F420064

General Info

Members Datasets Scaffolds Average Seq Length
355 224 710 211

Family's Representative Sequence

Representative Sequence 3300005842|Ga0068858_100492379|Ga0068858_1004923791
Length 240
Sequence MLKIGAKYGGTAPRVAAANKVPDVTKADTEKRVAAEAAAELVESGMTVGLGTGSTVAHLLPAIARRGVGEIRCVATSIATEDQARELGIPVEEFSSLSRLDIAIDGTDEVTPDGWLIKGGGGAHLREKIVAXXADHFVVIADSSKPVDVLRGPVPLELFAFGIVSTLARLGAEVQLRDVPPSPDGGVIADYRGPIGDPAELAARLEADPGVAAHGLFPPAMVSELYIGRGEAVERPSIVS

Samples

Sample ID Description Type Environment
1 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
108 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
109 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
110 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
111 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
112 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
113 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
114 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
115 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
116 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
117 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
118 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
119 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
120 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
121 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
122 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
123 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
124 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
125 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
128 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
129 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
130 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
131 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
134 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
135 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
136 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
137 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
138 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
139 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
140 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
141 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
142 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
143 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
144 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
145 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
146 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
147 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
148 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
149 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
150 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
151 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
152 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
153 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
154 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
155 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
156 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
157 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
158 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
159 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
160 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
161 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
162 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
163 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
164 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
165 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
166 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
167 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
168 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
169 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
170 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
171 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
172 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
190 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
191 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
203 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
204 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
205 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
206 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
207 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
208 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
209 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
212 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
213 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
217 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
218 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
219 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
220 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
221 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
222 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
223 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
224 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.85
Nodule 0
Rhizoplane 13.24
Rhizosphere 85.07
Stem 0
Stem Tuber 0
Unclassified 1.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068858_100492379 3300005842 Bacteria 1184
2 JGI24746J21847_1004845 3300001977 Bacteria 2112
3 JGI24751J29686_10015220 3300002459 Bacteria 1587
4 JGI25406J46586_10006828 3300003203 Bacteria 5242
5 Ga0070683_100027936 3300005329 Bacteria 5094
6 Ga0070683_100061441 3300005329 Bacteria 3494
7 Ga0070683_100153021 3300005329 Bacteria 2187
8 Ga0070683_100324525 3300005329 Unclassified 1465
9 Ga0068869_100133121 3300005334 Bacteria 1913
10 Ga0070682_100000038 3300005337 Bacteria 145670
11 Ga0070682_100009180 3300005337 Bacteria 5591
12 Ga0068868_100002257 3300005338 Bacteria 13330
13 Ga0068868_100111932 3300005338 Bacteria 2219
14 Ga0070689_100018487 3300005340 Bacteria 5135
15 Ga0070691_10008978 3300005341 Bacteria 4573
16 Ga0070691_10084070 3300005341 Bacteria 1562
17 Ga0070668_100006226 3300005347 Bacteria 8838
18 Ga0070668_100335129 3300005347 Bacteria 1277
19 Ga0070674_100078412 3300005356 Bacteria 2354
20 Ga0070674_100161294 3300005356 Bacteria 1701
21 Ga0070673_100031221 3300005364 Bacteria 3996
22 Ga0070673_100260773 3300005364 Bacteria 1514
23 Ga0070659_100769764 3300005366 Bacteria 836
24 Ga0070667_100001965 3300005367 Bacteria 18253
25 Ga0070714_100066419 3300005435 Bacteria 3108
26 Ga0070714_100272493 3300005435 Bacteria 1570
27 Ga0070711_100001471 3300005439 Bacteria 12945
28 Ga0070663_100100187 3300005455 Bacteria 2161
29 Ga0070678_100734143 3300005456 Bacteria 892
30 Ga0070662_100000079 3300005457 Bacteria 53583
31 Ga0070681_10034976 3300005458 Bacteria 5046
32 Ga0070681_10628783 3300005458 Bacteria 988
33 Ga0068867_100000246 3300005459 Bacteria 35737
34 Ga0070706_100031318 3300005467 Bacteria 4905
35 Ga0070707_100005579 3300005468 Bacteria 11755
36 Ga0070707_100068624 3300005468 Bacteria 3413
37 Ga0070698_100124446 3300005471 Bacteria 2535
38 Ga0070679_100000077 3300005530 Bacteria 74222
39 Ga0070684_100041320 3300005535 Bacteria 3975
40 Ga0070684_100341391 3300005535 Bacteria 1377
41 Ga0070684_100615996 3300005535 Bacteria 1010
42 Ga0070697_100603457 3300005536 Bacteria 965
43 Ga0070693_100001059 3300005547 Bacteria 12294
44 Ga0070665_100000306 3300005548 Bacteria 76666
45 Ga0070665_100109845 3300005548 Bacteria 2760
46 Ga0070704_100029477 3300005549 Bacteria 3665
47 Ga0070704_100269676 3300005549 Bacteria 1406
48 Ga0068857_100738439 3300005577 Bacteria 937
49 Ga0068854_100033059 3300005578 Bacteria 3604
50 Ga0068856_100007419 3300005614 Bacteria 10697
51 Ga0068856_100042448 3300005614 Bacteria 4474
52 Ga0068852_100000050 3300005616 Bacteria 84306
53 Ga0068852_100065559 3300005616 Bacteria 3169
54 Ga0068859_100319390 3300005617 Bacteria 1647
55 Ga0068866_10001565 3300005718 Bacteria 9730
56 Ga0068863_100000039 3300005841 Bacteria 161450
57 Ga0068858_100000178 3300005842 Bacteria 67760
58 Ga0068858_100000454 3300005842 Bacteria 42918
59 Ga0068860_100387901 3300005843 Bacteria 1380
60 Ga0068862_100002610 3300005844 Bacteria 15861
61 Ga0081455_10029907 3300005937 Bacteria 4959
62 Ga0081540_1000044 3300005983 Bacteria 134269
63 Ga0081539_10002207 3300005985 Bacteria 28464
64 Ga0081539_10078224 3300005985 Bacteria 1747
65 Ga0070717_10049502 3300006028 Bacteria 3450
66 Ga0070717_10092625 3300006028 Bacteria 2553
67 Ga0075365_10001514 3300006038 Bacteria 10618
68 Ga0070716_100031807 3300006173 Bacteria 2873
69 Ga0070712_100005335 3300006175 Bacteria 7958
70 Ga0075430_100105905 3300006846 Bacteria 2347
71 Ga0075433_10000032 3300006852 Bacteria 55399
72 Ga0075433_10002113 3300006852 Bacteria 15055
73 Ga0075433_10359233 3300006852 Bacteria 1287
74 Ga0075434_100164685 3300006871 Bacteria 2237
75 Ga0075434_100426834 3300006871 Bacteria 1347
76 Ga0075436_100060747 3300006914 Bacteria 2611
77 Ga0097620_100319411 3300006931 Bacteria 1647
78 Ga0075435_100499969 3300007076 Bacteria 1051
79 Ga0111539_10169152 3300009094 Bacteria 2554
80 Ga0105245_10000049 3300009098 Bacteria 128277
81 Ga0105245_10005490 3300009098 Bacteria 11137
82 Ga0105245_10730945 3300009098 Bacteria 1025
83 Ga0114129_10025550 3300009147 Bacteria 8367
84 Ga0105241_10194556 3300009174 Bacteria 1690
85 Ga0105242_10000403 3300009176 Bacteria 34337
86 Ga0105242_10001375 3300009176 Bacteria 19173
87 Ga0105248_10216715 3300009177 Bacteria 2156
88 Ga0105238_10000014 3300009551 Bacteria 241954
89 Ga0105249_10000039 3300009553 Bacteria 196325
90 Ga0105249_10004610 3300009553 Bacteria 11902
91 Ga0157370_10084018 3300013104 Bacteria 2993
92 Ga0157374_10002637 3300013296 Bacteria 15115
93 Ga0157374_10230696 3300013296 Bacteria 1818
94 Ga0163162_10731979 3300013306 Bacteria 1109
95 Ga0157375_10028209 3300013308 Bacteria 5258
96 Ga0157375_10400553 3300013308 Bacteria 1539
97 Ga0157380_10003168 3300014326 Bacteria 11228
98 Ga0157380_10076336 3300014326 Bacteria 2727
99 Ga0157380_11452462 3300014326 Bacteria 738
100 Ga0157379_10004635 3300014968 Bacteria 11797
101 Ga0157379_10098888 3300014968 Bacteria 2619
102 Ga0157376_10825180 3300014969 Bacteria 941
103 Ga0163161_10000013 3300017792 Bacteria 258747
104 Ga0224712_10004896 3300022467 Bacteria 3668
105 Ga0207682_10000007 3300025893 Bacteria 88967
106 Ga0207642_10027165 3300025899 Bacteria 2340
107 Ga0207684_10200235 3300025910 Bacteria 1723
108 Ga0207684_10250369 3300025910 Bacteria 1528
109 Ga0207707_10017668 3300025912 Bacteria 6220
110 Ga0207693_10017878 3300025915 Bacteria 5653
111 Ga0207663_10001276 3300025916 Bacteria 11682
112 Ga0207663_10199770 3300025916 Bacteria 1441
113 Ga0207660_10191473 3300025917 Bacteria 1593
114 Ga0207652_10000138 3300025921 Bacteria 77564
115 Ga0207646_10055718 3300025922 Bacteria 3534
116 Ga0207646_10207828 3300025922 Bacteria 1768
117 Ga0207694_10000008 3300025924 Bacteria 484902
118 Ga0207687_10000012 3300025927 Bacteria 370729
119 Ga0207687_10000750 3300025927 Bacteria 21930
120 Ga0207687_10020964 3300025927 Bacteria 4339
121 Ga0207687_10489385 3300025927 Bacteria 1025
122 Ga0207664_10215027 3300025929 Bacteria 1665
123 Ga0207664_10224260 3300025929 Bacteria 1631
124 Ga0207706_10000302 3300025933 Bacteria 53541
125 Ga0207686_10000029 3300025934 Bacteria 160239
126 Ga0207686_10022829 3300025934 Bacteria 3606
127 Ga0207670_10083734 3300025936 Bacteria 2238
128 Ga0207669_10254308 3300025937 Bacteria 1310
129 Ga0207669_10375638 3300025937 Bacteria 1106
130 Ga0207704_10098787 3300025938 Bacteria 1940
131 Ga0207704_10307047 3300025938 Bacteria 1218
132 Ga0207665_10271572 3300025939 Bacteria 1259
133 Ga0207689_10121426 3300025942 Bacteria 2149
134 Ga0207651_10016005 3300025960 Bacteria 4377
135 Ga0207712_10000003 3300025961 Bacteria 615314
136 Ga0207712_10073899 3300025961 Bacteria 2460
137 Ga0207668_10207475 3300025972 Bacteria 1565
138 Ga0207668_10297064 3300025972 Bacteria 1331
139 Ga0207640_10013610 3300025981 Bacteria 4667
140 Ga0207658_10000708 3300025986 Bacteria 28881
141 Ga0207677_10000218 3300026023 Bacteria 45820
142 Ga0207703_10000381 3300026035 Bacteria 47426
143 Ga0207703_10000451 3300026035 Bacteria 43264
144 Ga0207639_10000838 3300026041 Bacteria 20868
145 Ga0207678_10050439 3300026067 Bacteria 3595
146 Ga0207708_10356354 3300026075 Bacteria 1201
147 Ga0207702_10001991 3300026078 Bacteria 19831
148 Ga0207702_10843540 3300026078 Bacteria 907
149 Ga0207641_10000065 3300026088 Bacteria 156066
150 Ga0207648_10000783 3300026089 Bacteria 35821
151 Ga0207698_10000009 3300026142 Bacteria 281300
152 Ga0207698_10044802 3300026142 Bacteria 3328
153 Ga0268266_10000023 3300028379 Bacteria 501899
154 Ga0268265_10009717 3300028380 Bacteria 6492
155 Ga0268264_10170189 3300028381 Bacteria 1969
156 Ga0268264_10470320 3300028381 Bacteria 1221
157 Ga0268264_10681549 3300028381 Bacteria 1020
158 Ga0265337_1000074 3300028556 Bacteria 46897
159 Ga0265326_10000035 3300028558 Bacteria 89561
160 Ga0265322_10000009 3300028654 Bacteria 170768
161 Ga0265336_10004340 3300028666 Bacteria 5373
162 Ga0265324_10000168 3300029957 Bacteria 50622
163 Ga0265332_10052291 3300031238 Bacteria 1754
164 Ga0265328_10002059 3300031239 Bacteria 9075
165 Ga0265320_10000024 3300031240 Bacteria 170768
166 Ga0265339_10074304 3300031249 Bacteria 1806
167 Ga0265331_10002024 3300031250 Bacteria 14060
168 Ga0265327_10000227 3300031251 Bacteria 114777
169 Ga0265316_10039086 3300031344 Bacteria 3814
170 Ga0265314_10000647 3300031711 Bacteria 42707
171 Ga0307407_10416068 3300031903 Unclassified 968
172 Ga0307416_100104471 3300032002 Bacteria 2477
173 Ga0307416_100380572 3300032002 Bacteria 1441
174 Ga0373926_0000325 3300035083 Bacteria 11896
175 Ga0373935_0006798 3300035692 Bacteria 6831
176 Ga0373933_0141553 3300035724 Bacteria 1519
177 Ga0373947_0000422 3300035725 Bacteria 24073
178 Ga0373947_0557740 3300035725 Bacteria 780
179 Ga0373937_0021125 3300036401 Bacteria 5842
180 Ga0373937_0086041 3300036401 Bacteria 2909
181 Ga0373937_0216720 3300036401 Bacteria 1802
182 Ga0451853_2634544 3300041512 Bacteria 8367
183 Ga0466972_0037627 3300044658 Bacteria 2366
184 Ga0466963_0000025 3300044694 Bacteria 51171
185 Ga0466971_0223219 3300044719 Unclassified 893
186 Ga0466960_0080008 3300044901 Bacteria 1645
187 Ga0466967_0003204 3300045976 Bacteria 10566
188 Ga0466967_0056391 3300045976 Bacteria 3464
189 Ga0466967_0117046 3300045976 Bacteria 2456
190 Ga0495592_0117988 3300046454 Bacteria 1870
191 Ga0495603_0001846 3300046455 Bacteria 12499
192 Ga0495603_0007298 3300046455 Bacteria 6644
193 Ga0495629_0052741 3300046459 Bacteria 2846
194 Ga0495629_0064004 3300046459 Bacteria 2568
195 Ga0495629_0094072 3300046459 Bacteria 2091
196 Ga0495641_0000095 3300046461 Bacteria 60441
197 Ga0495641_0175380 3300046461 Bacteria 959
198 Ga0495641_0190235 3300046461 Bacteria 920
199 Ga0495651_0080086 3300046462 Bacteria 2468
200 Ga0495651_0287563 3300046462 Bacteria 1108
201 Ga0495653_0042546 3300046463 Bacteria 3537
202 Ga0495653_0225747 3300046463 Bacteria 1256
203 Ga0495653_0379976 3300046463 Bacteria 902
204 Ga0495582_0284326 3300046473 Bacteria 950
205 Ga0495639_0114431 3300046475 Unclassified 1282
206 Ga0495662_0001723 3300046476 Bacteria 10927
207 Ga0495662_0056335 3300046476 Bacteria 1899
208 Ga0495594_0000191 3300046499 Bacteria 29900
209 Ga0495608_0013561 3300046511 Bacteria 5653
210 Ga0495608_0222072 3300046511 Bacteria 1185
211 Ga0495610_0094520 3300046512 Bacteria 1349
212 Ga0495618_0000097 3300046514 Bacteria 63474
213 Ga0495618_0056287 3300046514 Bacteria 2490
214 Ga0495620_0000158 3300046515 Bacteria 54704
215 Ga0495628_0010115 3300046516 Bacteria 8022
216 Ga0495628_0020905 3300046516 Bacteria 5391
217 Ga0495628_0063628 3300046516 Bacteria 2890
218 Ga0495628_0296847 3300046516 Bacteria 1197
219 Ga0495628_0362295 3300046516 Bacteria 1064
220 Ga0495630_0001301 3300046517 Bacteria 17211
221 Ga0495644_0001570 3300046523 Bacteria 9309
222 Ga0495652_0000003 3300046529 Bacteria 597094
223 Ga0495652_0028279 3300046529 Bacteria 4935
224 Ga0495586_0000234 3300046535 Bacteria 36813
225 Ga0495587_0008616 3300046536 Bacteria 6557
226 Ga0495587_0012904 3300046536 Bacteria 5254
227 Ga0495587_0056428 3300046536 Bacteria 2311
228 Ga0495587_0087936 3300046536 Bacteria 1798
229 Ga0495598_0017141 3300046537 Unclassified 1862
230 Ga0495645_0440454 3300046543 Bacteria 823
231 Ga0495622_0000124 3300046557 Bacteria 66518
232 Ga0495633_0089154 3300046558 Bacteria 1434
233 Ga0495667_0000053 3300046559 Bacteria 105370
234 Ga0495667_0036399 3300046559 Bacteria 3286
235 Ga0495656_0014301 3300046615 Bacteria 2973
236 Ga0495634_0000092 3300046642 Bacteria 72088
237 Ga0495625_0000095 3300046660 Bacteria 143468
238 Ga0495657_0002455 3300046675 Bacteria 15608
239 Ga0495599_0027864 3300046678 Bacteria 3539
240 Ga0495647_0000010 3300046681 Bacteria 94696
241 Ga0495613_0000092 3300046689 Bacteria 86976
242 Ga0495613_0053942 3300046689 Bacteria 2956
243 Ga0495624_0000049 3300046690 Bacteria 75485
244 Ga0495624_0029189 3300046690 Bacteria 3600
245 Ga0495624_0080631 3300046690 Bacteria 2017
246 Ga0495600_0012890 3300046809 Bacteria 5238
247 Ga0495581_0304819 3300047315 Bacteria 931
248 Ga0495604_0000038 3300047317 Bacteria 123703
249 Ga0495604_0294476 3300047317 Bacteria 1092
250 Ga0495674_0000063 3300047319 Bacteria 71737
251 Ga0495676_0003442 3300047321 Bacteria 14318
252 Ga0495676_0115708 3300047321 Bacteria 1960
253 Ga0495676_0234442 3300047321 Bacteria 1259
254 Ga0495680_0000873 3300047322 Bacteria 33510
255 Ga0495680_0009372 3300047322 Bacteria 8811
256 Ga0495680_0170687 3300047322 Bacteria 1575
257 Ga0495680_0358676 3300047322 Bacteria 1014
258 Ga0495614_0035164 3300048089 Bacteria 2153
259 Ga0496100_0028136 3300048903 Bacteria 3464
260 Ga0496101_0001463 3300048904 Bacteria 14108
261 Ga0496102_0000132 3300048905 Bacteria 103176
262 Ga0496102_0026318 3300048905 Bacteria 5187
263 Ga0496102_0060979 3300048905 Bacteria 3451
264 Ga0496102_0117731 3300048905 Bacteria 2479
265 Ga0496102_0294873 3300048905 Bacteria 1528
266 Ga0496103_0000077 3300048906 Bacteria 112223
267 Ga0496103_0004084 3300048906 Bacteria 8868
268 Ga0496103_0177875 3300048906 Bacteria 1367
269 Ga0496104_0000002 3300048907 Bacteria 686017
270 Ga0496104_0000003 3300048907 Bacteria 669219
271 Ga0496104_0033406 3300048907 Bacteria 4792
272 Ga0496105_0000001 3300048908 Bacteria 1328178
273 Ga0496105_0000003 3300048908 Bacteria 713251
274 Ga0496105_0046142 3300048908 Bacteria 3596
275 Ga0496105_0253400 3300048908 Bacteria 1425
276 Ga0496106_0009375 3300048909 Bacteria 7235
277 Ga0496107_0003198 3300048910 Bacteria 10889
278 Ga0496108_0000002 3300048911 Bacteria 700890
279 Ga0496108_0005645 3300048911 Bacteria 10131
280 Ga0496108_0028044 3300048911 Bacteria 4657
281 Ga0496109_0000001 3300048912 Bacteria 700852
282 Ga0496109_0004849 3300048912 Bacteria 11229
283 Ga0496109_0122907 3300048912 Bacteria 2419
284 Ga0496109_0397098 3300048912 Bacteria 1303
285 Ga0496110_0005058 3300048913 Bacteria 10307
286 Ga0496110_0043258 3300048913 Bacteria 3932
287 Ga0496110_0062404 3300048913 Bacteria 3291
288 Ga0496110_0216347 3300048913 Bacteria 1742
289 Ga0496111_0002338 3300048914 Bacteria 11427
290 Ga0496111_0056033 3300048914 Bacteria 2851
291 Ga0496112_0000002 3300048915 Bacteria 782039
292 Ga0496112_0043827 3300048915 Bacteria 4381
293 Ga0496112_0206590 3300048915 Bacteria 1922
294 Ga0496113_0020761 3300048916 Bacteria 4624
295 Ga0496113_0279251 3300048916 Bacteria 1335
296 Ga0496113_0285534 3300048916 Bacteria 1320
297 Ga0496114_0003981 3300048917 Bacteria 11408
298 Ga0496114_0009648 3300048917 Bacteria 7666
299 Ga0496114_0014570 3300048917 Bacteria 6316
300 Ga0496114_0070182 3300048917 Bacteria 2942
301 Ga0496114_0187525 3300048917 Bacteria 1808
302 Ga0496114_0313993 3300048917 Bacteria 1384
303 Ga0496114_0449718 3300048917 Bacteria 1141
304 Ga0496115_0004189 3300048918 Bacteria 10425
305 Ga0496115_0204128 3300048918 Bacteria 1633
306 Ga0496119_0029259 3300048922 Bacteria 3741
307 Ga0496120_0043668 3300048923 Bacteria 2610
308 Ga0501033_0053057 3300049570 Bacteria 3003
309 Ga0501034_0100179 3300049571 Bacteria 2891
310 Ga0501036_0025000 3300049572 Bacteria 5036
311 Ga0501037_0021781 3300049573 Bacteria 4742
312 Ga0501038_0340023 3300049574 Bacteria 1171
313 Ga0501039_0023338 3300049575 Bacteria 4749
314 Ga0501042_0002245 3300049578 Bacteria 11787
315 Ga0501042_0022609 3300049578 Bacteria 4394
316 Ga0501042_0027376 3300049578 Bacteria 4009
317 Ga0501042_0159272 3300049578 Bacteria 1628
318 Ga0501043_0026811 3300049579 Bacteria 4521
319 Ga0501046_0027964 3300049580 Bacteria 4595
320 Ga0501047_0029255 3300049581 Bacteria 5313
321 Ga0501048_0057099 3300049582 Bacteria 2768
322 Ga0501067_0043065 3300049583 Bacteria 2507
323 Ga0501069_0019621 3300049585 Bacteria 3658
324 Ga0501070_0089625 3300049586 Bacteria 2545
325 Ga0501071_0143360 3300049587 Bacteria 1780
326 Ga0501071_0236572 3300049587 Bacteria 1377
327 Ga0501072_0425951 3300049588 Bacteria 1052
328 Ga0501073_0014537 3300049589 Bacteria 5718
329 Ga0501075_0000897 3300049591 Bacteria 18804
330 Ga0501080_0023100 3300049742 Bacteria 5766
331 Ga0501044_0075693 3300049823 Bacteria 3417
332 nmdc:mga05p37_330926_c1 3300050507 Bacteria 1799
333 nmdc:mga05p37_36554_c1 3300050507 Bacteria 6024
334 nmdc:mga0qj67_251513_c1 3300050509 Bacteria 1434
335 nmdc:mga06r32_3393_c1 3300050510 Bacteria 14249
336 nmdc:mga0n895_253089_c1 3300050512 Bacteria 1787
337 nmdc:mga08x19_99589_c1 3300050514 Bacteria 1927
338 nmdc:mga0a205_1629_c2 3300050515 Bacteria 15476
339 nmdc:mga0a205_1_c2 3300050515 Bacteria 266330
340 nmdc:mga0a205_278909_c1 3300050515 Bacteria 1547
341 nmdc:mga0a205_457692_c1 3300050515 Bacteria 1135
342 Ga0495601_0000296 3300053077 Bacteria 26491
343 Ga0495601_0040191 3300053077 Bacteria 2929
344 Ga0495612_0014769 3300053078 Bacteria 3134
345 Ga0495595_0000362 3300053084 Bacteria 17220
346 Ga0495595_0077722 3300053084 Bacteria 1577
347 Ga0495595_0151076 3300053084 Bacteria 1143
348 Ga0495595_0221682 3300053084 Bacteria 944
349 Ga0495619_0001321 3300053085 Bacteria 16261
350 Ga0495619_0005342 3300053085 Bacteria 8131
351 Ga0495619_0220712 3300053085 Bacteria 1313
352 Ga0500566_0017835 3300053094 Bacteria 4167
353 Ga0500614_003173 3300053123 Bacteria 3567
354 Ga0501084_0075601 3300054114 Bacteria 2822
355 Ga0501082_0211236 3300060353 Bacteria 1688
356 Ga0068858_100492379
357 JGI24746J21847_1004845
358 JGI24751J29686_10015220
359 JGI25406J46586_10006828
360 Ga0070683_100027936
361 Ga0070683_100061441
362 Ga0070683_100153021
363 Ga0070683_100324525
364 Ga0068869_100133121
365 Ga0070682_100000038
366 Ga0070682_100009180
367 Ga0068868_100002257
368 Ga0068868_100111932
369 Ga0070689_100018487
370 Ga0070691_10008978
371 Ga0070691_10084070
372 Ga0070668_100006226
373 Ga0070668_100335129
374 Ga0070674_100078412
375 Ga0070674_100161294
376 Ga0070673_100031221
377 Ga0070673_100260773
378 Ga0070659_100769764
379 Ga0070667_100001965
380 Ga0070714_100066419
381 Ga0070714_100272493
382 Ga0070711_100001471
383 Ga0070663_100100187
384 Ga0070678_100734143
385 Ga0070662_100000079
386 Ga0070681_10034976
387 Ga0070681_10628783
388 Ga0068867_100000246
389 Ga0070706_100031318
390 Ga0070707_100005579
391 Ga0070707_100068624
392 Ga0070698_100124446
393 Ga0070679_100000077
394 Ga0070684_100041320
395 Ga0070684_100341391
396 Ga0070684_100615996
397 Ga0070697_100603457
398 Ga0070693_100001059
399 Ga0070665_100000306
400 Ga0070665_100109845
401 Ga0070704_100029477
402 Ga0070704_100269676
403 Ga0068857_100738439
404 Ga0068854_100033059
405 Ga0068856_100007419
406 Ga0068856_100042448
407 Ga0068852_100000050
408 Ga0068852_100065559
409 Ga0068859_100319390
410 Ga0068866_10001565
411 Ga0068863_100000039
412 Ga0068858_100000178
413 Ga0068858_100000454
414 Ga0068860_100387901
415 Ga0068862_100002610
416 Ga0081455_10029907
417 Ga0081540_1000044
418 Ga0081539_10002207
419 Ga0081539_10078224
420 Ga0070717_10049502
421 Ga0070717_10092625
422 Ga0075365_10001514
423 Ga0070716_100031807
424 Ga0070712_100005335
425 Ga0075430_100105905
426 Ga0075433_10000032
427 Ga0075433_10002113
428 Ga0075433_10359233
429 Ga0075434_100164685
430 Ga0075434_100426834
431 Ga0075436_100060747
432 Ga0097620_100319411
433 Ga0075435_100499969
434 Ga0111539_10169152
435 Ga0105245_10000049
436 Ga0105245_10005490
437 Ga0105245_10730945
438 Ga0114129_10025550
439 Ga0105241_10194556
440 Ga0105242_10000403
441 Ga0105242_10001375
442 Ga0105248_10216715
443 Ga0105238_10000014
444 Ga0105249_10000039
445 Ga0105249_10004610
446 Ga0157370_10084018
447 Ga0157374_10002637
448 Ga0157374_10230696
449 Ga0163162_10731979
450 Ga0157375_10028209
451 Ga0157375_10400553
452 Ga0157380_10003168
453 Ga0157380_10076336
454 Ga0157380_11452462
455 Ga0157379_10004635
456 Ga0157379_10098888
457 Ga0157376_10825180
458 Ga0163161_10000013
459 Ga0224712_10004896
460 Ga0207682_10000007
461 Ga0207642_10027165
462 Ga0207684_10200235
463 Ga0207684_10250369
464 Ga0207707_10017668
465 Ga0207693_10017878
466 Ga0207663_10001276
467 Ga0207663_10199770
468 Ga0207660_10191473
469 Ga0207652_10000138
470 Ga0207646_10055718
471 Ga0207646_10207828
472 Ga0207694_10000008
473 Ga0207687_10000012
474 Ga0207687_10000750
475 Ga0207687_10020964
476 Ga0207687_10489385
477 Ga0207664_10215027
478 Ga0207664_10224260
479 Ga0207706_10000302
480 Ga0207686_10000029
481 Ga0207686_10022829
482 Ga0207670_10083734
483 Ga0207669_10254308
484 Ga0207669_10375638
485 Ga0207704_10098787
486 Ga0207704_10307047
487 Ga0207665_10271572
488 Ga0207689_10121426
489 Ga0207651_10016005
490 Ga0207712_10000003
491 Ga0207712_10073899
492 Ga0207668_10207475
493 Ga0207668_10297064
494 Ga0207640_10013610
495 Ga0207658_10000708
496 Ga0207677_10000218
497 Ga0207703_10000381
498 Ga0207703_10000451
499 Ga0207639_10000838
500 Ga0207678_10050439
501 Ga0207708_10356354
502 Ga0207702_10001991
503 Ga0207702_10843540
504 Ga0207641_10000065
505 Ga0207648_10000783
506 Ga0207698_10000009
507 Ga0207698_10044802
508 Ga0268266_10000023
509 Ga0268265_10009717
510 Ga0268264_10170189
511 Ga0268264_10470320
512 Ga0268264_10681549
513 Ga0265337_1000074
514 Ga0265326_10000035
515 Ga0265322_10000009
516 Ga0265336_10004340
517 Ga0265324_10000168
518 Ga0265332_10052291
519 Ga0265328_10002059
520 Ga0265320_10000024
521 Ga0265339_10074304
522 Ga0265331_10002024
523 Ga0265327_10000227
524 Ga0265316_10039086
525 Ga0265314_10000647
526 Ga0307407_10416068
527 Ga0307416_100104471
528 Ga0307416_100380572
529 Ga0373926_0000325
530 Ga0373935_0006798
531 Ga0373933_0141553
532 Ga0373947_0000422
533 Ga0373947_0557740
534 Ga0373937_0021125
535 Ga0373937_0086041
536 Ga0373937_0216720
537 Ga0451853_2634544
538 Ga0466972_0037627
539 Ga0466963_0000025
540 Ga0466971_0223219
541 Ga0466960_0080008
542 Ga0466967_0003204
543 Ga0466967_0056391
544 Ga0466967_0117046
545 Ga0495592_0117988
546 Ga0495603_0001846
547 Ga0495603_0007298
548 Ga0495629_0052741
549 Ga0495629_0064004
550 Ga0495629_0094072
551 Ga0495641_0000095
552 Ga0495641_0175380
553 Ga0495641_0190235
554 Ga0495651_0080086
555 Ga0495651_0287563
556 Ga0495653_0042546
557 Ga0495653_0225747
558 Ga0495653_0379976
559 Ga0495582_0284326
560 Ga0495639_0114431
561 Ga0495662_0001723
562 Ga0495662_0056335
563 Ga0495594_0000191
564 Ga0495608_0013561
565 Ga0495608_0222072
566 Ga0495610_0094520
567 Ga0495618_0000097
568 Ga0495618_0056287
569 Ga0495620_0000158
570 Ga0495628_0010115
571 Ga0495628_0020905
572 Ga0495628_0063628
573 Ga0495628_0296847
574 Ga0495628_0362295
575 Ga0495630_0001301
576 Ga0495644_0001570
577 Ga0495652_0000003
578 Ga0495652_0028279
579 Ga0495586_0000234
580 Ga0495587_0008616
581 Ga0495587_0012904
582 Ga0495587_0056428
583 Ga0495587_0087936
584 Ga0495598_0017141
585 Ga0495645_0440454
586 Ga0495622_0000124
587 Ga0495633_0089154
588 Ga0495667_0000053
589 Ga0495667_0036399
590 Ga0495656_0014301
591 Ga0495634_0000092
592 Ga0495625_0000095
593 Ga0495657_0002455
594 Ga0495599_0027864
595 Ga0495647_0000010
596 Ga0495613_0000092
597 Ga0495613_0053942
598 Ga0495624_0000049
599 Ga0495624_0029189
600 Ga0495624_0080631
601 Ga0495600_0012890
602 Ga0495581_0304819
603 Ga0495604_0000038
604 Ga0495604_0294476
605 Ga0495674_0000063
606 Ga0495676_0003442
607 Ga0495676_0115708
608 Ga0495676_0234442
609 Ga0495680_0000873
610 Ga0495680_0009372
611 Ga0495680_0170687
612 Ga0495680_0358676
613 Ga0495614_0035164
614 Ga0496100_0028136
615 Ga0496101_0001463
616 Ga0496102_0000132
617 Ga0496102_0026318
618 Ga0496102_0060979
619 Ga0496102_0117731
620 Ga0496102_0294873
621 Ga0496103_0000077
622 Ga0496103_0004084
623 Ga0496103_0177875
624 Ga0496104_0000002
625 Ga0496104_0000003
626 Ga0496104_0033406
627 Ga0496105_0000001
628 Ga0496105_0000003
629 Ga0496105_0046142
630 Ga0496105_0253400
631 Ga0496106_0009375
632 Ga0496107_0003198
633 Ga0496108_0000002
634 Ga0496108_0005645
635 Ga0496108_0028044
636 Ga0496109_0000001
637 Ga0496109_0004849
638 Ga0496109_0122907
639 Ga0496109_0397098
640 Ga0496110_0005058
641 Ga0496110_0043258
642 Ga0496110_0062404
643 Ga0496110_0216347
644 Ga0496111_0002338
645 Ga0496111_0056033
646 Ga0496112_0000002
647 Ga0496112_0043827
648 Ga0496112_0206590
649 Ga0496113_0020761
650 Ga0496113_0279251
651 Ga0496113_0285534
652 Ga0496114_0003981
653 Ga0496114_0009648
654 Ga0496114_0014570
655 Ga0496114_0070182
656 Ga0496114_0187525
657 Ga0496114_0313993
658 Ga0496114_0449718
659 Ga0496115_0004189
660 Ga0496115_0204128
661 Ga0496119_0029259
662 Ga0496120_0043668
663 Ga0501033_0053057
664 Ga0501034_0100179
665 Ga0501036_0025000
666 Ga0501037_0021781
667 Ga0501038_0340023
668 Ga0501039_0023338
669 Ga0501042_0002245
670 Ga0501042_0022609
671 Ga0501042_0027376
672 Ga0501042_0159272
673 Ga0501043_0026811
674 Ga0501046_0027964
675 Ga0501047_0029255
676 Ga0501048_0057099
677 Ga0501067_0043065
678 Ga0501069_0019621
679 Ga0501070_0089625
680 Ga0501071_0143360
681 Ga0501071_0236572
682 Ga0501072_0425951
683 Ga0501073_0014537
684 Ga0501075_0000897
685 Ga0501080_0023100
686 Ga0501044_0075693
687 nmdc:mga05p37_330926_c1
688 nmdc:mga05p37_36554_c1
689 nmdc:mga0qj67_251513_c1
690 nmdc:mga06r32_3393_c1
691 nmdc:mga0n895_253089_c1
692 nmdc:mga08x19_99589_c1
693 nmdc:mga0a205_1629_c2
694 nmdc:mga0a205_1_c2
695 nmdc:mga0a205_278909_c1
696 nmdc:mga0a205_457692_c1
697 Ga0495601_0000296
698 Ga0495601_0040191
699 Ga0495612_0014769
700 Ga0495595_0000362
701 Ga0495595_0077722
702 Ga0495595_0151076
703 Ga0495595_0221682
704 Ga0495619_0001321
705 Ga0495619_0005342
706 Ga0495619_0220712
707 Ga0500566_0017835
708 Ga0500614_003173
709 Ga0501084_0075601
710 Ga0501082_0211236

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06026

Rib_5-P_isom_A

Ribose 5-phosphate isomerase A (phosphoriboisomerase A)

72

232

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5uf2-assembly1.cif.gz_A crystal structure of ribose 5 phosphate isomerase a from neisseria gonorrhoeae 0.9172 2 205
4gmk-assembly1.cif.gz_B crystal structure of ribose 5-phosphate isomerase from the probiotic bacterium lactobacillus salivarius ucc118 0.9101 5 207
7lda-assembly1.cif.gz_A crystal structure of a ribose-5-phosphate isomerase from stenotrophomonas maltophilia k279a 0.9092 4 202
1uj4-assembly1.cif.gz_A crystal structure of thermus thermophilus ribose-5-phosphate isomerase 0.9034 3 205
6zxt-assembly1.cif.gz_A high resolution crystal structure of chloroplastic ribose-5-phosphate isomerase from chlamydomonas reinhardtii 0.9032 1 207
ID Description Score Start End Superfamily
af_I1MGA3_45_173_3.40.50.1360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9233 7 86 3.40.50.1360
4m8lA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9068 3 119 3.40.50.1360
2pjmC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8978 2 119 3.40.50.1360
1xtzA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8885 5 121 3.40.50.1360
4gmkB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8746 5 201 3.40.50.1360
ID Description Score Start End GO Terms
AF-A0A519PJ72-F1-model_v4 Ribose 5-phosphate isomerase A 0.9762 2 77 GO:0016853
AF-A0A837Q1W0-F1-model_v4 deleted 0.9618 1 86
AF-A0A7K0QZ85-F1-model_v4 Ribose 5-phosphate isomerase A (EC 5.3.1.6) 0.9585 3 207 GO:0004751
GO:0005829
GO:0006014
GO:0009052
AF-A0A7W1M2V3-F1-model_v4 Ribose 5-phosphate isomerase A (EC 5.3.1.6) 0.9583 3 207 GO:0004751
GO:0005829
GO:0006014
GO:0009052
AF-A0A257RZ60-F1-model_v4 Ribose 5-phosphate isomerase A (EC 5.3.1.6) 0.9581 1 198 GO:0004751
GO:0005829
GO:0006014
GO:0009052

Map