 Bacteria 4935
293 Ga0495582_0023804 3300046473 Unclassified 3348
294 Ga0495639_0006781 3300046475 Bacteria 4926
295 Ga0495608_0002111 3300046511 Bacteria 14317
296 Ga0495628_0093072 3300046516 Bacteria 2331
297 Ga0495630_0002604 3300046517 Bacteria 12502
298 Ga0495586_0012406 3300046535 Bacteria 4520
299 Ga0495586_0102257 3300046535 Unclassified 1591
300 Ga0495645_0194792 3300046543 Unclassified 1378
301 Ga0495667_0061450 3300046559 Bacteria 2463
302 Ga0495634_0301363 3300046642 Bacteria 969
303 Ga0495646_0201052 3300046680 Unclassified 1085
304 Ga0495669_0061596 3300046684 Bacteria 1698
305 Ga0495613_0002407 3300046689 Bacteria 14153
306 Ga0495676_0108667 3300047321 Bacteria 2040
307 Ga0495684_0001723 3300047471 Bacteria 17602
308 Ga0496100_0142166 3300048903 Bacteria 1702
309 Ga0496102_0071287 3300048905 Unclassified 3190
310 Ga0496104_0598413 3300048907 Bacteria 1013
311 Ga0496104_0657678 3300048907 Bacteria 957
312 Ga0496105_0249357 3300048908 Bacteria 1439
313 Ga0496106_0497462 3300048909 Unclassified 979
314 Ga0496106_0662493 3300048909 Unclassified 833
315 Ga0496107_0140607 3300048910 Bacteria 1784
316 Ga0496108_0000051 3300048911 Bacteria 131546
317 Ga0496109_0000105 3300048912 Bacteria 87116
318 Ga0496110_0012540 3300048913 Bacteria 6970
319 Ga0496111_0049851 3300048914 Unclassified 3019
320 Ga0496112_0005785 3300048915 Bacteria 10753
321 Ga0496112_0643055 3300048915 Unclassified 991
322 Ga0496113_0000499 3300048916 Bacteria 19290
323 Ga0496114_0080771 3300048917 Bacteria 2746
324 Ga0496114_0893855 3300048917 Bacteria 769
325 Ga0501031_0132836 3300049568 Bacteria 1626
326 Ga0501032_0017048 3300049569 Bacteria 5103
327 Ga0501038_0480263 3300049574 Bacteria 952
328 Ga0501039_0067015 3300049575 Bacteria 2788
329 Ga0501047_0430138 3300049581 Bacteria 1151
330 Ga0501068_0421749 3300049584 Bacteria 862
331 nmdc:mga00v17_238097_c1 3300050491 Unclassified 1180
332 nmdc:mga00v17_73116_c1 3300050491 Bacteria 2128
333 nmdc:mga0yw44_481920_c1 3300050492 Bacteria 841
334 nmdc:mga0k408_17693_c1 3300050493 Unclassified 3972
335 nmdc:mga06z11_150463_c1 3300050494 Unclassified 1323
336 nmdc:mga06z11_246826_c1 3300050494 Bacteria 1050
337 nmdc:mga07m45_66218_c1 3300050496 Bacteria 2052
338 nmdc:mga05p37_156172_c1 3300050507 Bacteria 2788
339 nmdc:mga05p37_312238_c1 3300050507 Bacteria 1863
340 nmdc:mga09592_69668_c1 3300050508 Bacteria 2983
341 nmdc:mga06r32_247013_c1 3300050510 Bacteria 1772
342 nmdc:mga06r32_482350_c1 3300050510 Bacteria 1218
343 nmdc:mga08y16_36974_c1 3300050511 Bacteria 5128
344 nmdc:mga08y16_64146_c1 3300050511 Bacteria 3836
345 nmdc:mga0n895_113863_c1 3300050512 Unclassified 2723
346 nmdc:mga0n895_81701_c1 3300050512 Bacteria 3220
347 nmdc:mga0rr50_4789_c1 3300050513 Bacteria 7988
348 nmdc:mga08x19_371614_c1 3300050514 Unclassified 1000
349 nmdc:mga08x19_434997_c1 3300050514 Unclassified 922
350 nmdc:mga0a205_25013_c1 3300050515 Bacteria 2965
351 Ga0495601_0006437 3300053077 Bacteria 6869
352 Ga0495595_0395160 3300053084 Unclassified 700
353 Ga0495619_0025294 3300053085 Bacteria 3811
354 Ga0495619_0506500 3300053085 Unclassified 830
355 Ga0501082_0698007 3300060353 Unclassified 888

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005367 Ga0070667_100329942 Ga0070667_1003299422 168
2 3300009094 Ga0111539_10289846 Ga0111539_102898462 173
3 3300050491 nmdc:mga00v17_238097_c1 nmdc:mga00v17_238097_c1_15_560 177
4 3300050510 nmdc:mga06r32_247013_c1 nmdc:mga06r32_247013_c1_369_959 178
5 3300026118 Ga0207675_100042471 Ga0207675_1000424714 179
6 3300025922 Ga0207646_10816916 Ga0207646_108169161 180
7 3300034957 Ga0373938_0097878 Ga0373938_0097878_79_693 182
8 3300035111 Ga0373923_0140779 Ga0373923_0140779_47_634 182
9 3300035170 Ga0373943_0002591 Ga0373943_0002591_7058_7645 182
10 3300035171 Ga0373946_0022207 Ga0373946_0022207_1442_2029 182
11 3300037068 Ga0373925_0052224 Ga0373925_0052224_315_902 182
12 3300053085 Ga0495619_0506500 Ga0495619_0506500_193_780 182
13 3300005535 Ga0070684_100766310 Ga0070684_1007663102 183
14 3300049584 Ga0501068_0421749 Ga0501068_0421749_12_638 183
15 3300031711 Ga0265314_10053004 Ga0265314_100530046 184
16 3300044712 Ga0453684_0844614 Ga0453684_0844614_286_879 184
17 3300046642 Ga0495634_0301363 Ga0495634_0301363_301_918 184
18 3300005355 Ga0070671_100194506 Ga0070671_1001945062 185
19 3300005364 Ga0070673_100278771 Ga0070673_1002787713 185
20 3300005615 Ga0070702_100962739 Ga0070702_1009627391 185
21 3300006358 Ga0068871_100272790 Ga0068871_1002727902 185
22 3300014969 Ga0157376_10070172 Ga0157376_100701722 185
23 3300005471 Ga0070698_100065853 Ga0070698_1000658535 186
24 3300006175 Ga0070712_100257141 Ga0070712_1002571413 186
25 3300025931 Ga0207644_10095511 Ga0207644_100955112 187
26 3300025960 Ga0207651_10034422 Ga0207651_100344222 187
27 3300042876 Ga0451577_0122001 Ga0451577_0122001_772_1383 187
28 3300050492 nmdc:mga0yw44_481920_c1 nmdc:mga0yw44_481920_c1_93_719 187
29 3300005578 Ga0068854_100331230 Ga0068854_1003312302 188
30 3300006844 Ga0075428_100046822 Ga0075428_1000468225 188
31 3300009553 Ga0105249_10302419 Ga0105249_103024192 188
32 3300025981 Ga0207640_10307204 Ga0207640_103072042 188
33 3300050510 nmdc:mga06r32_482350_c1 nmdc:mga06r32_482350_c1_13_630 188
34 3300035724 Ga0373933_0654095 Ga0373933_0654095_66_680 189
35 3300046454 Ga0495592_0021253 Ga0495592_0021253_3065_3679 189
36 3300046473 Ga0495582_0023804 Ga0495582_0023804_1936_2550 189
37 3300046511 Ga0495608_0002111 Ga0495608_0002111_8956_9570 189
38 3300046516 Ga0495628_0093072 Ga0495628_0093072_340_954 189
39 3300046517 Ga0495630_0002604 Ga0495630_0002604_11179_11793 189
40 3300046535 Ga0495586_0102257 Ga0495586_0102257_667_1281 189
41 3300046543 Ga0495645_0194792 Ga0495645_0194792_662_1276 189
42 3300046559 Ga0495667_0061450 Ga0495667_0061450_1581_2195 189
43 3300046680 Ga0495646_0201052 Ga0495646_0201052_74_688 189
44 3300046689 Ga0495613_0002407 Ga0495613_0002407_2881_3495 189
45 3300047471 Ga0495684_0001723 Ga0495684_0001723_7954_8568 189
46 3300053077 Ga0495601_0006437 Ga0495601_0006437_1247_1861 189
47 3300053084 Ga0495595_0395160 Ga0495595_0395160_50_664 189
48 3300053085 Ga0495619_0025294 Ga0495619_0025294_774_1388 189
49 3300013308 Ga0157375_10687629 Ga0157375_106876292 190
50 3300025944 Ga0207661_10365539 Ga0207661_103655392 190
51 3300044712 Ga0453684_0410017 Ga0453684_0410017_642_1241 190
52 3300046684 Ga0495669_0061596 Ga0495669_0061596_496_1110 190
53 3300005295 Ga0065707_10093378 Ga0065707_100933783 191
54 3300005330 Ga0070690_100070523 Ga0070690_1000705231 191
55 3300005335 Ga0070666_10114205 Ga0070666_101142051 191
56 3300005336 Ga0070680_100256851 Ga0070680_1002568512 191
57 3300005338 Ga0068868_100058000 Ga0068868_1000580002 191
58 3300005339 Ga0070660_100428305 Ga0070660_1004283052 191
59 3300005341 Ga0070691_10145834 Ga0070691_101458341 191
60 3300005354 Ga0070675_100207349 Ga0070675_1002073492 191
61 3300005355 Ga0070671_100083790 Ga0070671_1000837902 191
62 3300005364 Ga0070673_100002350 Ga0070673_1000023503 191
63 3300005364 Ga0070673_100003194 Ga0070673_1000031944 191
64 3300005365 Ga0070688_100362566 Ga0070688_1003625662 191
65 3300005366 Ga0070659_100144490 Ga0070659_1001444903 191
66 3300005367 Ga0070667_100029452 Ga0070667_1000294523 191
67 3300005438 Ga0070701_10014973 Ga0070701_100149734 191
68 3300005441 Ga0070700_100032267 Ga0070700_1000322673 191
69 3300005444 Ga0070694_100023260 Ga0070694_1000232603 191
70 3300005459 Ga0068867_100047915 Ga0068867_1000479154 191
71 3300005543 Ga0070672_100025241 Ga0070672_1000252411 191
72 3300005544 Ga0070686_100015135 Ga0070686_1000151353 191
73 3300005545 Ga0070695_100074202 Ga0070695_1000742022 191
74 3300005549 Ga0070704_100101207 Ga0070704_1001012073 191
75 3300005615 Ga0070702_100064246 Ga0070702_1000642461 191
76 3300005616 Ga0068852_100587067 Ga0068852_1005870672 191
77 3300005617 Ga0068859_100543553 Ga0068859_1005435532 191
78 3300005719 Ga0068861_100413588 Ga0068861_1004135881 191
79 3300005834 Ga0068851_10058382 Ga0068851_100583823 191
80 3300005840 Ga0068870_10060028 Ga0068870_100600284 191
81 3300005841 Ga0068863_100716181 Ga0068863_1007161811 191
82 3300005842 Ga0068858_100034730 Ga0068858_1000347305 191
83 3300005843 Ga0068860_100210400 Ga0068860_1002104002 191
84 3300006237 Ga0097621_100295314 Ga0097621_1002953142 191
85 3300006852 Ga0075433_10098870 Ga0075433_100988702 191
86 3300006871 Ga0075434_100042664 Ga0075434_1000426643 191
87 3300006881 Ga0068865_100083062 Ga0068865_1000830621 191
88 3300006931 Ga0097620_100543588 Ga0097620_1005435882 191
89 3300007076 Ga0075435_100044135 Ga0075435_1000441354 191
90 3300009098 Ga0105245_10138420 Ga0105245_101384203 191
91 3300009148 Ga0105243_10331556 Ga0105243_103315562 191
92 3300009176 Ga0105242_10024569 Ga0105242_100245693 191
93 3300009177 Ga0105248_10111799 Ga0105248_101117995 191
94 3300010375 Ga0105239_10251002 Ga0105239_102510021 191
95 3300013297 Ga0157378_10606031 Ga0157378_106060311 191
96 3300014326 Ga0157380_10184994 Ga0157380_101849941 191
97 3300025901 Ga0207688_10296702 Ga0207688_102967021 191
98 3300025907 Ga0207645_10023638 Ga0207645_100236381 191
99 3300025918 Ga0207662_10004113 Ga0207662_100041133 191
100 3300025922 Ga0207646_10481074 Ga0207646_104810742 191
101 3300025927 Ga0207687_10556676 Ga0207687_105566761 191
102 3300025931 Ga0207644_10478315 Ga0207644_104783152 191
103 3300025933 Ga0207706_10100647 Ga0207706_101006473 191
104 3300025936 Ga0207670_10400408 Ga0207670_104004082 191
105 3300025937 Ga0207669_10286192 Ga0207669_102861922 191
106 3300025938 Ga0207704_10796093 Ga0207704_107960931 191
107 3300025940 Ga0207691_10033741 Ga0207691_100337412 191
108 3300025941 Ga0207711_10012597 Ga0207711_100125973 191
109 3300025942 Ga0207689_10107800 Ga0207689_101078003 191
110 3300025960 Ga0207651_10022038 Ga0207651_100220384 191
111 3300025960 Ga0207651_10076918 Ga0207651_100769182 191
112 3300025981 Ga0207640_10162430 Ga0207640_101624302 191
113 3300025986 Ga0207658_10070193 Ga0207658_100701933 191
114 3300026075 Ga0207708_10023723 Ga0207708_100237232 191
115 3300026088 Ga0207641_10621283 Ga0207641_106212832 191
116 3300026089 Ga0207648_10015628 Ga0207648_100156286 191
117 3300026121 Ga0207683_10073104 Ga0207683_100731041 191
118 3300026142 Ga0207698_10038766 Ga0207698_100387665 191
119 3300028380 Ga0268265_10406289 Ga0268265_104062891 191
120 3300028381 Ga0268264_10455575 Ga0268264_104555752 191
121 3300048909 Ga0496106_0662493 Ga0496106_0662493_76_693 191
122 3300048915 Ga0496112_0643055 Ga0496112_0643055_190_807 191
123 3300050507 nmdc:mga05p37_156172_c1 nmdc:mga05p37_156172_c1_56_670 191
124 3300050512 nmdc:mga0n895_81701_c1 nmdc:mga0n895_81701_c1_801_1418 191
125 3300050513 nmdc:mga0rr50_4789_c1 nmdc:mga0rr50_4789_c1_535_1152 191
126 3300050514 nmdc:mga08x19_371614_c1 nmdc:mga08x19_371614_c1_184_801 191
127 3300050515 nmdc:mga0a205_25013_c1 nmdc:mga0a205_25013_c1_704_1318 191
128 3300005468 Ga0070707_100187765 Ga0070707_1001877652 192
129 3300005615 Ga0070702_100536405 Ga0070702_1005364052 192
130 3300006358 Ga0068871_100001669 Ga0068871_1000016698 192
131 3300006358 Ga0068871_100079140 Ga0068871_1000791404 192
132 3300006844 Ga0075428_100654558 Ga0075428_1006545582 192
133 3300006871 Ga0075434_100024356 Ga0075434_1000243566 192
134 3300006914 Ga0075436_100140998 Ga0075436_1001409982 192
135 3300009094 Ga0111539_10112936 Ga0111539_101129362 192
136 3300009147 Ga0114129_10055836 Ga0114129_100558362 192
137 3300025922 Ga0207646_10155565 Ga0207646_101555652 192
138 3300027907 Ga0207428_10081708 Ga0207428_100817082 192
139 3300028381 Ga0268264_10156443 Ga0268264_101564432 192
140 3300031995 Ga0307409_100237840 Ga0307409_1002378403 192
141 3300042435 Ga0439434_0150678 Ga0439434_0150678_120_740 192
142 3300050511 nmdc:mga08y16_36974_c1 nmdc:mga08y16_36974_c1_163_771 192
143 3300050514 nmdc:mga08x19_434997_c1 nmdc:mga08x19_434997_c1_143_757 192
144 3300005328 Ga0070676_10011026 Ga0070676_100110267 193
145 3300005330 Ga0070690_100074175 Ga0070690_1000741752 193
146 3300005335 Ga0070666_10110621 Ga0070666_101106211 193
147 3300005338 Ga0068868_100224441 Ga0068868_1002244412 193
148 3300005459 Ga0068867_100011810 Ga0068867_1000118106 193
149 3300005544 Ga0070686_100489346 Ga0070686_1004893462 193
150 3300005548 Ga0070665_100004823 Ga0070665_10000482313 193
151 3300006237 Ga0097621_100155364 Ga0097621_1001553641 193
152 3300006358 Ga0068871_100047786 Ga0068871_1000477862 193
153 3300009098 Ga0105245_10004290 Ga0105245_1000429012 193
154 3300009176 Ga0105242_10003580 Ga0105242_100035802 193
155 3300009176 Ga0105242_10050949 Ga0105242_100509493 193
156 3300009177 Ga0105248_10140449 Ga0105248_101404495 193
157 3300009177 Ga0105248_10157447 Ga0105248_101574472 193
158 3300009551 Ga0105238_10099538 Ga0105238_100995383 193
159 3300013308 Ga0157375_10109291 Ga0157375_101092912 193
160 3300014968 Ga0157379_10368626 Ga0157379_103686262 193
161 3300025934 Ga0207686_10027408 Ga0207686_100274084 193
162 3300025941 Ga0207711_10403470 Ga0207711_104034701 193
163 3300026023 Ga0207677_10038081 Ga0207677_100380812 193
164 3300026089 Ga0207648_10022226 Ga0207648_100222267 193
165 3300026121 Ga0207683_10058983 Ga0207683_100589836 193
166 3300028379 Ga0268266_10011689 Ga0268266_100116897 193
167 3300028379 Ga0268266_10377232 Ga0268266_103772322 193
168 3300031731 Ga0307405_10535689 Ga0307405_105356891 193
169 3300032002 Ga0307416_101421595 Ga0307416_1014215952 193
170 3300042156 Ga0439446_0006742 Ga0439446_0006742_53_673 193
171 3300048907 Ga0496104_0598413 Ga0496104_0598413_255_878 193
172 3300048907 Ga0496104_0657678 Ga0496104_0657678_318_941 193
173 3300048917 Ga0496114_0893855 Ga0496114_0893855_103_726 193
174 3300049568 Ga0501031_0132836 Ga0501031_0132836_268_888 193
175 3300049574 Ga0501038_0480263 Ga0501038_0480263_99_719 193
176 3300049575 Ga0501039_0067015 Ga0501039_0067015_515_1135 193
177 3300005331 Ga0070670_100152163 Ga0070670_1001521633 194
178 3300005344 Ga0070661_100247434 Ga0070661_1002474341 194
179 3300005456 Ga0070678_100028638 Ga0070678_1000286383 194
180 3300005548 Ga0070665_100805425 Ga0070665_1008054251 194
181 3300005617 Ga0068859_100221327 Ga0068859_1002213273 194
182 3300005719 Ga0068861_100159705 Ga0068861_1001597052 194
183 3300005719 Ga0068861_100824190 Ga0068861_1008241901 194
184 3300006051 Ga0075364_10227076 Ga0075364_102270762 194
185 3300006051 Ga0075364_10308095 Ga0075364_103080951 194
186 3300006178 Ga0075367_10025046 Ga0075367_100250461 194
187 3300006178 Ga0075367_10047877 Ga0075367_100478773 194
188 3300006178 Ga0075367_10132948 Ga0075367_101329482 194
189 3300006195 Ga0075366_10011131 Ga0075366_100111312 194
190 3300006195 Ga0075366_10012114 Ga0075366_100121142 194
191 3300006353 Ga0075370_10091563 Ga0075370_100915632 194
192 3300006931 Ga0097620_100221330 Ga0097620_1002213303 194
193 3300006931 Ga0097620_101046152 Ga0097620_1010461521 194
194 3300013308 Ga0157375_10786662 Ga0157375_107866621 194
195 3300014969 Ga0157376_10471511 Ga0157376_104715111 194
196 3300025920 Ga0207649_10144102 Ga0207649_101441023 194
197 3300025942 Ga0207689_10545069 Ga0207689_105450692 194
198 3300025972 Ga0207668_11156134 Ga0207668_111561341 194
199 3300026067 Ga0207678_10084679 Ga0207678_100846793 194
200 3300026118 Ga0207675_100840753 Ga0207675_1008407531 194
201 3300026121 Ga0207683_10082687 Ga0207683_100826873 194
202 3300027866 Ga0209813_10085993 Ga0209813_100859932 194
203 3300037068 Ga0373925_0128544 Ga0373925_0128544_835_1446 194
204 3300046475 Ga0495639_0006781 Ga0495639_0006781_2130_2741 194
205 3300046535 Ga0495586_0012406 Ga0495586_0012406_3085_3696 194
206 3300047321 Ga0495676_0108667 Ga0495676_0108667_1218_1829 194
207 3300050491 nmdc:mga00v17_73116_c1 nmdc:mga00v17_73116_c1_438_1064 194
208 3300050493 nmdc:mga0k408_17693_c1 nmdc:mga0k408_17693_c1_290_910 194
209 3300050494 nmdc:mga06z11_150463_c1 nmdc:mga06z11_150463_c1_382_1002 194
210 3300050494 nmdc:mga06z11_246826_c1 nmdc:mga06z11_246826_c1_402_1022 194
211 3300050496 nmdc:mga07m45_66218_c1 nmdc:mga07m45_66218_c1_566_1186 194
212 3300005365 Ga0070688_100027779 Ga0070688_1000277793 195
213 3300005365 Ga0070688_100030420 Ga0070688_1000304202 195
214 3300006871 Ga0075434_100249885 Ga0075434_1002498852 195
215 3300006880 Ga0075429_100067497 Ga0075429_1000674972 195
216 3300014325 Ga0163163_10130094 Ga0163163_101300943 195
217 3300032004 Ga0307414_10740340 Ga0307414_107403401 195
218 3300049569 Ga0501032_0017048 Ga0501032_0017048_391_1011 195
219 3300049581 Ga0501047_0430138 Ga0501047_0430138_217_837 195
220 3300050507 nmdc:mga05p37_312238_c1 nmdc:mga05p37_312238_c1_566_1189 195
221 3300050508 nmdc:mga09592_69668_c1 nmdc:mga09592_69668_c1_819_1445 195
222 3300050512 nmdc:mga0n895_113863_c1 nmdc:mga0n895_113863_c1_110_730 195
223 3300005471 Ga0070698_100570986 Ga0070698_1005709862 196
224 3300006048 Ga0075363_100081373 Ga0075363_1000813732 196
225 3300006844 Ga0075428_100018009 Ga0075428_1000180095 196
226 3300006847 Ga0075431_100841576 Ga0075431_1008415762 196
227 3300009094 Ga0111539_10049698 Ga0111539_100496982 196
228 3300009147 Ga0114129_10048638 Ga0114129_100486385 196
229 3300048917 Ga0496114_0080771 Ga0496114_0080771_1339_2037 196
230 3300050511 nmdc:mga08y16_64146_c1 nmdc:mga08y16_64146_c1_194_823 196
231 3300060353 Ga0501082_0698007 Ga0501082_0698007_170_805 196
232 3300031548 Ga0307408_100771582 Ga0307408_1007715821 199
233 2162886011 MRS1b_contig_6667382 MRS1b_0727.00000700 201
234 2162886012 MBSR1b_contig_2196287 MBSR1b_0051.00006290 201
235 3300001976 JGI24752J21851_1000709 JGI24752J21851_10007093 201
236 3300001990 JGI24737J22298_10031290 JGI24737J22298_100312903 201
237 3300001991 JGI24743J22301_10005537 JGI24743J22301_100055373 201
238 3300002459 JGI24751J29686_10064038 JGI24751J29686_100640381 201
239 3300005290 Ga0065712_10107819 Ga0065712_101078191 201
240 3300005293 Ga0065715_10116040 Ga0065715_101160402 201
241 3300005328 Ga0070676_10039091 Ga0070676_100390913 201
242 3300005329 Ga0070683_100000704 Ga0070683_10000070412 201
243 3300005330 Ga0070690_100010528 Ga0070690_1000105283 201
244 3300005331 Ga0070670_100008800 Ga0070670_1000088007 201
245 3300005333 Ga0070677_10026661 Ga0070677_100266613 201
246 3300005334 Ga0068869_100112293 Ga0068869_1001122933 201
247 3300005337 Ga0070682_100010330 Ga0070682_1000103303 201
248 3300005338 Ga0068868_100093741 Ga0068868_1000937413 201
249 3300005339 Ga0070660_100007072 Ga0070660_1000070725 201
250 3300005340 Ga0070689_100006365 Ga0070689_1000063656 201
251 3300005343 Ga0070687_100002702 Ga0070687_1000027026 201
252 3300005344 Ga0070661_100016366 Ga0070661_1000163664 201
253 3300005347 Ga0070668_100019796 Ga0070668_1000197963 201
254 3300005353 Ga0070669_100088606 Ga0070669_1000886063 201
255 3300005354 Ga0070675_100066873 Ga0070675_1000668733 201
256 3300005356 Ga0070674_100105237 Ga0070674_1001052371 201
257 3300005364 Ga0070673_100014720 Ga0070673_1000147205 201
258 3300005365 Ga0070688_100000576 Ga0070688_10000057617 201
259 3300005366 Ga0070659_100000527 Ga0070659_1000005273 201
260 3300005455 Ga0070663_100023193 Ga0070663_1000231933 201
261 3300005456 Ga0070678_100087515 Ga0070678_1000875151 201
262 3300005459 Ga0068867_100088697 Ga0068867_1000886971 201
263 3300005530 Ga0070679_100140810 Ga0070679_1001408103 201
264 3300005535 Ga0070684_100003207 Ga0070684_10000320710 201
265 3300005544 Ga0070686_100003422 Ga0070686_1000034224 201
266 3300005545 Ga0070695_100591326 Ga0070695_1005913262 201
267 3300005547 Ga0070693_100634669 Ga0070693_1006346691 201
268 3300005563 Ga0068855_100033465 Ga0068855_1000334653 201
269 3300005564 Ga0070664_100029173 Ga0070664_1000291733 201
270 3300005577 Ga0068857_100012765 Ga0068857_1000127655 201
271 3300005578 Ga0068854_100054570 Ga0068854_1000545702 201
272 3300005614 Ga0068856_100020436 Ga0068856_1000204363 201
273 3300005615 Ga0070702_100007041 Ga0070702_1000070414 201
274 3300005616 Ga0068852_100016986 Ga0068852_1000169863 201
275 3300005617 Ga0068859_100051071 Ga0068859_1000510713 201
276 3300005618 Ga0068864_100023048 Ga0068864_1000230483 201
277 3300005718 Ga0068866_10001573 Ga0068866_100015733 201
278 3300005719 Ga0068861_100076398 Ga0068861_1000763982 201
279 3300005834 Ga0068851_10002796 Ga0068851_100027965 201
280 3300005840 Ga0068870_10059718 Ga0068870_100597181 201
281 3300005841 Ga0068863_100037728 Ga0068863_1000377283 201
282 3300005844 Ga0068862_100010080 Ga0068862_1000100803 201
283 3300006237 Ga0097621_100053189 Ga0097621_1000531893 201
284 3300006881 Ga0068865_100078682 Ga0068865_1000786823 201
285 3300006931 Ga0097620_100051077 Ga0097620_1000510773 201
286 3300009092 Ga0105250_10009930 Ga0105250_100099303 201
287 3300009098 Ga0105245_10036187 Ga0105245_100361873 201
288 3300009176 Ga0105242_10023757 Ga0105242_100237573 201
289 3300009553 Ga0105249_10409826 Ga0105249_104098262 201
290 3300010375 Ga0105239_10015229 Ga0105239_1001522910 201
291 3300011119 Ga0105246_10008798 Ga0105246_100087983 201
292 3300013100 Ga0157373_10002204 Ga0157373_1000220415 201
293 3300013102 Ga0157371_10113506 Ga0157371_101135063 201
294 3300013297 Ga0157378_10225728 Ga0157378_102257282 201
295 3300013306 Ga0163162_10158196 Ga0163162_101581961 201
296 3300013307 Ga0157372_10203772 Ga0157372_102037721 201
297 3300014325 Ga0163163_10002687 Ga0163163_100026872 201
298 3300014745 Ga0157377_10002421 Ga0157377_100024216 201
299 3300017792 Ga0163161_10003741 Ga0163161_100037415 201
300 3300025321 Ga0207656_10018108 Ga0207656_100181083 201
301 3300025893 Ga0207682_10015763 Ga0207682_100157632 201
302 3300025900 Ga0207710_10014150 Ga0207710_100141502 201
303 3300025901 Ga0207688_10004315 Ga0207688_100043153 201
304 3300025903 Ga0207680_10025702 Ga0207680_100257023 201
305 3300025904 Ga0207647_10003722 Ga0207647_100037226 201
306 3300025907 Ga0207645_10003011 Ga0207645_100030113 201
307 3300025908 Ga0207643_10000930 Ga0207643_1000093012 201
308 3300025918 Ga0207662_10000289 Ga0207662_100002896 201
309 3300025919 Ga0207657_10001839 Ga0207657_1000183921 201
310 3300025920 Ga0207649_10002401 Ga0207649_1000240112 201
311 3300025921 Ga0207652_10507841 Ga0207652_105078412 201
312 3300025925 Ga0207650_10000150 Ga0207650_100001501 201
313 3300025926 Ga0207659_10009794 Ga0207659_100097944 201
314 3300025927 Ga0207687_10019877 Ga0207687_100198771 201
315 3300025931 Ga0207644_10157893 Ga0207644_101578933 201
316 3300025932 Ga0207690_10013258 Ga0207690_100132583 201
317 3300025933 Ga0207706_10000790 Ga0207706_1000079021 201
318 3300025934 Ga0207686_10036458 Ga0207686_100364583 201
319 3300025936 Ga0207670_10100678 Ga0207670_101006783 201
320 3300025937 Ga0207669_10068995 Ga0207669_100689953 201
321 3300025938 Ga0207704_10031954 Ga0207704_100319543 201
322 3300025940 Ga0207691_10001778 Ga0207691_1000177817 201
323 3300025941 Ga0207711_10048227 Ga0207711_100482273 201
324 3300025942 Ga0207689_10001791 Ga0207689_1000179120 201
325 3300025944 Ga0207661_10000422 Ga0207661_1000042220 201
326 3300025945 Ga0207679_10000359 Ga0207679_1000035917 201
327 3300025961 Ga0207712_10018895 Ga0207712_100188953 201
328 3300025972 Ga0207668_10097529 Ga0207668_100975292 201
329 3300025981 Ga0207640_10013195 Ga0207640_100131953 201
330 3300025986 Ga0207658_10004692 Ga0207658_100046926 201
331 3300026035 Ga0207703_10078363 Ga0207703_100783633 201
332 3300026041 Ga0207639_10109690 Ga0207639_101096903 201
333 3300026067 Ga0207678_10000498 Ga0207678_1000049815 201
334 3300026088 Ga0207641_10000147 Ga0207641_1000014794 201
335 3300026089 Ga0207648_10001035 Ga0207648_100010358 201
336 3300026095 Ga0207676_10001035 Ga0207676_100010354 201
337 3300026116 Ga0207674_10000432 Ga0207674_1000043237 201
338 3300026118 Ga0207675_100040089 Ga0207675_1000400894 201
339 3300026121 Ga0207683_10000692 Ga0207683_1000069222 201
340 3300026142 Ga0207698_10159764 Ga0207698_101597641 201
341 3300028379 Ga0268266_10020641 Ga0268266_100206414 201
342 3300028380 Ga0268265_10010314 Ga0268265_100103144 201
343 3300028381 Ga0268264_10034611 Ga0268264_100346113 201
344 3300035691 Ga0373931_0215900 Ga0373931_0215900_508_1113 201
345 3300048903 Ga0496100_0142166 Ga0496100_0142166_102_707 201
346 3300048905 Ga0496102_0071287 Ga0496102_0071287_1587_2192 201
347 3300048908 Ga0496105_0249357 Ga0496105_0249357_807_1412 201
348 3300048909 Ga0496106_0497462 Ga0496106_0497462_274_879 201
349 3300048910 Ga0496107_0140607 Ga0496107_0140607_882_1487 201
350 3300048911 Ga0496108_0000051 Ga0496108_0000051_69560_70165 201
351 3300048912 Ga0496109_0000105 Ga0496109_0000105_16890_17495 201
352 3300048913 Ga0496110_0012540 Ga0496110_0012540_6229_6834 201
353 3300048914 Ga0496111_0049851 Ga0496111_0049851_1435_2040 201
354 3300048915 Ga0496112_0005785 Ga0496112_0005785_3614_4219 201
355 3300048916 Ga0496113_0000499 Ga0496113_0000499_1792_2397 201

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

102

186

0.87

PF00034

Cytochrom_C

Cytochrome c

104

190

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
6lod-assembly1.cif.gz_E cryo-em structure of the air-oxidized photosynthetic alternative complex iii from roseiflexus castenholzii 0.8721 58 156
6loe-assembly1.cif.gz_E cryo-em structure of the dithionite-reduced photosynthetic alternative complex iii from roseiflexus castenholzii 0.869 60 156
7o38-assembly1.cif.gz_A cytochrome c kustc0562 from kuenenia stuttgartiensis 0.8673 70 152
7o38-assembly1.cif.gz_A cytochrome c kustc0562 from kuenenia stuttgartiensis 0.8378 70 152
5mxy-assembly1.cif.gz_A kustc0563 c-type cytochrome 0.8343 71 152
ID Description Score Start End Superfamily
1hzuA01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7684 57 153 1.10.760.10
2v08B00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7666 68 154 1.10.760.10
1hzuA01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7317 57 153 1.10.760.10
2v08B00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7254 68 154 1.10.760.10
2zboK00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7164 63 154 1.10.760.10
ID Description Score Start End GO Terms
AF-A0A2V6T0W2-F1-model_v4 Cytochrome c domain-containing protein 0.9394 54 153 GO:0005886
GO:0006825
GO:0009055
GO:0020037
GO:0046872
AF-A0A1F3MWB9-F1-model_v4 Cytochrome c domain-containing protein 0.9376 50 152 GO:0005506
GO:0009055
GO:0020037
AF-A0A3M1HNZ2-F1-model_v4 Cytochrome c domain-containing protein 0.9358 46 152 GO:0009055
GO:0020037
GO:0046872
AF-A0A6L8UKW8-F1-model_v4 C-type cytochrome 0.9354 50 152 GO:0005506
GO:0009055
GO:0020037
AF-A0A522FP82-F1-model_v4 Cytochrome c 0.9348 50 152 GO:0005506
GO:0009055
GO:0020037

Feature Viewer

pLDDT pTM Quality
84.94 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map