F420071

General Info

Members Datasets Scaffolds Average Seq Length
355 257 295 284

Family's Representative Sequence

Representative Sequence 3300006048|Ga0075363_100014801|Ga0075363_1000148013
Length 313
Sequence MTTDSIPVQATDARPKTARKTSKAAPSGARRRQLFRHPGAGRQHHAGPVAYILLGLAALVSLFPLYWTMVAASTDNTRVTQTPPPFLPGPHLLENLGKAWQDAALGKAMLNSLIVAGAIALSTVLFATLAGFAFAKLRFKGRNILLMLVIGTMMVPPQLGVVPLFMMMTELGWGQKLPAVIFPTLVSAVGVFFMRQYLSEALPDELVEAGRVDGAHSLRIFWSIVLPIARPPMAVLFMITFVHAWNDFFWPFIVLDMTNPTVPVALTQLSAGYVRDQSLIMAGALLGTLPLLALFVVFGRQIVGGIMQGAVKG

Samples

Sample ID Description Type Environment
1 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
2 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
3 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
4 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
5 2643221575 Microbacterium sp. Root61 Isolate Unclassified
6 2671180694 Paenibacillus sp. A3 Isolate Unclassified
7 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
8 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
9 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
10 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
11 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
12 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
13 2808606448 Streptomyces sp. 193411 Isolate Unclassified
14 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
15 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
16 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
17 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
18 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
19 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
20 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
21 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
22 2867428634 Streptomyces sp. RP5T Isolate Unclassified
23 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
24 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
25 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
26 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
27 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
28 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
29 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
30 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
31 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
32 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
33 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
34 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
35 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
36 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
37 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
38 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
39 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
40 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
41 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
42 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
43 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
44 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
45 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
46 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
47 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
48 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
49 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
51 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
52 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
53 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
54 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
55 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
56 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
57 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
58 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
59 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
60 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
61 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
62 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
63 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
64 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
65 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
66 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
67 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
112 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
113 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
114 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
115 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
116 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
117 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
118 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
119 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
120 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
125 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
126 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
127 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
128 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
129 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
130 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
131 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
132 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
133 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
134 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
135 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
136 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
137 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
138 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
139 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
140 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
141 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
142 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
143 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
144 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
145 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
146 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
147 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
148 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
149 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
152 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
153 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
154 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
155 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
156 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
157 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
158 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
159 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
160 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
161 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
162 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
163 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
164 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
165 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
166 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
167 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
168 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
169 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
170 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
171 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
172 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
173 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
174 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
175 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
176 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
177 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
178 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
179 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
180 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
181 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
182 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
183 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
184 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
185 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
186 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
187 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
188 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
189 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
190 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
191 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
204 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
205 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
206 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
207 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
208 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
209 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
210 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
224 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
225 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
226 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
227 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
228 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
229 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
230 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
231 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
232 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
233 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
236 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
237 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
238 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
239 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
240 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
241 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
242 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
243 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
244 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
245 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
246 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
247 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
249 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
250 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
251 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
252 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
253 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
254 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
255 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
256 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
257 8054795415 Paenibacillus periandrae PM10 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 82.54
Metatranscriptomes 0.56
Isolates 16.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.54
Nodule 0.56
Rhizoplane 5.92
Rhizosphere 78.87
Stem 0
Stem Tuber 0
Unclassified 12.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10032268 3300002067 Bacteria 1551
2 JGI25406J46586_10000703 3300003203 Bacteria 15622
3 rootH2_10051798 3300003320 Bacteria 4275
4 rootH1_10031393 3300003323 Bacteria 1607
5 Ga0055541_1001239 3300003841 Bacteria 5634
6 Ga0065715_10114750 3300005293 Bacteria 2439
7 Ga0065707_10094032 3300005295 Bacteria 3547
8 Ga0070658_10358769 3300005327 Bacteria 1248
9 Ga0070683_100004739 3300005329 Bacteria 11254
10 Ga0070683_100669481 3300005329 Bacteria 994
11 Ga0070680_100174281 3300005336 Bacteria 1811
12 Ga0070682_100353173 3300005337 Bacteria 1097
13 Ga0070668_100278524 3300005347 Bacteria 1396
14 Ga0070674_100146277 3300005356 Bacteria 1779
15 Ga0070714_100008946 3300005435 Bacteria 7837
16 Ga0070713_100025319 3300005436 Bacteria 4638
17 Ga0070678_100378619 3300005456 Bacteria 1224
18 Ga0070681_10541155 3300005458 Bacteria 1078
19 Ga0068867_100392151 3300005459 Bacteria 1169
20 Ga0070679_100427275 3300005530 Bacteria 1270
21 Ga0070684_100659426 3300005535 Bacteria 974
22 Ga0068853_100036638 3300005539 Bacteria 4173
23 Ga0070665_100018383 3300005548 Bacteria 7005
24 Ga0070665_100023797 3300005548 Bacteria 6170
25 Ga0068855_100005701 3300005563 Bacteria 15212
26 Ga0068856_100048495 3300005614 Bacteria 4186
27 Ga0068852_100007612 3300005616 Bacteria 7920
28 Ga0068852_100969124 3300005616 Bacteria 869
29 Ga0068870_10106456 3300005840 Bacteria 1594
30 Ga0068863_100009355 3300005841 Bacteria 9562
31 Ga0081539_10000286 3300005985 Bacteria 114239
32 Ga0070717_10000727 3300006028 Bacteria 21428
33 Ga0075363_100014801 3300006048 Bacteria 3822
34 Ga0075428_100007485 3300006844 Bacteria 12101
35 Ga0075431_100018048 3300006847 Bacteria 7177
36 Ga0075429_100070992 3300006880 Bacteria 3032
37 Ga0105244_10060088 3300009036 Bacteria 1915
38 Ga0105240_10013170 3300009093 Bacteria 11377
39 Ga0111539_10000093 3300009094 Bacteria 94060
40 Ga0105243_10541305 3300009148 Bacteria 1111
41 Ga0105241_10002382 3300009174 Bacteria 14113
42 Ga0105248_10094891 3300009177 Bacteria 3358
43 Ga0105237_10113366 3300009545 Bacteria 2704
44 Ga0105238_10022662 3300009551 Bacteria 6400
45 Ga0105239_10034741 3300010375 Bacteria 5538
46 Ga0105239_10822873 3300010375 Bacteria 1064
47 Ga0157369_10061530 3300013105 Bacteria 4047
48 Ga0157374_10018252 3300013296 Bacteria 6189
49 Ga0157374_10331614 3300013296 Bacteria 1509
50 Ga0163162_10301278 3300013306 Bacteria 1735
51 Ga0157372_10479911 3300013307 Bacteria 1449
52 Ga0157372_10560764 3300013307 Bacteria 1331
53 Ga0206353_11717966 3300020082 Bacteria 1930
54 Ga0209566_100046 3300025225 Bacteria 247053
55 Ga0209437_100483 3300025233 Bacteria 30009
56 Ga0207654_10002767 3300025911 Bacteria 8907
57 Ga0207695_10003124 3300025913 Bacteria 23688
58 Ga0207671_10000170 3300025914 Bacteria 99729
59 Ga0207652_10339654 3300025921 Bacteria 1356
60 Ga0207694_10003270 3300025924 Bacteria 12912
61 Ga0207664_10007595 3300025929 Bacteria 7522
62 Ga0207670_10056902 3300025936 Bacteria 2650
63 Ga0207661_10052412 3300025944 Bacteria 3260
64 Ga0207667_10021927 3300025949 Bacteria 7070
65 Ga0207639_10005566 3300026041 Bacteria 8519
66 Ga0207702_10075674 3300026078 Bacteria 2909
67 Ga0207698_10007361 3300026142 Bacteria 6897
68 Ga0207428_10000147 3300027907 Bacteria 95314
69 Ga0268266_10041714 3300028379 Bacteria 3917
70 Ga0307517_10009904 3300028786 Bacteria 13423
71 Ga0307515_10210359 3300028794 Bacteria 1791
72 Ga0307512_10005602 3300030522 Bacteria 13026
73 Ga0307513_10005762 3300031456 Bacteria 16293
74 Ga0307513_10084610 3300031456 Bacteria 3257
75 Ga0307513_10152774 3300031456 Bacteria 2214
76 Ga0307514_10001390 3300031649 Bacteria 30145
77 Ga0307405_10222734 3300031731 Bacteria 1385
78 Ga0307413_10003628 3300031824 Bacteria 6548
79 Ga0307409_100198221 3300031995 Bacteria 1794
80 Ga0307415_100110943 3300032126 Bacteria 2035
81 Ga0395899_0292693 3300037312 Bacteria 1104
82 Ga0395900_0011199 3300037418 Bacteria 9173
83 Ga0395898_0211923 3300037466 Bacteria 1848
84 Ga0395898_0308059 3300037466 Bacteria 1511
85 Ga0395898_0617116 3300037466 Bacteria 1027
86 Ga0395901_0037302 3300038443 Bacteria 5027
87 Ga0451853_1301325 3300041512 Bacteria 7962
88 Ga0439442_002982 3300042002 Bacteria 3340
89 Ga0439448_0007801 3300042005 Bacteria 3111
90 Ga0439449_0000183 3300042007 Bacteria 21770
91 Ga0439450_027491 3300042008 Bacteria 1260
92 Ga0439457_000427 3300042014 Bacteria 12122
93 Ga0439457_002796 3300042014 Bacteria 4880
94 Ga0439457_007440 3300042014 Bacteria 2627
95 Ga0439462_0018330 3300042015 Bacteria 1818
96 Ga0450894_000879 3300042131 Bacteria 4797
97 Ga0450894_011721 3300042131 Bacteria 1142
98 Ga0450895_001067 3300042132 Bacteria 1822
99 Ga0450896_003786 3300042133 Bacteria 2028
100 Ga0450898_007744 3300042134 Bacteria 1678
101 Ga0450899_001242 3300042135 Bacteria 2889
102 Ga0450900_013898 3300042136 Bacteria 1069
103 Ga0450903_000760 3300042138 Bacteria 6322
104 Ga0450903_006326 3300042138 Bacteria 1970
105 Ga0450906_002992 3300042145 Bacteria 3667
106 Ga0450906_005896 3300042145 Bacteria 2496
107 Ga0439458_0002656 3300042157 Bacteria 4310
108 Ga0466969_0004480 3300044656 Bacteria 7438
109 Ga0466965_0018876 3300044683 Bacteria 3308
110 Ga0466966_0004131 3300044684 Bacteria 9587
111 Ga0466961_0005459 3300044693 Bacteria 8020
112 Ga0466961_0023247 3300044693 Bacteria 3988
113 Ga0466963_0100940 3300044694 Bacteria 1975
114 Ga0466971_0190820 3300044719 Bacteria 965
115 Ga0466970_0001976 3300044765 Bacteria 9917
116 Ga0466970_0041068 3300044765 Bacteria 2457
117 Ga0466957_0232303 3300044842 Bacteria 1221
118 Ga0466960_0127322 3300044901 Bacteria 1340
119 Ga0466959_0004355 3300045049 Bacteria 9469
120 Ga0466959_0048721 3300045049 Bacteria 3114
121 Ga0466967_0014947 3300045976 Bacteria 6070
122 Ga0466967_0026600 3300045976 Bacteria 4794
123 Ga0466967_0032186 3300045976 Bacteria 4425
124 Ga0466967_0047267 3300045976 Bacteria 3751
125 Ga0466967_0083570 3300045976 Bacteria 2887
126 Ga0495617_091326 3300046452 Bacteria 993
127 Ga0495592_0094596 3300046454 Bacteria 2138
128 Ga0495592_0096390 3300046454 Bacteria 2114
129 Ga0495603_0018653 3300046455 Bacteria 4197
130 Ga0495603_0207919 3300046455 Bacteria 1130
131 Ga0495638_0091145 3300046460 Bacteria 1836
132 Ga0495641_0064215 3300046461 Bacteria 1654
133 Ga0495641_0076528 3300046461 Bacteria 1500
134 Ga0495651_0000176 3300046462 Bacteria 47308
135 Ga0495651_0099742 3300046462 Bacteria 2165
136 Ga0495580_0057076 3300046472 Bacteria 2748
137 Ga0495582_0064038 3300046473 Bacteria 2030
138 Ga0495605_0040546 3300046474 Bacteria 2323
139 Ga0495594_0007586 3300046499 Bacteria 5584
140 Ga0495607_0011532 3300046501 Bacteria 5879
141 Ga0495606_0007008 3300046507 Bacteria 10229
142 Ga0495616_0026651 3300046513 Bacteria 3073
143 Ga0495620_0119119 3300046515 Bacteria 1041
144 Ga0495628_0008457 3300046516 Bacteria 8824
145 Ga0495631_0013426 3300046518 Bacteria 3976
146 Ga0495648_0023170 3300046524 Bacteria 4259
147 Ga0495652_0001006 3300046529 Bacteria 32271
148 Ga0495654_0039995 3300046530 Bacteria 2338
149 Ga0495640_0017241 3300046533 Bacteria 5385
150 Ga0495609_0047569 3300046538 Bacteria 1919
151 Ga0495645_0069422 3300046543 Bacteria 2544
152 Ga0495635_0024352 3300046663 Bacteria 4219
153 Ga0495661_0017810 3300046665 Bacteria 4682
154 Ga0495657_0122133 3300046675 Bacteria 1639
155 Ga0495658_0011719 3300046683 Bacteria 4418
156 Ga0495613_0084312 3300046689 Bacteria 2307
157 Ga0495624_0003563 3300046690 Bacteria 11529
158 Ga0495670_0059210 3300046691 Bacteria 1923
159 Ga0495600_0041688 3300046809 Bacteria 2992
160 Ga0495604_0057609 3300047317 Bacteria 2987
161 Ga0495604_0075623 3300047317 Bacteria 2535
162 Ga0495674_0387241 3300047319 Bacteria 1130
163 Ga0495672_0117572 3300047320 Bacteria 1418
164 Ga0495676_0007630 3300047321 Bacteria 9922
165 Ga0495676_0118799 3300047321 Bacteria 1927
166 Ga0495680_0040129 3300047322 Bacteria 3730
167 Ga0495675_0053517 3300047444 Bacteria 2562
168 Ga0495677_0024588 3300047445 Bacteria 2185
169 Ga0495685_037385 3300047447 Bacteria 1664
170 Ga0495686_0005810 3300047472 Bacteria 9621
171 Ga0495686_0016827 3300047472 Bacteria 4945
172 Ga0495686_0095109 3300047472 Bacteria 1804
173 Ga0495593_0084688 3300047673 Bacteria 1636
174 Ga0495626_0006240 3300048091 Bacteria 6808
175 Ga0496101_0029003 3300048904 Bacteria 3869
176 Ga0496101_0385226 3300048904 Bacteria 1103
177 Ga0496102_0157886 3300048905 Bacteria 2133
178 Ga0496102_0227477 3300048905 Bacteria 1759
179 Ga0496104_0098738 3300048907 Bacteria 2795
180 Ga0496105_0113514 3300048908 Bacteria 2235
181 Ga0496105_0161262 3300048908 Bacteria 1841
182 Ga0496105_0191145 3300048908 Bacteria 1674
183 Ga0496107_0058965 3300048910 Bacteria 2777
184 Ga0496108_0024491 3300048911 Bacteria 4970
185 Ga0496108_0487256 3300048911 Bacteria 1077
186 Ga0496109_0021616 3300048912 Bacteria 5692
187 Ga0496110_0024103 3300048913 Bacteria 5185
188 Ga0496110_0069022 3300048913 Bacteria 3129
189 Ga0496110_0114322 3300048913 Bacteria 2429
190 Ga0496111_0030478 3300048914 Bacteria 3836
191 Ga0496111_0148111 3300048914 Bacteria 1741
192 Ga0496111_0151548 3300048914 Bacteria 1720
193 Ga0496112_0508583 3300048915 Bacteria 1140
194 Ga0496114_0020294 3300048917 Bacteria 5392
195 Ga0496114_0276340 3300048917 Bacteria 1480
196 Ga0496116_0001250 3300048919 Bacteria 29519
197 Ga0496121_0141263 3300048924 Bacteria 1786
198 Ga0496122_0084344 3300048925 Bacteria 2198
199 Ga0496124_0027690 3300048927 Bacteria 5081
200 Ga0496124_0109655 3300048927 Bacteria 2224
201 Ga0496125_0006592 3300048928 Bacteria 12500
202 Ga0495678_099541 3300049459 Bacteria 1009
203 Ga0495682_0021324 3300049460 Bacteria 2428
204 Ga0501031_0004116 3300049568 Bacteria 9395
205 Ga0501032_0003847 3300049569 Bacteria 11400
206 Ga0501032_0007622 3300049569 Bacteria 7892
207 Ga0501032_0009566 3300049569 Bacteria 7028
208 Ga0501032_0248406 3300049569 Bacteria 1155
209 Ga0501033_0000784 3300049570 Bacteria 29162
210 Ga0501033_0005502 3300049570 Bacteria 10027
211 Ga0501033_0039628 3300049570 Bacteria 3519
212 Ga0501034_0002409 3300049571 Bacteria 22644
213 Ga0501034_0029852 3300049571 Bacteria 5541
214 Ga0501034_0033531 3300049571 Bacteria 5208
215 Ga0501034_0155605 3300049571 Bacteria 2260
216 Ga0501034_0158458 3300049571 Bacteria 2236
217 Ga0501036_0012153 3300049572 Bacteria 7133
218 Ga0501036_0014955 3300049572 Bacteria 6473
219 Ga0501036_0078839 3300049572 Bacteria 2786
220 Ga0501037_0000913 3300049573 Bacteria 22000
221 Ga0501037_0007103 3300049573 Bacteria 8184
222 Ga0501037_0246812 3300049573 Bacteria 1250
223 Ga0501038_0000102 3300049574 Bacteria 72409
224 Ga0501038_0007717 3300049574 Bacteria 9920
225 Ga0501038_0026125 3300049574 Bacteria 5202
226 Ga0501038_0028864 3300049574 Bacteria 4924
227 Ga0501039_0010095 3300049575 Bacteria 7193
228 Ga0501039_0019617 3300049575 Bacteria 5185
229 Ga0501039_0047580 3300049575 Bacteria 3315
230 Ga0501039_0241608 3300049575 Bacteria 1420
231 Ga0501042_0006531 3300049578 Bacteria 7577
232 Ga0501043_0005199 3300049579 Bacteria 10530
233 Ga0501043_0012423 3300049579 Bacteria 6660
234 Ga0501043_0024944 3300049579 Bacteria 4691
235 Ga0501043_0068911 3300049579 Bacteria 2778
236 Ga0501046_0001819 3300049580 Bacteria 20318
237 Ga0501046_0002795 3300049580 Bacteria 16250
238 Ga0501046_0024366 3300049580 Bacteria 4966
239 Ga0501047_0010290 3300049581 Bacteria 8846
240 Ga0501047_0015302 3300049581 Bacteria 7309
241 Ga0501047_0020417 3300049581 Bacteria 6361
242 Ga0501047_0046198 3300049581 Bacteria 4208
243 Ga0501047_0080078 3300049581 Bacteria 3140
244 Ga0501047_0086158 3300049581 Bacteria 3018
245 Ga0501047_0113662 3300049581 Bacteria 2590
246 Ga0501048_0005540 3300049582 Bacteria 9602
247 Ga0501067_0001326 3300049583 Bacteria 13400
248 Ga0501068_0007378 3300049584 Bacteria 6089
249 Ga0501068_0069511 3300049584 Bacteria 2147
250 Ga0501068_0268941 3300049584 Bacteria 1088
251 Ga0501069_0021677 3300049585 Bacteria 3490
252 Ga0501070_0004857 3300049586 Bacteria 11487
253 Ga0501070_0035518 3300049586 Bacteria 4165
254 Ga0501070_0270169 3300049586 Bacteria 1389
255 Ga0501070_0379911 3300049586 Bacteria 1144
256 Ga0501072_0002640 3300049588 Bacteria 13435
257 Ga0501072_0110317 3300049588 Bacteria 2190
258 Ga0501073_0001706 3300049589 Bacteria 16294
259 Ga0501073_0002396 3300049589 Bacteria 14029
260 Ga0501073_0003306 3300049589 Bacteria 12112
261 Ga0501073_0004066 3300049589 Bacteria 10985
262 Ga0501074_0002526 3300049590 Bacteria 12773
263 Ga0501074_0006743 3300049590 Bacteria 8284
264 Ga0501074_0391406 3300049590 Bacteria 986
265 Ga0501077_0016736 3300049593 Bacteria 4623
266 Ga0501079_0020058 3300049741 Bacteria 5107
267 Ga0501080_0003895 3300049742 Bacteria 13213
268 Ga0501080_0015799 3300049742 Bacteria 6964
269 Ga0501080_0017467 3300049742 Bacteria 6635
270 Ga0501080_0080979 3300049742 Bacteria 3017
271 Ga0501080_0127533 3300049742 Bacteria 2356
272 Ga0501035_0002549 3300049822 Bacteria 17819
273 Ga0501035_0017325 3300049822 Bacteria 6643
274 Ga0501035_0065871 3300049822 Bacteria 3215
275 Ga0501035_0181604 3300049822 Bacteria 1812
276 Ga0501035_0204146 3300049822 Bacteria 1694
277 Ga0501044_0005275 3300049823 Bacteria 14373
278 Ga0501044_0016096 3300049823 Bacteria 8039
279 Ga0501044_0034845 3300049823 Bacteria 5276
280 Ga0501044_0042732 3300049823 Bacteria 4712
281 Ga0501044_0188751 3300049823 Bacteria 2024
282 Ga0501045_0027776 3300049824 Bacteria 4080
283 nmdc:mga03n38_6528_c1 3300050490 Bacteria 4060
284 nmdc:mga09592_168030_c1 3300050508 Bacteria 1896
285 nmdc:mga06r32_1857_c1 3300050510 Bacteria 18803
286 nmdc:mga08y16_58_c1 3300050511 Bacteria 94206
287 Ga0495601_0069942 3300053077 Bacteria 2239
288 Ga0495655_0025579 3300053083 Bacteria 1382
289 Ga0500560_000647 3300053107 Bacteria 5136
290 Ga0500614_032459 3300053123 Bacteria 1285
291 Ga0500628_023946 3300053129 Bacteria 1264
292 Ga0500573_0040972 3300053140 Bacteria 2674
293 Ga0590075_011434 3300059424 Bacteria 2146
294 Ga0587067_020709 3300059640 Bacteria 1127
295 Ga0501082_0008562 3300060353 Bacteria 8823

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045976 Ga0466967_0014947 Ga0466967_0014947_857_1672 245
2 3300046499 Ga0495594_0007586 Ga0495594_0007586_537_1349 245
3 3300046452 Ga0495617_091326 Ga0495617_091326_229_978 248
4 3300005295 Ga0065707_10094032 Ga0065707_100940321 251
5 3300046461 Ga0495641_0076528 Ga0495641_0076528_140_1003 252
6 3300046683 Ga0495658_0011719 Ga0495658_0011719_2300_3163 252
7 3300046689 Ga0495613_0084312 Ga0495613_0084312_667_1530 252
8 3300047444 Ga0495675_0053517 Ga0495675_0053517_693_1526 252
9 3300053123 Ga0500614_032459 Ga0500614_032459_281_1144 252
10 3300045976 Ga0466967_0083570 Ga0466967_0083570_275_1090 254
11 3300048924 Ga0496121_0141263 Ga0496121_0141263_244_1026 254
12 3300005337 Ga0070682_100353173 Ga0070682_1003531732 257
13 3300010375 Ga0105239_10822873 Ga0105239_108228732 257
14 3300013306 Ga0163162_10301278 Ga0163162_103012782 257
15 3300028786 Ga0307517_10009904 Ga0307517_100099049 257
16 3300048904 Ga0496101_0029003 Ga0496101_0029003_1350_2183 257
17 3300048905 Ga0496102_0157886 Ga0496102_0157886_439_1272 257
18 3300048908 Ga0496105_0161262 Ga0496105_0161262_810_1643 257
19 3300048912 Ga0496109_0021616 Ga0496109_0021616_1889_2722 257
20 3300048913 Ga0496110_0114322 Ga0496110_0114322_1380_2216 257
21 3300048914 Ga0496111_0151548 Ga0496111_0151548_483_1319 257
22 3300048917 Ga0496114_0020294 Ga0496114_0020294_4419_5252 257
23 3300013307 Ga0157372_10560764 Ga0157372_105607642 258
24 3300044694 Ga0466963_0100940 Ga0466963_0100940_791_1642 258
25 3300045976 Ga0466967_0026600 Ga0466967_0026600_2731_3582 258
26 3300049585 Ga0501069_0021677 Ga0501069_0021677_651_1487 258
27 3300046473 Ga0495582_0064038 Ga0495582_0064038_527_1372 259
28 3300049586 Ga0501070_0379911 Ga0501070_0379911_216_1055 259
29 3300048919 Ga0496116_0001250 Ga0496116_0001250_6364_7149 260
30 3300048927 Ga0496124_0027690 Ga0496124_0027690_2448_3233 260
31 3300044901 Ga0466960_0127322 Ga0466960_0127322_495_1283 261
32 3300049584 Ga0501068_0069511 Ga0501068_0069511_237_1100 261
33 3300049588 Ga0501072_0002640 Ga0501072_0002640_7286_8149 261
34 3300049589 Ga0501073_0003306 Ga0501073_0003306_5826_6689 261
35 3300049590 Ga0501074_0002526 Ga0501074_0002526_6129_6992 261
36 3300049742 Ga0501080_0003895 Ga0501080_0003895_5171_6034 261
37 3300060353 Ga0501082_0008562 Ga0501082_0008562_2965_3828 261
38 3300003841 Ga0055541_1001239 Ga0055541_10012393 263
39 3300005329 Ga0070683_100004739 Ga0070683_1000047395 263
40 3300005548 Ga0070665_100018383 Ga0070665_1000183832 263
41 3300005841 Ga0068863_100009355 Ga0068863_1000093554 263
42 3300025225 Ga0209566_100046 Ga0209566_10004688 263
43 3300028379 Ga0268266_10041714 Ga0268266_100417143 263
44 3300009177 Ga0105248_10094891 Ga0105248_100948913 264
45 3300048907 Ga0496104_0098738 Ga0496104_0098738_923_1807 264
46 3300048908 Ga0496105_0191145 Ga0496105_0191145_52_936 264
47 3300049569 Ga0501032_0007622 Ga0501032_0007622_6559_7476 264
48 3300049571 Ga0501034_0033531 Ga0501034_0033531_50_967 264
49 3300049572 Ga0501036_0014955 Ga0501036_0014955_1225_2142 264
50 3300049573 Ga0501037_0007103 Ga0501037_0007103_3117_4034 264
51 3300049574 Ga0501038_0028864 Ga0501038_0028864_3879_4796 264
52 3300049575 Ga0501039_0010095 Ga0501039_0010095_1493_2410 264
53 3300049579 Ga0501043_0024944 Ga0501043_0024944_143_1060 264
54 3300049581 Ga0501047_0020417 Ga0501047_0020417_4802_5719 264
55 3300049586 Ga0501070_0035518 Ga0501070_0035518_1626_2543 264
56 3300049588 Ga0501072_0110317 Ga0501072_0110317_887_1804 264
57 3300049822 Ga0501035_0065871 Ga0501035_0065871_1882_2799 264
58 3300049823 Ga0501044_0042732 Ga0501044_0042732_1665_2582 264
59 3300049824 Ga0501045_0027776 Ga0501045_0027776_1006_1923 264
60 3300037466 Ga0395898_0211923 Ga0395898_0211923_513_1352 265
61 3300042014 Ga0439457_000427 Ga0439457_000427_7118_8035 265
62 3300044693 Ga0466961_0005459 Ga0466961_0005459_645_1535 265
63 3300050510 nmdc:mga06r32_1857_c1 nmdc:mga06r32_1857_c1_5298_6098 265
64 3300049580 Ga0501046_0002795 Ga0501046_0002795_4832_5674 266
65 3300025233 Ga0209437_100483 Ga0209437_1004836 267
66 3300045976 Ga0466967_0032186 Ga0466967_0032186_1459_2349 267
67 3300048925 Ga0496122_0084344 Ga0496122_0084344_925_1749 267
68 3300048927 Ga0496124_0109655 Ga0496124_0109655_587_1411 267
69 3300049581 Ga0501047_0113662 Ga0501047_0113662_346_1209 267
70 iso_pu_bacteria 8054280661 8054281801 267
71 3300005293 Ga0065715_10114750 Ga0065715_101147502 268
72 3300005356 Ga0070674_100146277 Ga0070674_1001462772 268
73 3300005535 Ga0070684_100659426 Ga0070684_1006594261 268
74 3300006847 Ga0075431_100018048 Ga0075431_1000180485 268
75 3300025936 Ga0207670_10056902 Ga0207670_100569023 268
76 3300046515 Ga0495620_0119119 Ga0495620_0119119_72_881 268
77 3300048913 Ga0496110_0069022 Ga0496110_0069022_2140_3027 268
78 3300049571 Ga0501034_0029852 Ga0501034_0029852_3951_4817 268
79 3300049583 Ga0501067_0001326 Ga0501067_0001326_1211_2077 268
80 3300049584 Ga0501068_0007378 Ga0501068_0007378_3229_4095 268
81 3300049586 Ga0501070_0004857 Ga0501070_0004857_7150_8016 268
82 3300049589 Ga0501073_0004066 Ga0501073_0004066_5710_6576 268
83 3300049590 Ga0501074_0006743 Ga0501074_0006743_2102_2968 268
84 3300049593 Ga0501077_0016736 Ga0501077_0016736_3698_4564 268
85 3300049741 Ga0501079_0020058 Ga0501079_0020058_3497_4363 268
86 3300049742 Ga0501080_0015799 Ga0501080_0015799_566_1432 268
87 3300049822 Ga0501035_0204146 Ga0501035_0204146_281_1147 268
88 iso_pu_bacteria 2512564039 2512732048 268
89 iso_pu_bacteria 2593339198 2595320403 268
90 iso_pu_bacteria 2671180694 2673819041 268
91 iso_pu_bacteria 2864997549 2864998511 268
92 iso_pu_bacteria 2980125574 2980126273 268
93 iso_pu_bacteria 2864733723 2864737146 269
94 iso_pu_bacteria 2889042446 2889045020 269
95 iso_pu_bacteria 2889295896 2889298721 269
96 iso_pu_bacteria 2904490793 2904491910 269
97 iso_pu_bacteria 2919160200 2919161149 269
98 iso_pu_bacteria 2931384279 2931388454 269
99 iso_pu_bacteria 2939679117 2939682561 269
100 iso_pu_bacteria 2945991243 2945992953 269
101 iso_pu_bacteria 2946053406 2946055695 269
102 iso_pu_bacteria 2981284811 2981288241 269
103 iso_pu_bacteria 2981289755 2981293062 269
104 iso_pu_bacteria 2981980479 2981983796 269
105 iso_pu_bacteria 2981985349 2981988716 269
106 iso_pu_bacteria 8054795415 8054795677 269
107 3300046455 Ga0495603_0207919 Ga0495603_0207919_282_1097 270
108 3300046460 Ga0495638_0091145 Ga0495638_0091145_386_1201 270
109 3300046474 Ga0495605_0040546 Ga0495605_0040546_1293_2108 270
110 3300046501 Ga0495607_0011532 Ga0495607_0011532_44_859 270
111 3300046507 Ga0495606_0007008 Ga0495606_0007008_8896_9711 270
112 3300046513 Ga0495616_0026651 Ga0495616_0026651_1619_2434 270
113 3300046518 Ga0495631_0013426 Ga0495631_0013426_2508_3323 270
114 3300046524 Ga0495648_0023170 Ga0495648_0023170_3155_3970 270
115 3300046530 Ga0495654_0039995 Ga0495654_0039995_1502_2317 270
116 3300046533 Ga0495640_0017241 Ga0495640_0017241_611_1426 270
117 3300046538 Ga0495609_0047569 Ga0495609_0047569_964_1779 270
118 3300046665 Ga0495661_0017810 Ga0495661_0017810_1542_2357 270
119 3300046691 Ga0495670_0059210 Ga0495670_0059210_1057_1872 270
120 3300047321 Ga0495676_0007630 Ga0495676_0007630_34_849 270
121 3300047447 Ga0495685_037385 Ga0495685_037385_24_839 270
122 3300047472 Ga0495686_0095109 Ga0495686_0095109_963_1778 270
123 3300048091 Ga0495626_0006240 Ga0495626_0006240_1577_2392 270
124 3300049459 Ga0495678_099541 Ga0495678_099541_168_983 270
125 3300049460 Ga0495682_0021324 Ga0495682_0021324_1020_1835 270
126 3300005347 Ga0070668_100278524 Ga0070668_1002785242 271
127 3300005456 Ga0070678_100378619 Ga0070678_1003786191 271
128 3300005459 Ga0068867_100392151 Ga0068867_1003921512 271
129 3300005616 Ga0068852_100969124 Ga0068852_1009691241 271
130 3300005840 Ga0068870_10106456 Ga0068870_101064562 271
131 3300006880 Ga0075429_100070992 Ga0075429_1000709923 271
132 3300009094 Ga0111539_10000093 Ga0111539_1000009321 271
133 3300026041 Ga0207639_10005566 Ga0207639_100055664 271
134 3300027907 Ga0207428_10000147 Ga0207428_1000014722 271
135 3300048911 Ga0496108_0487256 Ga0496108_0487256_175_1020 271
136 3300048928 Ga0496125_0006592 Ga0496125_0006592_6915_7733 271
137 3300049568 Ga0501031_0004116 Ga0501031_0004116_1515_2336 271
138 3300049569 Ga0501032_0003847 Ga0501032_0003847_3537_4358 271
139 3300049570 Ga0501033_0000784 Ga0501033_0000784_19003_19824 271
140 3300049571 Ga0501034_0002409 Ga0501034_0002409_3524_4345 271
141 3300049573 Ga0501037_0000913 Ga0501037_0000913_18645_19466 271
142 3300049574 Ga0501038_0000102 Ga0501038_0000102_68069_68890 271
143 3300049575 Ga0501039_0047580 Ga0501039_0047580_955_1776 271
144 3300049579 Ga0501043_0012423 Ga0501043_0012423_1507_2328 271
145 3300049580 Ga0501046_0001819 Ga0501046_0001819_4142_4963 271
146 3300049581 Ga0501047_0010290 Ga0501047_0010290_554_1375 271
147 3300049589 Ga0501073_0001706 Ga0501073_0001706_3461_4282 271
148 3300049742 Ga0501080_0080979 Ga0501080_0080979_681_1502 271
149 3300049822 Ga0501035_0002549 Ga0501035_0002549_8115_8936 271
150 3300049823 Ga0501044_0005275 Ga0501044_0005275_1508_2329 271
151 3300050508 nmdc:mga09592_168030_c1 nmdc:mga09592_168030_c1_270_1088 271
152 3300050511 nmdc:mga08y16_58_c1 nmdc:mga08y16_58_c1_28703_29521 271
153 3300053083 Ga0495655_0025579 Ga0495655_0025579_149_967 271
154 3300059640 Ga0587067_020709 Ga0587067_020709_238_1059 272
155 3300009036 Ga0105244_10060088 Ga0105244_100600881 273
156 3300044684 Ga0466966_0004131 Ga0466966_0004131_3412_4236 273
157 3300044719 Ga0466971_0190820 Ga0466971_0190820_31_855 273
158 3300045049 Ga0466959_0004355 Ga0466959_0004355_729_1553 273
159 3300049589 Ga0501073_0002396 Ga0501073_0002396_9358_10182 273
160 3300049742 Ga0501080_0017467 Ga0501080_0017467_5003_5827 273
161 3300031456 Ga0307513_10152774 Ga0307513_101527742 275
162 3300032126 Ga0307415_100110943 Ga0307415_1001109432 275
163 3300048914 Ga0496111_0148111 Ga0496111_0148111_64_954 275
164 3300048915 Ga0496112_0508583 Ga0496112_0508583_46_936 275
165 3300003203 JGI25406J46586_10000703 JGI25406J46586_100007037 276
166 3300005985 Ga0081539_10000286 Ga0081539_1000028687 276
167 3300046690 Ga0495624_0003563 Ga0495624_0003563_6710_7606 276
168 3300047321 Ga0495676_0118799 Ga0495676_0118799_233_1129 276
169 3300030522 Ga0307512_10005602 Ga0307512_100056025 277
170 3300031731 Ga0307405_10222734 Ga0307405_102227342 277
171 3300005329 Ga0070683_100669481 Ga0070683_1006694811 278
172 3300013105 Ga0157369_10061530 Ga0157369_100615302 278
173 3300020082 Ga0206353_11717966 Ga0206353_117179662 278
174 3300037312 Ga0395899_0292693 Ga0395899_0292693_61_957 279
175 3300037418 Ga0395900_0011199 Ga0395900_0011199_7712_8608 279
176 3300037466 Ga0395898_0308059 Ga0395898_0308059_351_1247 279
177 3300038443 Ga0395901_0037302 Ga0395901_0037302_1846_2742 279
178 3300005435 Ga0070714_100008946 Ga0070714_1000089466 280
179 3300005436 Ga0070713_100025319 Ga0070713_1000253193 280
180 3300006028 Ga0070717_10000727 Ga0070717_100007277 280
181 3300025929 Ga0207664_10007595 Ga0207664_100075956 280
182 3300049569 Ga0501032_0248406 Ga0501032_0248406_120_962 280
183 3300049570 Ga0501033_0005502 Ga0501033_0005502_6145_6987 280
184 3300049572 Ga0501036_0012153 Ga0501036_0012153_2752_3594 280
185 3300049575 Ga0501039_0019617 Ga0501039_0019617_746_1588 280
186 3300049578 Ga0501042_0006531 Ga0501042_0006531_3086_3928 280
187 3300049579 Ga0501043_0068911 Ga0501043_0068911_310_1152 280
188 3300049580 Ga0501046_0024366 Ga0501046_0024366_167_1009 280
189 3300049581 Ga0501047_0086158 Ga0501047_0086158_1370_2212 280
190 3300049582 Ga0501048_0005540 Ga0501048_0005540_2194_3036 280
191 3300049584 Ga0501068_0268941 Ga0501068_0268941_57_899 280
192 3300049590 Ga0501074_0391406 Ga0501074_0391406_10_852 280
193 3300049742 Ga0501080_0127533 Ga0501080_0127533_530_1372 280
194 3300049822 Ga0501035_0181604 Ga0501035_0181604_164_1006 280
195 3300049823 Ga0501044_0188751 Ga0501044_0188751_146_988 280
196 3300005336 Ga0070680_100174281 Ga0070680_1001742812 281
197 3300013307 Ga0157372_10479911 Ga0157372_104799112 281
198 3300046461 Ga0495641_0064215 Ga0495641_0064215_114_1001 281
199 3300048904 Ga0496101_0385226 Ga0496101_0385226_176_1063 281
200 iso_pu_bacteria 2791354901 2791913513 281
201 3300045976 Ga0466967_0047267 Ga0466967_0047267_984_1880 282
202 3300048908 Ga0496105_0113514 Ga0496105_0113514_1228_2112 282
203 3300048911 Ga0496108_0024491 Ga0496108_0024491_3940_4824 282
204 3300048913 Ga0496110_0024103 Ga0496110_0024103_1256_2140 282
205 3300048914 Ga0496111_0030478 Ga0496111_0030478_375_1259 282
206 3300049581 Ga0501047_0015302 Ga0501047_0015302_6190_7056 282
207 3300044842 Ga0466957_0232303 Ga0466957_0232303_228_1124 283
208 3300031824 Ga0307413_10003628 Ga0307413_100036283 286
209 3300046455 Ga0495603_0018653 Ga0495603_0018653_2664_3554 286
210 iso_pu_bacteria 2990044586 2990045030 287
211 3300053107 Ga0500560_000647 Ga0500560_000647_2087_3022 288
212 3300053140 Ga0500573_0040972 Ga0500573_0040972_923_1858 288
213 3300059424 Ga0590075_011434 Ga0590075_011434_486_1370 289
214 iso_pu_bacteria 2784746763 2785346178 289
215 iso_pu_bacteria 2863404153 2863410546 289
216 iso_pu_bacteria 8048406513 8048411395 289
217 iso_pu_bacteria 2547132111 2547405675 290
218 iso_pu_bacteria 2643221575 2643887445 290
219 iso_pu_bacteria 2784132148 2784585725 290
220 iso_pu_bacteria 2808606448 2809229223 290
221 iso_pu_bacteria 2811994917 2812481057 290
222 iso_pu_bacteria 2811994917 2812482896 290
223 iso_pu_bacteria 2862507626 2862515759 290
224 iso_pu_bacteria 8023623736 8023626506 290
225 3300025944 Ga0207661_10052412 Ga0207661_100524121 291
226 3300042002 Ga0439442_002982 Ga0439442_002982_104_1000 291
227 3300048905 Ga0496102_0227477 Ga0496102_0227477_451_1332 291
228 3300048910 Ga0496107_0058965 Ga0496107_0058965_1374_2255 291
229 3300048917 Ga0496114_0276340 Ga0496114_0276340_464_1345 291
230 iso_pu_bacteria 2862290372 2862294003 291
231 3300006844 Ga0075428_100007485 Ga0075428_1000074853 292
232 iso_pu_bacteria 2616644814 2616697601 292
233 iso_pu_bacteria 2862507626 2862511520 292
234 iso_pu_bacteria 2862705112 2862708196 292
235 iso_pu_bacteria 3006425503 3006429433 292
236 iso_pu_bacteria 8008485437 8008488087 292
237 iso_pu_bacteria 8025524527 8025527875 292
238 3300042014 Ga0439457_002796 Ga0439457_002796_3823_4740 293
239 3300042015 Ga0439462_0018330 Ga0439462_0018330_258_1175 293
240 3300042131 Ga0450894_011721 Ga0450894_011721_13_930 293
241 3300042133 Ga0450896_003786 Ga0450896_003786_244_1161 293
242 3300042145 Ga0450906_002992 Ga0450906_002992_47_964 293
243 iso_pu_bacteria 2786546132 2786674018 293
244 iso_pu_bacteria 2802429296 2804847356 293
245 iso_pu_bacteria 2808606375 2808918800 293
246 iso_pu_bacteria 2862281513 2862281696 293
247 iso_pu_bacteria 2867428634 2867430175 293
248 iso_pu_bacteria 2912757875 2912764865 293
249 iso_pu_bacteria 2954673503 2954681395 293
250 iso_pu_bacteria 2954682443 2954682763 293
251 iso_pu_bacteria 2954711539 2954719635 293
252 iso_pu_bacteria 2954721474 2954729670 293
253 iso_pu_bacteria 2954731030 2954732138 293
254 iso_pu_bacteria 2954740390 2954748574 293
255 iso_pu_bacteria 2954749733 2954751079 293
256 iso_pu_bacteria 2954759201 2954767701 293
257 iso_pu_bacteria 8025413630 8025416793 293
258 iso_pu_bacteria 8025530807 8025538463 293
259 3300005530 Ga0070679_100427275 Ga0070679_1004272752 294
260 3300025921 Ga0207652_10339654 Ga0207652_103396542 294
261 3300044765 Ga0466970_0041068 Ga0466970_0041068_1057_1980 294
262 3300049571 Ga0501034_0158458 Ga0501034_0158458_1001_1921 294
263 3300049574 Ga0501038_0007717 Ga0501038_0007717_8771_9691 294
264 3300049581 Ga0501047_0046198 Ga0501047_0046198_2745_3665 294
265 3300049581 Ga0501047_0080078 Ga0501047_0080078_1234_2154 294
266 3300049586 Ga0501070_0270169 Ga0501070_0270169_22_942 294
267 3300049823 Ga0501044_0034845 Ga0501044_0034845_94_1014 294
268 3300031456 Ga0307513_10084610 Ga0307513_100846102 295
269 3300031995 Ga0307409_100198221 Ga0307409_1001982212 295
270 3300037466 Ga0395898_0617116 Ga0395898_0617116_110_1015 295
271 3300042138 Ga0450903_006326 Ga0450903_006326_946_1869 295
272 3300044683 Ga0466965_0018876 Ga0466965_0018876_1193_2104 295
273 3300044765 Ga0466970_0001976 Ga0466970_0001976_5197_6099 295
274 3300047472 Ga0495686_0016827 Ga0495686_0016827_2777_3682 295
275 3300053129 Ga0500628_023946 Ga0500628_023946_106_1011 295
276 iso_pu_bacteria 2784746763 2785344003 295
277 iso_pu_bacteria 2990059506 2990065561 295
278 iso_pu_bacteria 8008558824 8008559785 295
279 iso_pu_bacteria 8048406513 8048413304 295
280 3300003320 rootH2_10051798 rootH2_100517984 296
281 3300003323 rootH1_10031393 rootH1_100313931 296
282 3300005458 Ga0070681_10541155 Ga0070681_105411551 296
283 3300042005 Ga0439448_0007801 Ga0439448_0007801_1815_2756 296
284 3300042007 Ga0439449_0000183 Ga0439449_0000183_15310_16215 296
285 3300042008 Ga0439450_027491 Ga0439450_027491_40_981 296
286 3300042138 Ga0450903_000760 Ga0450903_000760_1832_2773 296
287 3300042157 Ga0439458_0002656 Ga0439458_0002656_386_1327 296
288 3300046454 Ga0495592_0094596 Ga0495592_0094596_1018_1926 296
289 3300046462 Ga0495651_0099742 Ga0495651_0099742_1210_2118 296
290 3300046472 Ga0495580_0057076 Ga0495580_0057076_1557_2465 296
291 3300046663 Ga0495635_0024352 Ga0495635_0024352_48_956 296
292 3300046675 Ga0495657_0122133 Ga0495657_0122133_76_984 296
293 3300047317 Ga0495604_0075623 Ga0495604_0075623_876_1784 296
294 3300047319 Ga0495674_0387241 Ga0495674_0387241_197_1105 296
295 3300047320 Ga0495672_0117572 Ga0495672_0117572_352_1260 296
296 3300047322 Ga0495680_0040129 Ga0495680_0040129_995_1903 296
297 3300047445 Ga0495677_0024588 Ga0495677_0024588_32_940 296
298 3300047673 Ga0495593_0084688 Ga0495593_0084688_379_1287 296
299 3300049569 Ga0501032_0009566 Ga0501032_0009566_6002_6922 296
300 3300049570 Ga0501033_0039628 Ga0501033_0039628_2461_3381 296
301 3300049571 Ga0501034_0155605 Ga0501034_0155605_838_1758 296
302 3300049572 Ga0501036_0078839 Ga0501036_0078839_231_1151 296
303 3300049573 Ga0501037_0246812 Ga0501037_0246812_213_1133 296
304 3300049574 Ga0501038_0026125 Ga0501038_0026125_3639_4559 296
305 3300049575 Ga0501039_0241608 Ga0501039_0241608_392_1312 296
306 3300049579 Ga0501043_0005199 Ga0501043_0005199_4638_5558 296
307 3300049822 Ga0501035_0017325 Ga0501035_0017325_1973_2893 296
308 3300049823 Ga0501044_0016096 Ga0501044_0016096_4760_5680 296
309 3300006048 Ga0075363_100014801 Ga0075363_1000148013 297
310 3300009148 Ga0105243_10541305 Ga0105243_105413051 297
311 3300013296 Ga0157374_10331614 Ga0157374_103316142 297
312 3300028794 Ga0307515_10210359 Ga0307515_102103592 297
313 3300031456 Ga0307513_10005762 Ga0307513_1000576210 297
314 3300031649 Ga0307514_10001390 Ga0307514_1000139018 297
315 3300047472 Ga0495686_0005810 Ga0495686_0005810_7050_7991 297
316 3300050490 nmdc:mga03n38_6528_c1 nmdc:mga03n38_6528_c1_1686_2627 297
317 3300044656 Ga0466969_0004480 Ga0466969_0004480_3151_4047 298
318 3300044693 Ga0466961_0023247 Ga0466961_0023247_2984_3880 298
319 3300045049 Ga0466959_0048721 Ga0466959_0048721_1042_1938 298
320 3300046809 Ga0495600_0041688 Ga0495600_0041688_448_1344 298
321 3300053077 Ga0495601_0069942 Ga0495601_0069942_1101_1997 298
322 3300041512 Ga0451853_1301325 Ga0451853_1301325_3678_4595 299
323 3300042014 Ga0439457_007440 Ga0439457_007440_234_1151 299
324 3300042131 Ga0450894_000879 Ga0450894_000879_1121_2038 299
325 3300042132 Ga0450895_001067 Ga0450895_001067_711_1628 299
326 3300042134 Ga0450898_007744 Ga0450898_007744_230_1147 299
327 3300042135 Ga0450899_001242 Ga0450899_001242_1584_2501 299
328 3300042136 Ga0450900_013898 Ga0450900_013898_37_954 299
329 3300042145 Ga0450906_005896 Ga0450906_005896_27_944 299
330 3300046454 Ga0495592_0096390 Ga0495592_0096390_603_1502 299
331 3300046462 Ga0495651_0000176 Ga0495651_0000176_4814_5713 299
332 3300046516 Ga0495628_0008457 Ga0495628_0008457_5728_6627 299
333 3300046529 Ga0495652_0001006 Ga0495652_0001006_6999_7898 299
334 3300046543 Ga0495645_0069422 Ga0495645_0069422_498_1397 299
335 3300047317 Ga0495604_0057609 Ga0495604_0057609_681_1580 299
336 3300002067 JGI24735J21928_10032268 JGI24735J21928_100322682 300
337 3300005327 Ga0070658_10358769 Ga0070658_103587692 300
338 3300005539 Ga0068853_100036638 Ga0068853_1000366382 300
339 3300005548 Ga0070665_100023797 Ga0070665_1000237972 300
340 3300005563 Ga0068855_100005701 Ga0068855_1000057017 300
341 3300005614 Ga0068856_100048495 Ga0068856_1000484952 300
342 3300005616 Ga0068852_100007612 Ga0068852_1000076122 300
343 3300009093 Ga0105240_10013170 Ga0105240_100131702 300
344 3300009174 Ga0105241_10002382 Ga0105241_1000238210 300
345 3300009545 Ga0105237_10113366 Ga0105237_101133663 300
346 3300009551 Ga0105238_10022662 Ga0105238_100226625 300
347 3300010375 Ga0105239_10034741 Ga0105239_100347413 300
348 3300013296 Ga0157374_10018252 Ga0157374_100182522 300
349 3300025911 Ga0207654_10002767 Ga0207654_100027675 300
350 3300025913 Ga0207695_10003124 Ga0207695_1000312410 300
351 3300025914 Ga0207671_10000170 Ga0207671_1000017073 300
352 3300025924 Ga0207694_10003270 Ga0207694_100032703 300
353 3300025949 Ga0207667_10021927 Ga0207667_100219277 300
354 3300026078 Ga0207702_10075674 Ga0207702_100756742 300
355 3300026142 Ga0207698_10007361 Ga0207698_100073613 300

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

123

302

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
2r6g-assembly1.cif.gz_G the crystal structure of the e. coli maltose transporter 0.8563 36 289
4tqu-assembly1.cif.gz_N crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.8556 36 287
4jbw-assembly2.cif.gz_I crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.8397 36 288
3rlf-assembly1.cif.gz_G crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp 0.8394 36 300
8hpn-assembly1.cif.gz_B lpqy-sugabc in state 3 0.8217 36 291
ID Description Score Start End Superfamily
af_I6Y1U3_2_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9385 36 290 1.10.3720.10
af_O53483_6_271_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9354 36 290 1.10.3720.10
af_P10906_2_274_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9266 36 290 1.10.3720.10
af_I6Y1U3_2_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9013 36 290 1.10.3720.10
af_P77716_1_267_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8992 37 287 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A4V2EL48-F1-model_v4 Carbohydrate ABC transporter permease 0.9603 50 299 GO:0005886
GO:0055085
AF-A0A0B0HCC5-F1-model_v4 deleted 0.9599 36 276
AF-A0A1C4QQ99-F1-model_v4 Cellobiose transport system permease protein 0.9598 58 300 GO:0005886
GO:0055085
AF-A0A7V2RWS1-F1-model_v4 Carbohydrate ABC transporter permease 0.9588 36 285 GO:0005886
GO:0055085
AF-A0A841CQE1-F1-model_v4 Cellobiose transport system permease protein 0.9547 31 292 GO:0005886
GO:0055085

Feature Viewer

pLDDT pTM Quality
85.41 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map