F420073

General Info

Members Datasets Scaffolds Average Seq Length
355 214 699 134

Family's Representative Sequence

Representative Sequence 3300006048|Ga0075363_100547795|Ga0075363_1005477952
Length 146
Sequence MAIAPAAAITTMQADSGKSYDDINITPMVDLYLVLLLIFIIMTTAGVQGIKVNLPKAGSPANTKIEGPKLQAITVNNEGKVFLNTIPVTLEELEQKLNAIKAATPEFPVVIRGDSVTQYQGIMDVLDVIGRVGIAQVGLATKPPGS

Samples

Sample ID Description Type Environment
1 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
68 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
69 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
70 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
71 3300025227 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in- M7 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
73 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
105 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
108 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
109 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
110 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
111 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
112 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
113 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
116 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
117 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
118 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
119 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
120 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
121 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
122 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
123 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
124 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
125 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
129 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
130 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
131 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
132 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
133 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
134 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
135 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
136 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
137 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
140 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
141 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
142 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
143 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
144 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
145 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
146 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
147 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
148 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
149 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
150 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
151 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
152 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
153 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
156 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
157 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
158 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
162 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
163 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
164 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
165 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
166 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
167 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
168 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
169 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
179 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
180 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
181 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
182 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
183 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
185 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
186 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
187 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
188 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
189 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
190 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
191 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
192 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
193 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
194 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
195 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
196 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
197 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
198 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
199 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
200 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
201 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
202 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
203 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
204 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
205 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
206 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
207 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
208 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
209 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
210 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
211 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
212 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
213 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
214 2786546548 Spartobacteria bacterium LR76 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.87
Metatranscriptomes 0.56
Isolates 0.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.08
Nodule 0.28
Rhizoplane 3.94
Rhizosphere 74.08
Stem 0
Stem Tuber 0
Unclassified 7.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075363_100547795 3300006048 Bacteria 690
2 SwRhRL2b_contig_1090618 2162886007 Bacteria 1340
3 JGI24743J22301_10000729 3300001991 Bacteria 4090
4 JGI24744J21845_10058049 3300002077 Bacteria 709
5 JGI24033J26618_1000055 3300002155 Bacteria 16486
6 JGI24033J26618_1003765 3300002155 Bacteria 1612
7 JGI24742J22300_10048199 3300002244 Bacteria 768
8 rootH2_10002966 3300003320 Bacteria 63709
9 rootH2_10008800 3300003320 Bacteria 42067
10 rootH1_10000342 3300003316 Bacteria 12450
11 rootH1_10000342 3300003323 Bacteria 29593
12 rootH1_10117828 3300003323 Bacteria 2478
13 JGI25404J52841_10013064 3300003659 Bacteria 1801
14 Ga0055530_10016333 3300003791 Bacteria 2377
15 Ga0065714_10172898 3300005288 Bacteria 996
16 Ga0065714_10301233 3300005288 Bacteria 670
17 Ga0065704_10074244 3300005289 Bacteria 6426
18 Ga0065704_10080648 3300005289 Bacteria 3907
19 Ga0065704_10130866 3300005289 Bacteria 1631
20 Ga0065704_10146263 3300005289 Bacteria 1469
21 Ga0065704_10574702 3300005289 Unclassified 621
22 Ga0065712_10364233 3300005290 Bacteria 771
23 Ga0070658_10000638 3300005327 Bacteria 30268
24 Ga0070658_10003086 3300005327 Bacteria 13742
25 Ga0070670_100057999 3300005331 Bacteria 3323
26 Ga0070666_10856304 3300005335 Bacteria 671
27 Ga0070660_100346912 3300005339 Bacteria 1222
28 Ga0070661_100000196 3300005344 Bacteria 50078
29 Ga0070661_100024817 3300005344 Bacteria 4302
30 Ga0070661_100569207 3300005344 Bacteria 913
31 Ga0070668_100768137 3300005347 Bacteria 854
32 Ga0070671_100053592 3300005355 Unclassified 3353
33 Ga0070671_100078822 3300005355 Bacteria 2753
34 Ga0070671_101264348 3300005355 Bacteria 650
35 Ga0070674_100347882 3300005356 Bacteria 1196
36 Ga0070659_100016690 3300005366 Bacteria 5515
37 Ga0070713_100035432 3300005436 Unclassified 4017
38 Ga0070678_100101351 3300005456 Bacteria 2232
39 Ga0070678_102141264 3300005456 Bacteria 530
40 Ga0070662_100312671 3300005457 Bacteria 1279
41 Ga0068853_100482914 3300005539 Bacteria 1168
42 Ga0068853_101093436 3300005539 Bacteria 769
43 Ga0070665_100000064 3300005548 Bacteria 216416
44 Ga0070665_100047844 3300005548 Bacteria 4292
45 Ga0068855_100003958 3300005563 Bacteria 18088
46 Ga0070664_100109912 3300005564 Bacteria 2405
47 Ga0068856_100001114 3300005614 Bacteria 28384
48 Ga0068856_102465247 3300005614 Archaea 527
49 Ga0068852_100695046 3300005616 Bacteria 1027
50 Ga0068859_100676737 3300005617 Unclassified 1123
51 Ga0068864_102374826 3300005618 Bacteria 536
52 Ga0068863_100016566 3300005841 Bacteria 7072
53 Ga0068863_102165101 3300005841 Bacteria 566
54 Ga0068858_100011751 3300005842 Bacteria 8259
55 Ga0068858_100052891 3300005842 Bacteria 3758
56 Ga0068858_100076955 3300005842 Bacteria 3099
57 Ga0068860_100000199 3300005843 Bacteria 95791
58 Ga0068860_101357661 3300005843 Bacteria 732
59 Ga0068862_100823021 3300005844 Bacteria 908
60 Ga0081540_1000311 3300005983 Bacteria 50309
61 Ga0081540_1003769 3300005983 Bacteria 11871
62 Ga0070717_11203492 3300006028 Archaea 689
63 Ga0075368_10537617 3300006042 Bacteria 524
64 Ga0070715_10068465 3300006163 Unclassified 1579
65 Ga0070712_100515710 3300006175 Bacteria 1004
66 Ga0075366_10345354 3300006195 Unclassified 913
67 Ga0075366_10554639 3300006195 Unclassified 712
68 Ga0075366_10740240 3300006195 Bacteria 611
69 Ga0097621_100027566 3300006237 Unclassified 4469
70 Ga0097621_100272032 3300006237 Bacteria 1489
71 Ga0068871_100016012 3300006358 Bacteria 5633
72 Ga0068871_100488656 3300006358 Bacteria 1108
73 Ga0068871_101239946 3300006358 Bacteria 700
74 Ga0075434_101816776 3300006871 Bacteria 616
75 Ga0075436_100084564 3300006914 Bacteria 2202
76 Ga0097620_100676740 3300006931 Unclassified 1123
77 Ga0075435_101124194 3300007076 Bacteria 687
78 Ga0105240_10006851 3300009093 Bacteria 16660
79 Ga0105240_10070457 3300009093 Unclassified 4325
80 Ga0105240_10091032 3300009093 Bacteria 3727
81 Ga0105240_10414752 3300009093 Bacteria 1514
82 Ga0105240_12548756 3300009093 Bacteria 529
83 Ga0105247_11357480 3300009101 Bacteria 573
84 Ga0105242_10819394 3300009176 Bacteria 923
85 Ga0105248_10183229 3300009177 Bacteria 2360
86 Ga0105237_10002498 3300009545 Bacteria 22811
87 Ga0105237_10013352 3300009545 Bacteria 8616
88 Ga0105237_10189646 3300009545 Bacteria 2056
89 Ga0105238_10017714 3300009551 Bacteria 7242
90 Ga0105239_10030640 3300010375 Bacteria 5917
91 Ga0105239_10415798 3300010375 Bacteria 1523
92 Ga0105239_10450792 3300010375 Bacteria 1459
93 Ga0105239_10682094 3300010375 Bacteria 1174
94 Ga0157373_10017047 3300013100 Bacteria 5289
95 Ga0157373_10292843 3300013100 Unclassified 1154
96 Ga0157371_10092886 3300013102 Bacteria 2138
97 Ga0157371_10183266 3300013102 Bacteria 1498
98 Ga0157371_11261634 3300013102 Bacteria 571
99 Ga0157370_10004080 3300013104 Bacteria 16932
100 Ga0157374_10026963 3300013296 Bacteria 5175
101 Ga0157378_10014525 3300013297 Bacteria 6895
102 Ga0157378_10250054 3300013297 Bacteria 1697
103 Ga0157378_11726818 3300013297 Unclassified 673
104 Ga0157378_13241628 3300013297 Unclassified 506
105 Ga0163162_10563560 3300013306 Bacteria 1267
106 Ga0157375_10027179 3300013308 Bacteria 5345
107 Ga0157375_10173317 3300013308 Bacteria 2306
108 Ga0157375_12640620 3300013308 Bacteria 600
109 Ga0157380_10939849 3300014326 Unclassified 894
110 Ga0157380_11658487 3300014326 Bacteria 696
111 Ga0157379_11649355 3300014968 Bacteria 627
112 Ga0157376_10953198 3300014969 Bacteria 879
113 Ga0157376_11563840 3300014969 Bacteria 693
114 Ga0213872_10010532 3300021361 Bacteria 4397
115 Ga0213872_10056774 3300021361 Bacteria 1773
116 Ga0213872_10310929 3300021361 Bacteria 652
117 Ga0213872_10338779 3300021361 Bacteria 619
118 Ga0213874_10275726 3300021377 Bacteria 627
119 Ga0213876_10029402 3300021384 Bacteria 2895
120 Ga0213871_10035485 3300021441 Bacteria 1319
121 Ga0213871_10054727 3300021441 Bacteria 1101
122 Ga0207638_1000112 3300025227 Bacteria 1598
123 Ga0209758_1073607 3300025297 Bacteria 1063
124 Ga0209758_1108700 3300025297 Bacteria 772
125 Ga0209050_1000641 3300025298 Bacteria 54197
126 Ga0207688_10070783 3300025901 Bacteria 1979
127 Ga0207705_10001839 3300025909 Bacteria 16687
128 Ga0207705_10023416 3300025909 Bacteria 4405
129 Ga0207684_10014336 3300025910 Bacteria 6837
130 Ga0207695_10000336 3300025913 Bacteria 110791
131 Ga0207695_10002796 3300025913 Bacteria 25373
132 Ga0207695_10147031 3300025913 Bacteria 2300
133 Ga0207695_10348605 3300025913 Bacteria 1368
134 Ga0207695_10419282 3300025913 Bacteria 1223
135 Ga0207671_10002681 3300025914 Bacteria 18673
136 Ga0207671_10013726 3300025914 Bacteria 6432
137 Ga0207671_10175558 3300025914 Bacteria 1665
138 Ga0207671_10840781 3300025914 Bacteria 727
139 Ga0207693_10292379 3300025915 Bacteria 1277
140 Ga0207663_10244506 3300025916 Bacteria 1318
141 Ga0207657_10044094 3300025919 Bacteria 3923
142 Ga0207649_10001381 3300025920 Bacteria 14385
143 Ga0207649_10100913 3300025920 Bacteria 1910
144 Ga0207694_10001653 3300025924 Bacteria 18732
145 Ga0207694_10319218 3300025924 Bacteria 1282
146 Ga0207650_10243963 3300025925 Bacteria 1452
147 Ga0207700_10021844 3300025928 Unclassified 4379
148 Ga0207644_10352976 3300025931 Bacteria 1195
149 Ga0207644_10524416 3300025931 Bacteria 979
150 Ga0207690_10010367 3300025932 Bacteria 5535
151 Ga0207706_10165374 3300025933 Bacteria 1944
152 Ga0207669_10387338 3300025937 Bacteria 1091
153 Ga0207711_10250629 3300025941 Bacteria 1626
154 Ga0207689_10196183 3300025942 Bacteria 1666
155 Ga0207661_11118500 3300025944 Bacteria 725
156 Ga0207679_10044195 3300025945 Bacteria 3213
157 Ga0207679_10949537 3300025945 Bacteria 787
158 Ga0207667_10010339 3300025949 Bacteria 10911
159 Ga0207651_10177753 3300025960 Bacteria 1685
160 Ga0207703_10036500 3300026035 Bacteria 3913
161 Ga0207703_10228912 3300026035 Unclassified 1666
162 Ga0207703_10436606 3300026035 Bacteria 1221
163 Ga0207702_10000503 3300026078 Bacteria 44056
164 Ga0207641_10008034 3300026088 Bacteria 8745
165 Ga0207641_10827414 3300026088 Bacteria 917
166 Ga0207683_10014323 3300026121 Bacteria 6756
167 Ga0207683_11102871 3300026121 Bacteria 736
168 Ga0207698_11178390 3300026142 Bacteria 780
169 Ga0268266_10000258 3300028379 Bacteria 89023
170 Ga0268266_10005770 3300028379 Bacteria 11463
171 Ga0268266_10023969 3300028379 Bacteria 5192
172 Ga0268265_12108616 3300028380 Unclassified 571
173 Ga0268264_10000366 3300028381 Bacteria 67007
174 Ga0307515_10038124 3300028794 Bacteria 7700
175 Ga0265763_1002048 3300030763 Bacteria 1511
176 Ga0265760_10000145 3300031090 Bacteria 18251
177 Ga0265330_10300334 3300031235 Bacteria 677
178 Ga0265325_10074284 3300031241 Unclassified 1701
179 Ga0265340_10027635 3300031247 Bacteria 2859
180 Ga0265331_10004489 3300031250 Bacteria 8706
181 Ga0265331_10230834 3300031250 Bacteria 831
182 Ga0265327_10009134 3300031251 Bacteria 7209
183 Ga0265327_10009702 3300031251 Bacteria 6898
184 Ga0265316_10110038 3300031344 Bacteria 2087
185 Ga0307513_10102219 3300031456 Bacteria 2886
186 Ga0307408_100000034 3300031548 Bacteria 208605
187 Ga0307408_100012690 3300031548 Bacteria 5589
188 Ga0307408_100045254 3300031548 Bacteria 3142
189 Ga0307516_10103205 3300031730 Bacteria 2665
190 Ga0307410_10385101 3300031852 Bacteria 1129
191 Ga0307406_10000175 3300031901 Bacteria 38313
192 Ga0307406_10002360 3300031901 Bacteria 10267
193 Ga0307406_10081221 3300031901 Bacteria 2155
194 Ga0307406_10397522 3300031901 Bacteria 1091
195 Ga0307407_10572834 3300031903 Bacteria 837
196 Ga0307412_10657485 3300031911 Bacteria 895
197 Ga0307409_100005202 3300031995 Bacteria 7447
198 Ga0307409_100245738 3300031995 Bacteria 1632
199 Ga0307409_100507665 3300031995 Bacteria 1175
200 Ga0307409_100580515 3300031995 Bacteria 1105
201 Ga0307416_101378748 3300032002 Bacteria 811
202 Ga0307414_10000007 3300032004 Bacteria 407977
203 Ga0307414_10006455 3300032004 Bacteria 6541
204 Ga0307414_10541517 3300032004 Bacteria 1036
205 Ga0307414_11863175 3300032004 Bacteria 561
206 Ga0373942_0033050 3300035207 Bacteria 1378
207 Ga0373927_0741994 3300035695 Bacteria 649
208 Ga0395899_0000250 3300037312 Bacteria 71846
209 Ga0395898_0000170 3300037466 Bacteria 168466
210 Ga0395901_0207610 3300038443 Bacteria 2051
211 Ga0436365_0258649 3300039437 Bacteria 1376
212 Ga0436365_0770770 3300039437 Bacteria 5129
213 Ga0436365_1085227 3300039437 Bacteria 8874
214 Ga0436360_0038147 3300039438 Bacteria 858
215 Ga0436360_0062041 3300039438 Bacteria 4467
216 Ga0436360_0098632 3300039438 Bacteria 1467
217 Ga0436360_0570539 3300039438 Bacteria 1365
218 Ga0436360_1045300 3300039438 Bacteria 542
219 Ga0436360_1193132 3300039438 Unclassified 1727
220 Ga0436361_0205947 3300039447 Bacteria 4231
221 Ga0436361_0635363 3300039447 Bacteria 2163
222 Ga0436361_0739226 3300039447 Bacteria 533
223 Ga0436361_1007725 3300039447 Bacteria 3639
224 Ga0436361_1019371 3300039447 Bacteria 607
225 Ga0436363_1028879 3300039450 Bacteria 1042
226 Ga0436362_0057551 3300039453 Bacteria 1378
227 Ga0436362_0205555 3300039453 Bacteria 1165
228 Ga0436362_0341908 3300039453 Bacteria 502
229 Ga0436362_0411507 3300039453 Bacteria 539
230 Ga0436362_0488113 3300039453 Bacteria 1259
231 Ga0436362_0821351 3300039453 Bacteria 998
232 Ga0451787_506088 3300041441 Bacteria 804
233 Ga0451800_0485385 3300041459 Bacteria 546
234 Ga0451853_2556988 3300041512 Bacteria 532
235 Ga0451577_0003220 3300042876 Bacteria 18341
236 Ga0451577_0311046 3300042876 Bacteria 1428
237 Ga0466965_0070146 3300044683 Bacteria 1761
238 Ga0466963_0312970 3300044694 Bacteria 1105
239 Ga0466964_0014089 3300044706 Bacteria 3038
240 Ga0466971_0000072 3300044719 Bacteria 37014
241 Ga0466957_0001744 3300044842 Bacteria 11448
242 Ga0466957_0204373 3300044842 Bacteria 1298
243 Ga0466967_0947966 3300045976 Bacteria 856
244 Ga0495618_0122325 3300046514 Bacteria 1667
245 Ga0495628_0371291 3300046516 Bacteria 1049
246 Ga0495643_0000057 3300046522 Bacteria 195145
247 Ga0495657_0067861 3300046675 Bacteria 2339
248 Ga0495599_0274226 3300046678 Bacteria 1023
249 Ga0495646_0339802 3300046680 Bacteria 788
250 Ga0495600_0412905 3300046809 Bacteria 839
251 Ga0495674_1106736 3300047319 Bacteria 603
252 Ga0495602_0282074 3300048088 Bacteria 1223
253 Ga0495602_1077318 3300048088 Bacteria 528
254 Ga0496100_0164903 3300048903 Unclassified 1591
255 Ga0496101_0136633 3300048904 Unclassified 1866
256 Ga0496102_0162532 3300048905 Unclassified 2101
257 Ga0496103_0158000 3300048906 Bacteria 1454
258 Ga0496108_0656627 3300048911 Bacteria 911
259 Ga0496109_0182186 3300048912 Unclassified 1973
260 Ga0496110_1057018 3300048913 Bacteria 720
261 Ga0496112_0020689 3300048915 Bacteria 6241
262 Ga0496112_0320218 3300048915 Bacteria 1495
263 Ga0496114_0065066 3300048917 Bacteria 3054
264 Ga0496115_0003168 3300048918 Bacteria 11824
265 Ga0496115_0685132 3300048918 Bacteria 807
266 Ga0496118_0318975 3300048921 Unclassified 844
267 Ga0496121_0090190 3300048924 Bacteria 2397
268 Ga0496121_0303699 3300048924 Bacteria 1082
269 Ga0496122_0078173 3300048925 Bacteria 2319
270 Ga0496122_0099746 3300048925 Bacteria 1946
271 Ga0496123_0151730 3300048926 Bacteria 1249
272 Ga0496124_0108407 3300048927 Bacteria 2239
273 Ga0496125_0000123 3300048928 Bacteria 170244
274 Ga0496125_0131620 3300048928 Bacteria 1760
275 Ga0496125_0365219 3300048928 Bacteria 857
276 Ga0496126_0811976 3300048929 Bacteria 717
277 Ga0501031_0000054 3300049568 Bacteria 62184
278 Ga0501032_0000020 3300049569 Bacteria 148483
279 Ga0501032_0029693 3300049569 Bacteria 3750
280 Ga0501032_0341117 3300049569 Bacteria 966
281 Ga0501033_0000001 3300049570 Bacteria 795921
282 Ga0501033_0001227 3300049570 Bacteria 22989
283 Ga0501033_0087943 3300049570 Bacteria 2273
284 Ga0501034_0256037 3300049571 Bacteria 1694
285 Ga0501036_0139508 3300049572 Bacteria 2046
286 Ga0501037_0000094 3300049573 Bacteria 83003
287 Ga0501038_0000250 3300049574 Bacteria 45474
288 Ga0501038_0007381 3300049574 Bacteria 10139
289 Ga0501038_0299626 3300049574 Bacteria 1262
290 Ga0501043_0002180 3300049579 Bacteria 16717
291 Ga0501043_0004227 3300049579 Bacteria 11705
292 Ga0501043_0028329 3300049579 Bacteria 4397
293 Ga0501047_0001278 3300049581 Bacteria 24871
294 Ga0501047_0060310 3300049581 Bacteria 3661
295 Ga0501047_0172378 3300049581 Bacteria 2032
296 Ga0501047_0532668 3300049581 Bacteria 1000
297 Ga0501070_0027845 3300049586 Bacteria 4740
298 Ga0501070_0524255 3300049586 Bacteria 950
299 Ga0501223_072631 3300049663 Bacteria 681
300 Ga0501227_036368 3300049665 Bacteria 1201
301 Ga0501235_235973 3300049669 Bacteria 507
302 Ga0501080_0029185 3300049742 Bacteria 5135
303 Ga0501035_0000114 3300049822 Bacteria 98468
304 Ga0501035_0304045 3300049822 Bacteria 1343
305 Ga0501044_0012487 3300049823 Bacteria 9196
306 Ga0501044_0015184 3300049823 Bacteria 8295
307 nmdc:mga03n38_704725_c1 3300050490 Bacteria 582
308 nmdc:mga0yw44_302708_c1 3300050492 Bacteria 1071
309 nmdc:mga0k408_425081_c1 3300050493 Unclassified 790
310 nmdc:mga0k408_639930_c1 3300050493 Bacteria 626
311 nmdc:mga0k408_900830_c1 3300050493 Bacteria 513
312 nmdc:mga08x19_756016_c1 3300050514 Bacteria 690
313 Ga0500610_0122016 3300053079 Bacteria 1332
314 Ga0500635_0230495 3300053080 Unclassified 724
315 Ga0500643_039215 3300053087 Bacteria 1400
316 Ga0500643_066924 3300053087 Bacteria 1001
317 Ga0500643_084697 3300053087 Bacteria 868
318 Ga0500643_183952 3300053087 Bacteria 560
319 Ga0500566_0010124 3300053094 Bacteria 5560
320 Ga0500554_042337 3300053102 Bacteria 1403
321 Ga0500555_000093 3300053103 Bacteria 42057
322 Ga0500556_0256059 3300053104 Bacteria 688
323 Ga0500594_0029382 3300053118 Unclassified 1437
324 Ga0500595_000234 3300053119 Bacteria 37453
325 Ga0500595_021713 3300053119 Bacteria 2287
326 Ga0500628_022768 3300053129 Bacteria 1285
327 Ga0500559_0000495 3300053136 Bacteria 27654
328 Ga0500559_0039086 3300053136 Bacteria 2063
329 Ga0500559_0115511 3300053136 Bacteria 1246
330 Ga0500568_0050557 3300053139 Bacteria 1638
331 Ga0500573_0000006 3300053140 Bacteria 285988
332 Ga0500573_0137383 3300053140 Bacteria 1349
333 Ga0500603_021295 3300053150 Bacteria 1593
334 Ga0500616_0008426 3300053153 Bacteria 6405
335 Ga0500616_0015745 3300053153 Bacteria 4317
336 Ga0500616_0077061 3300053153 Bacteria 1684
337 Ga0500616_0178059 3300053153 Bacteria 960
338 Ga0500622_0415991 3300053156 Bacteria 542
339 Ga0500627_0102729 3300053158 Bacteria 1284
340 Ga0500627_0222874 3300053158 Bacteria 841
341 Ga0500638_018726 3300053162 Bacteria 3235
342 Ga0500636_0181392 3300053177 Bacteria 1130
343 Ga0500637_0032590 3300053178 Bacteria 2905
344 Ga0500611_118651 3300053727 Bacteria 703
345 Ga0500645_010805 3300053730 Bacteria 3003
346 Ga0500645_077101 3300053730 Bacteria 953
347 Ga0500661_000196 3300055283 Bacteria 10677
348 Ga0466962_0000139 3300061719 Bacteria 29705
349 2509146746 2508501128 Bacteria 8613869
350 2787507564 2786546548 Bacteria 4745694
351 Ga0075363_100547795
352 SwRhRL2b_contig_1090618
353 JGI24743J22301_10000729
354 JGI24744J21845_10058049
355 JGI24033J26618_1000055
356 JGI24033J26618_1003765
357 JGI24742J22300_10048199
358 rootH2_10002966
359 rootH2_10008800
360 rootH1_10000342
361 rootH1_10117828
362 JGI25404J52841_10013064
363 Ga0055530_10016333
364 Ga0065714_10172898
365 Ga0065714_10301233
366 Ga0065704_10074244
367 Ga0065704_10080648
368 Ga0065704_10130866
369 Ga0065704_10146263
370 Ga0065704_10574702
371 Ga0065712_10364233
372 Ga0070658_10000638
373 Ga0070658_10003086
374 Ga0070670_100057999
375 Ga0070666_10856304
376 Ga0070660_100346912
377 Ga0070661_100000196
378 Ga0070661_100024817
379 Ga0070661_100569207
380 Ga0070668_100768137
381 Ga0070671_100053592
382 Ga0070671_100078822
383 Ga0070671_101264348
384 Ga0070674_100347882
385 Ga0070659_100016690
386 Ga0070713_100035432
387 Ga0070678_100101351
388 Ga0070678_102141264
389 Ga0070662_100312671
390 Ga0068853_100482914
391 Ga0068853_101093436
392 Ga0070665_100000064
393 Ga0070665_100047844
394 Ga0068855_100003958
395 Ga0070664_100109912
396 Ga0068856_100001114
397 Ga0068856_102465247
398 Ga0068852_100695046
399 Ga0068859_100676737
400 Ga0068864_102374826
401 Ga0068863_100016566
402 Ga0068863_102165101
403 Ga0068858_100011751
404 Ga0068858_100052891
405 Ga0068858_100076955
406 Ga0068860_100000199
407 Ga0068860_101357661
408 Ga0068862_100823021
409 Ga0081540_1000311
410 Ga0081540_1003769
411 Ga0070717_11203492
412 Ga0075368_10537617
413 Ga0070715_10068465
414 Ga0070712_100515710
415 Ga0075366_10345354
416 Ga0075366_10554639
417 Ga0075366_10740240
418 Ga0097621_100027566
419 Ga0097621_100272032
420 Ga0068871_100016012
421 Ga0068871_100488656
422 Ga0068871_101239946
423 Ga0075434_101816776
424 Ga0075436_100084564
425 Ga0097620_100676740
426 Ga0075435_101124194
427 Ga0105240_10006851
428 Ga0105240_10070457
429 Ga0105240_10091032
430 Ga0105240_10414752
431 Ga0105240_12548756
432 Ga0105247_11357480
433 Ga0105242_10819394
434 Ga0105248_10183229
435 Ga0105237_10002498
436 Ga0105237_10013352
437 Ga0105237_10189646
438 Ga0105238_10017714
439 Ga0105239_10030640
440 Ga0105239_10415798
441 Ga0105239_10450792
442 Ga0105239_10682094
443 Ga0157373_10017047
444 Ga0157373_10292843
445 Ga0157371_10092886
446 Ga0157371_10183266
447 Ga0157371_11261634
448 Ga0157370_10004080
449 Ga0157374_10026963
450 Ga0157378_10014525
451 Ga0157378_10250054
452 Ga0157378_11726818
453 Ga0157378_13241628
454 Ga0163162_10563560
455 Ga0157375_10027179
456 Ga0157375_10173317
457 Ga0157375_12640620
458 Ga0157380_10939849
459 Ga0157380_11658487
460 Ga0157379_11649355
461 Ga0157376_10953198
462 Ga0157376_11563840
463 Ga0213872_10010532
464 Ga0213872_10056774
465 Ga0213872_10310929
466 Ga0213872_10338779
467 Ga0213874_10275726
468 Ga0213876_10029402
469 Ga0213871_10035485
470 Ga0213871_10054727
471 Ga0207638_1000112
472 Ga0209758_1073607
473 Ga0209758_1108700
474 Ga0209050_1000641
475 Ga0207688_10070783
476 Ga0207705_10001839
477 Ga0207705_10023416
478 Ga0207684_10014336
479 Ga0207695_10000336
480 Ga0207695_10002796
481 Ga0207695_10147031
482 Ga0207695_10348605
483 Ga0207695_10419282
484 Ga0207671_10002681
485 Ga0207671_10013726
486 Ga0207671_10175558
487 Ga0207671_10840781
488 Ga0207693_10292379
489 Ga0207663_10244506
490 Ga0207657_10044094
491 Ga0207649_10001381
492 Ga0207649_10100913
493 Ga0207694_10001653
494 Ga0207694_10319218
495 Ga0207650_10243963
496 Ga0207700_10021844
497 Ga0207644_10352976
498 Ga0207644_10524416
499 Ga0207690_10010367
500 Ga0207706_10165374
501 Ga0207669_10387338
502 Ga0207711_10250629
503 Ga0207689_10196183
504 Ga0207661_11118500
505 Ga0207679_10044195
506 Ga0207679_10949537
507 Ga0207667_10010339
508 Ga0207651_10177753
509 Ga0207703_10036500
510 Ga0207703_10228912
511 Ga0207703_10436606
512 Ga0207702_10000503
513 Ga0207641_10008034
514 Ga0207641_10827414
515 Ga0207683_10014323
516 Ga0207683_11102871
517 Ga0207698_11178390
518 Ga0268266_10000258
519 Ga0268266_10005770
520 Ga0268266_10023969
521 Ga0268265_12108616
522 Ga0268264_10000366
523 Ga0307515_10038124
524 Ga0265763_1002048
525 Ga0265760_10000145
526 Ga0265330_10300334
527 Ga0265325_10074284
528 Ga0265340_10027635
529 Ga0265331_10004489
530 Ga0265331_10230834
531 Ga0265327_10009134
532 Ga0265327_10009702
533 Ga0265316_10110038
534 Ga0307513_10102219
535 Ga0307408_100000034
536 Ga0307408_100012690
537 Ga0307408_100045254
538 Ga0307516_10103205
539 Ga0307410_10385101
540 Ga0307406_10000175
541 Ga0307406_10002360
542 Ga0307406_10081221
543 Ga0307406_10397522
544 Ga0307407_10572834
545 Ga0307412_10657485
546 Ga0307409_100005202
547 Ga0307409_100245738
548 Ga0307409_100507665
549 Ga0307409_100580515
550 Ga0307416_101378748
551 Ga0307414_10000007
552 Ga0307414_10006455
553 Ga0307414_10541517
554 Ga0307414_11863175
555 Ga0373942_0033050
556 Ga0373927_0741994
557 Ga0395899_0000250
558 Ga0395898_0000170
559 Ga0395901_0207610
560 Ga0436365_0258649
561 Ga0436365_0770770
562 Ga0436365_1085227
563 Ga0436360_0038147
564 Ga0436360_0062041
565 Ga0436360_0098632
566 Ga0436360_0570539
567 Ga0436360_1045300
568 Ga0436360_1193132
569 Ga0436361_0205947
570 Ga0436361_0635363
571 Ga0436361_0739226
572 Ga0436361_1007725
573 Ga0436361_1019371
574 Ga0436363_1028879
575 Ga0436362_0057551
576 Ga0436362_0205555
577 Ga0436362_0341908
578 Ga0436362_0411507
579 Ga0436362_0488113
580 Ga0436362_0821351
581 Ga0451787_506088
582 Ga0451800_0485385
583 Ga0451853_2556988
584 Ga0451577_0003220
585 Ga0451577_0311046
586 Ga0466965_0070146
587 Ga0466963_0312970
588 Ga0466964_0014089
589 Ga0466971_0000072
590 Ga0466957_0001744
591 Ga0466957_0204373
592 Ga0466967_0947966
593 Ga0495618_0122325
594 Ga0495628_0371291
595 Ga0495643_0000057
596 Ga0495657_0067861
597 Ga0495599_0274226
598 Ga0495646_0339802
599 Ga0495600_0412905
600 Ga0495674_1106736
601 Ga0495602_0282074
602 Ga0495602_1077318
603 Ga0496100_0164903
604 Ga0496101_0136633
605 Ga0496102_0162532
606 Ga0496103_0158000
607 Ga0496108_0656627
608 Ga0496109_0182186
609 Ga0496110_1057018
610 Ga0496112_0020689
611 Ga0496112_0320218
612 Ga0496114_0065066
613 Ga0496115_0003168
614 Ga0496115_0685132
615 Ga0496118_0318975
616 Ga0496121_0090190
617 Ga0496121_0303699
618 Ga0496122_0078173
619 Ga0496122_0099746
620 Ga0496123_0151730
621 Ga0496124_0108407
622 Ga0496125_0000123
623 Ga0496125_0131620
624 Ga0496125_0365219
625 Ga0496126_0811976
626 Ga0501031_0000054
627 Ga0501032_0000020
628 Ga0501032_0029693
629 Ga0501032_0341117
630 Ga0501033_0000001
631 Ga0501033_0001227
632 Ga0501033_0087943
633 Ga0501034_0256037
634 Ga0501036_0139508
635 Ga0501037_0000094
636 Ga0501038_0000250
637 Ga0501038_0007381
638 Ga0501038_0299626
639 Ga0501043_0002180
640 Ga0501043_0004227
641 Ga0501043_0028329
642 Ga0501047_0001278
643 Ga0501047_0060310
644 Ga0501047_0172378
645 Ga0501047_0532668
646 Ga0501070_0027845
647 Ga0501070_0524255
648 Ga0501223_072631
649 Ga0501227_036368
650 Ga0501235_235973
651 Ga0501080_0029185
652 Ga0501035_0000114
653 Ga0501035_0304045
654 Ga0501044_0012487
655 Ga0501044_0015184
656 nmdc:mga03n38_704725_c1
657 nmdc:mga0yw44_302708_c1
658 nmdc:mga0k408_425081_c1
659 nmdc:mga0k408_639930_c1
660 nmdc:mga0k408_900830_c1
661 nmdc:mga08x19_756016_c1
662 Ga0500610_0122016
663 Ga0500635_0230495
664 Ga0500643_039215
665 Ga0500643_066924
666 Ga0500643_084697
667 Ga0500643_183952
668 Ga0500566_0010124
669 Ga0500554_042337
670 Ga0500555_000093
671 Ga0500556_0256059
672 Ga0500594_0029382
673 Ga0500595_000234
674 Ga0500595_021713
675 Ga0500628_022768
676 Ga0500559_0000495
677 Ga0500559_0039086
678 Ga0500559_0115511
679 Ga0500568_0050557
680 Ga0500573_0000006
681 Ga0500573_0137383
682 Ga0500603_021295
683 Ga0500616_0008426
684 Ga0500616_0015745
685 Ga0500616_0077061
686 Ga0500616_0178059
687 Ga0500622_0415991
688 Ga0500627_0102729
689 Ga0500627_0222874
690 Ga0500638_018726
691 Ga0500636_0181392
692 Ga0500637_0032590
693 Ga0500611_118651
694 Ga0500645_010805
695 Ga0500645_077101
696 Ga0500661_000196
697 Ga0466962_0000139
698 2509146746
699 2787507564

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

17

144

0.95

Map