F420118

General Info

Members Datasets Scaffolds Average Seq Length
355 250 710 499

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10039065|Ga0105249_100390652
Length 568
Sequence MLLQLRCRVVSLRRRQLPALARRGFAWAGGCHLGSGLVDARSAECDAMRNTPEDHMAEAQHGRGKGMDASEDVELLRSMGYAQELRRRMSGFSNFAISFSIICILAGGITSLQLGVSAVGGAAAGIVWPVGVGFSLLVALCMAQVASAFPTAGGLYHWSSILGGKGWGWATAWFNLGGLVFVTAAVNVGAYSLFINFVGPLLGIDPTQLGVVHQVIGVALITASHALFNHLGIRVTTLLTDFSGYWIFFVAVLLTIVMLFGAGSIDIGRLFTFANFGGPSGGDVWPESGSLLRMALLGLMWPIYTITGFDASAHTSEETVQAAKNVPRGILRSVYLSGLFGWVMVSAFVLAMPSMSEAAKQGANVFPWLMEQVVPGALGKALWVGIVISNYLCGLACVTSTSRMMYAFARDGGLPGSAALKQVSPKWQTPVTAIWVTAALAIASTLYAPAYSTLTTACVIFLYLSYVMPTVCGFFAFGKTWTKMGPFDLGARLYKTLAAISVLGVLVVVWIGVQPPNDKALTVLAAVSVLLGASWKLGVQRVFRGPPLMSIASVPPPAAVAAQQPRPA

Samples

Sample ID Description Type Environment
1 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
75 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
76 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
77 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
113 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
114 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
115 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
116 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
117 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
118 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
119 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
120 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
121 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
122 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
123 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
124 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
125 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
126 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
127 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
128 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
134 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
135 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
136 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
137 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
138 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
139 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
142 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
143 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
144 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
145 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
146 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
147 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
148 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
149 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
150 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
151 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
152 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
153 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
154 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
155 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
156 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
157 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
160 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
163 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
164 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
165 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
166 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
167 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
168 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
173 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
174 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
175 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
176 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
177 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
178 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
179 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
182 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
183 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
184 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
185 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
186 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
187 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
188 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
189 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
190 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
191 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
192 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
193 2512875024
194 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
195 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
196 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
197 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
198 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified
199 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
200 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
201 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
202 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
203 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
204 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
205 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
206 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
207 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
208 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
209 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
210 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
211 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
212 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
213 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
214 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
215 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
216 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
217 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
218 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere
219 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
220 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
221 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
222 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
223 2909042592 Labrys sp. LIt4 Isolate Nodule
224 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
225 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
226 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
227 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
228 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
229 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
230 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
231 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
232 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
233 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
234 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
235 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
236 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
237 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
238 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
239 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
240 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
241 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
242 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
243 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
244 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
245 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
246 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
247 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
248 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
249 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
250 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.1
Metatranscriptomes 0
Isolates 16.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.63
Nodule 12.96
Rhizoplane 3.66
Rhizosphere 72.68
Stem 0
Stem Tuber 0
Unclassified 1.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105249_10039065 3300009553 Bacteria 4308
2 JGI24739J22299_10005537 3300001989 Bacteria 4786
3 JGI25157J39369_1000502 3300002741 Bacteria 24104
4 rootL2_10020137 3300003322 Bacteria 3214
5 rootH1_10000064 3300003323 Bacteria 13039
6 rootH1_10051731 3300003323 Bacteria 10002
7 Ga0070658_10007440 3300005327 Bacteria 8840
8 Ga0070676_10008606 3300005328 Bacteria 5503
9 Ga0070683_100028197 3300005329 Bacteria 5073
10 Ga0070690_100013217 3300005330 Bacteria 4873
11 Ga0070666_10082946 3300005335 Bacteria 2193
12 Ga0070680_100056377 3300005336 Bacteria 3212
13 Ga0068868_100054458 3300005338 Bacteria 3153
14 Ga0068868_100062322 3300005338 Bacteria 2956
15 Ga0068868_100159328 3300005338 Bacteria 1863
16 Ga0070689_100000001 3300005340 Bacteria 1334580
17 Ga0070689_100006572 3300005340 Bacteria 8064
18 Ga0070689_100059094 3300005340 Bacteria 2979
19 Ga0070687_100004458 3300005343 Bacteria 5586
20 Ga0070687_100022633 3300005343 Bacteria 2975
21 Ga0070668_100054432 3300005347 Bacteria 3086
22 Ga0070669_100004920 3300005353 Bacteria 9649
23 Ga0070675_100053367 3300005354 Bacteria 3325
24 Ga0070671_100001713 3300005355 Bacteria 16644
25 Ga0070674_100037216 3300005356 Bacteria 3271
26 Ga0070673_100020202 3300005364 Bacteria 4800
27 Ga0070673_100063990 3300005364 Bacteria 2929
28 Ga0070673_100081399 3300005364 Bacteria 2626
29 Ga0070708_100023406 3300005445 Bacteria 5253
30 Ga0070708_100106178 3300005445 Bacteria 2578
31 Ga0070662_100109944 3300005457 Bacteria 2098
32 Ga0070681_10026440 3300005458 Bacteria 5831
33 Ga0070681_10167532 3300005458 Bacteria 2119
34 Ga0068867_100113814 3300005459 Bacteria 2082
35 Ga0070685_10059712 3300005466 Bacteria 2227
36 Ga0070706_100002969 3300005467 Bacteria 16832
37 Ga0070706_100023950 3300005467 Bacteria 5621
38 Ga0070706_100167982 3300005467 Bacteria 2048
39 Ga0070707_100017690 3300005468 Bacteria 6704
40 Ga0070698_100013851 3300005471 Bacteria 8529
41 Ga0070698_100032211 3300005471 Bacteria 5430
42 Ga0070698_100072777 3300005471 Bacteria 3444
43 Ga0070698_100090966 3300005471 Bacteria 3034
44 Ga0070699_100002253 3300005518 Bacteria 17398
45 Ga0070679_100085198 3300005530 Bacteria 3147
46 Ga0070684_100003684 3300005535 Bacteria 11561
47 Ga0070684_100003710 3300005535 Bacteria 11520
48 Ga0070697_100107459 3300005536 Bacteria 2322
49 Ga0068853_100007265 3300005539 Bacteria 8872
50 Ga0070672_100006434 3300005543 Bacteria 7896
51 Ga0070672_100046547 3300005543 Bacteria 3361
52 Ga0070672_100082090 3300005543 Bacteria 2586
53 Ga0070696_100060157 3300005546 Bacteria 2656
54 Ga0070665_100040588 3300005548 Bacteria 4677
55 Ga0068855_100007348 3300005563 Bacteria 13348
56 Ga0068855_100033902 3300005563 Bacteria 6090
57 Ga0068855_100084707 3300005563 Bacteria 3669
58 Ga0068855_100152463 3300005563 Bacteria 2627
59 Ga0070702_100105727 3300005615 Bacteria 1735
60 Ga0068859_100002898 3300005617 Bacteria 17423
61 Ga0068866_10081412 3300005718 Bacteria 1739
62 Ga0068861_100003626 3300005719 Bacteria 10285
63 Ga0068861_100043678 3300005719 Bacteria 3366
64 Ga0068861_100131943 3300005719 Bacteria 2028
65 Ga0068863_100026502 3300005841 Bacteria 5529
66 Ga0068863_100056571 3300005841 Bacteria 3713
67 Ga0068863_100145164 3300005841 Bacteria 2269
68 Ga0068858_100041712 3300005842 Bacteria 4254
69 Ga0068858_100041979 3300005842 Bacteria 4241
70 Ga0068860_100047631 3300005843 Bacteria 4085
71 Ga0068862_100022249 3300005844 Bacteria 5302
72 Ga0068862_100076670 3300005844 Bacteria 2894
73 Ga0081540_1014907 3300005983 Bacteria 4945
74 Ga0081539_10001521 3300005985 Bacteria 38875
75 Ga0075365_10001944 3300006038 Bacteria 9753
76 Ga0075365_10112408 3300006038 Bacteria 1873
77 Ga0075368_10035650 3300006042 Bacteria 1942
78 Ga0075364_10013311 3300006051 Bacteria 5051
79 Ga0075362_10000833 3300006177 Bacteria 9249
80 Ga0075367_10014500 3300006178 Bacteria 4268
81 Ga0075366_10029502 3300006195 Bacteria 3222
82 Ga0075428_100069396 3300006844 Bacteria 3853
83 Ga0075428_100207020 3300006844 Bacteria 2120
84 Ga0075431_100015217 3300006847 Bacteria 7795
85 Ga0075433_10132184 3300006852 Bacteria 2217
86 Ga0075429_100043136 3300006880 Bacteria 3924
87 Ga0097620_100002898 3300006931 Bacteria 17423
88 Ga0075435_100017046 3300007076 Bacteria 5488
89 Ga0105240_10002249 3300009093 Bacteria 31352
90 Ga0105240_10224983 3300009093 Bacteria 2184
91 Ga0111539_10001232 3300009094 Bacteria 34078
92 Ga0111539_10026273 3300009094 Bacteria 7121
93 Ga0111539_10056887 3300009094 Bacteria 4647
94 Ga0105245_10049086 3300009098 Unclassified 3778
95 Ga0114129_10038869 3300009147 Bacteria 6708
96 Ga0114129_10136079 3300009147 Bacteria 3371
97 Ga0105243_10042459 3300009148 Bacteria 3560
98 Ga0105248_10115545 3300009177 Bacteria 3027
99 Ga0105237_10001163 3300009545 Bacteria 35190
100 Ga0105237_10012187 3300009545 Bacteria 9067
101 Ga0105237_10012993 3300009545 Bacteria 8743
102 Ga0105237_10063893 3300009545 Bacteria 3678
103 Ga0105237_10118276 3300009545 Bacteria 2644
104 Ga0105238_10003552 3300009551 Bacteria 15544
105 Ga0105238_10012224 3300009551 Bacteria 8656
106 Ga0105238_10013326 3300009551 Bacteria 8296
107 Ga0105238_10033679 3300009551 Bacteria 5212
108 Ga0105238_10202657 3300009551 Bacteria 1960
109 Ga0105249_10046522 3300009553 Bacteria 3949
110 Ga0105239_10017593 3300010375 Bacteria 7905
111 Ga0105239_10022381 3300010375 Bacteria 6968
112 Ga0105239_10073080 3300010375 Bacteria 3770
113 Ga0157374_10000030 3300013296 Bacteria 211102
114 Ga0157374_10016542 3300013296 Bacteria 6486
115 Ga0157374_10176228 3300013296 Bacteria 2087
116 Ga0157375_10001676 3300013308 Bacteria 19069
117 Ga0157375_10068382 3300013308 Bacteria 3554
118 Ga0157375_10114377 3300013308 Unclassified 2800
119 Ga0163163_10000038 3300014325 Bacteria 154457
120 Ga0182008_10013005 3300014497 Bacteria 4379
121 Ga0157376_10000110 3300014969 Bacteria 58480
122 Ga0182007_10019254 3300015262 Bacteria 2457
123 Ga0209026_1000029 3300025250 Bacteria 337109
124 Ga0209759_1000393 3300025256 Bacteria 54357
125 Ga0209050_1000733 3300025298 Bacteria 47706
126 Ga0207647_10019753 3300025904 Bacteria 4526
127 Ga0207645_10016365 3300025907 Bacteria 4910
128 Ga0207684_10006140 3300025910 Bacteria 10985
129 Ga0207684_10031174 3300025910 Bacteria 4537
130 Ga0207695_10012876 3300025913 Bacteria 10012
131 Ga0207671_10008743 3300025914 Bacteria 8533
132 Ga0207671_10066276 3300025914 Bacteria 2687
133 Ga0207662_10004665 3300025918 Bacteria 7232
134 Ga0207662_10023269 3300025918 Bacteria 3558
135 Ga0207662_10042672 3300025918 Bacteria 2674
136 Ga0207652_10001028 3300025921 Bacteria 25593
137 Ga0207646_10003241 3300025922 Bacteria 18549
138 Ga0207681_10007298 3300025923 Bacteria 6772
139 Ga0207694_10001684 3300025924 Bacteria 18531
140 Ga0207694_10004759 3300025924 Bacteria 10554
141 Ga0207694_10013233 3300025924 Bacteria 6212
142 Ga0207644_10035794 3300025931 Bacteria 3481
143 Ga0207706_10175165 3300025933 Bacteria 1884
144 Ga0207670_10055857 3300025936 Bacteria 2670
145 Ga0207669_10000726 3300025937 Bacteria 14264
146 Ga0207704_10018552 3300025938 Bacteria 3634
147 Ga0207691_10013975 3300025940 Bacteria 7659
148 Ga0207691_10020029 3300025940 Bacteria 6328
149 Ga0207691_10159565 3300025940 Bacteria 1979
150 Ga0207689_10029632 3300025942 Bacteria 4568
151 Ga0207689_10111225 3300025942 Bacteria 2251
152 Ga0207661_10020573 3300025944 Bacteria 4935
153 Ga0207661_10031039 3300025944 Bacteria 4123
154 Ga0207667_10029418 3300025949 Bacteria 5958
155 Ga0207651_10040404 3300025960 Bacteria 3086
156 Ga0207639_10017602 3300026041 Bacteria 5068
157 Ga0207639_10052215 3300026041 Bacteria 3114
158 Ga0207639_10128443 3300026041 Bacteria 2094
159 Ga0207678_10025316 3300026067 Bacteria 5180
160 Ga0207708_10006088 3300026075 Bacteria 8947
161 Ga0207708_10011976 3300026075 Bacteria 6462
162 Ga0207702_10193031 3300026078 Bacteria 1883
163 Ga0207641_10090848 3300026088 Bacteria 2671
164 Ga0207641_10128845 3300026088 Bacteria 2269
165 Ga0207648_10008504 3300026089 Bacteria 9933
166 Ga0207648_10009528 3300026089 Bacteria 9294
167 Ga0207674_10012421 3300026116 Bacteria 9516
168 Ga0207674_10189847 3300026116 Bacteria 2004
169 Ga0207675_100018015 3300026118 Bacteria 6587
170 Ga0207675_100018051 3300026118 Bacteria 6580
171 Ga0207675_100049279 3300026118 Bacteria 3931
172 Ga0207675_100101795 3300026118 Bacteria 2706
173 Ga0207683_10088507 3300026121 Bacteria 2755
174 Ga0207698_10117984 3300026142 Bacteria 2240
175 Ga0209813_10001190 3300027866 Bacteria 5801
176 Ga0207428_10000309 3300027907 Bacteria 64761
177 Ga0207428_10005580 3300027907 Bacteria 11701
178 Ga0268266_10053410 3300028379 Bacteria 3471
179 Ga0268265_10120941 3300028380 Bacteria 2157
180 Ga0265319_1007533 3300028563 Bacteria 4881
181 Ga0265318_10000033 3300028577 Bacteria 143214
182 Ga0265318_10000634 3300028577 Bacteria 24168
183 Ga0265338_10003104 3300028800 Bacteria 23782
184 Ga0265338_10054686 3300028800 Bacteria 3557
185 Ga0265330_10000029 3300031235 Bacteria 138185
186 Ga0265330_10004513 3300031235 Bacteria 7058
187 Ga0265332_10000822 3300031238 Bacteria 18842
188 Ga0265332_10002159 3300031238 Bacteria 10144
189 Ga0265328_10000581 3300031239 Bacteria 16927
190 Ga0265328_10001007 3300031239 Bacteria 12941
191 Ga0265328_10007964 3300031239 Bacteria 4394
192 Ga0265320_10000294 3300031240 Bacteria 40603
193 Ga0265320_10005335 3300031240 Bacteria 8267
194 Ga0265320_10014561 3300031240 Bacteria 4471
195 Ga0265320_10025372 3300031240 Bacteria 3116
196 Ga0265329_10032394 3300031242 Bacteria 1693
197 Ga0265339_10047699 3300031249 Bacteria 2351
198 Ga0265331_10000079 3300031250 Bacteria 138758
199 Ga0265331_10000515 3300031250 Bacteria 36222
200 Ga0265316_10000643 3300031344 Bacteria 38832
201 Ga0265313_10000344 3300031595 Bacteria 50468
202 Ga0265313_10024623 3300031595 Bacteria 3211
203 Ga0265313_10027905 3300031595 Bacteria 2947
204 Ga0265314_10001235 3300031711 Bacteria 29148
205 Ga0265314_10002236 3300031711 Bacteria 20109
206 Ga0265314_10019257 3300031711 Bacteria 5292
207 Ga0265314_10036061 3300031711 Bacteria 3598
208 Ga0265342_10000127 3300031712 Bacteria 84774
209 Ga0265342_10002572 3300031712 Bacteria 15541
210 Ga0373943_0015016 3300035170 Bacteria 3515
211 Ga0373955_0080498 3300035172 Bacteria 1840
212 Ga0373927_0000058 3300035695 Bacteria 80217
213 Ga0373937_0007714 3300036401 Bacteria 9326
214 Ga0373925_0014167 3300037068 Bacteria 5771
215 Ga0373925_0125164 3300037068 Bacteria 1999
216 Ga0373925_0149043 3300037068 Bacteria 1836
217 Ga0395900_0038726 3300037418 Bacteria 4914
218 Ga0395905_0001069 3300037471 Bacteria 34516
219 Ga0395905_0038753 3300037471 Bacteria 4470
220 Ga0395905_0201288 3300037471 Bacteria 1867
221 Ga0439458_0010118 3300042157 Bacteria 2101
222 Ga0466969_0000807 3300044656 Bacteria 17009
223 Ga0466972_0004520 3300044658 Bacteria 6965
224 Ga0453684_0000001 3300044712 Bacteria 2623166
225 Ga0466968_0009319 3300044735 Bacteria 3777
226 Ga0466960_0037442 3300044901 Bacteria 2275
227 Ga0451576_0007242 3300045051 Bacteria 13356
228 Ga0451576_0043431 3300045051 Bacteria 4743
229 Ga0495629_0063596 3300046459 Unclassified 2577
230 Ga0495638_0087881 3300046460 Bacteria 1877
231 Ga0495662_0002977 3300046476 Bacteria 8550
232 Ga0495664_0022917 3300046477 Bacteria 3622
233 Ga0495630_0000040 3300046517 Bacteria 106232
234 Ga0495643_0000331 3300046522 Bacteria 64586
235 Ga0495666_0015612 3300046526 Unclassified 3780
236 Ga0495640_0037316 3300046533 Bacteria 3428
237 Ga0495586_0000018 3300046535 Bacteria 112658
238 Ga0495586_0047431 3300046535 Bacteria 2319
239 Ga0495634_0003184 3300046642 Bacteria 13281
240 Ga0495634_0022108 3300046642 Bacteria 4484
241 Ga0495599_0006081 3300046678 Bacteria 7266
242 Ga0495669_0013445 3300046684 Bacteria 3488
243 Ga0495581_0056727 3300047315 Unclassified 2261
244 Ga0495674_0000489 3300047319 Bacteria 36129
245 Ga0495674_0053273 3300047319 Bacteria 3557
246 Ga0495676_0002071 3300047321 Bacteria 17657
247 Ga0496100_0077849 3300048903 Bacteria 2231
248 Ga0496101_0021246 3300048904 Bacteria 4458
249 Ga0496104_0082633 3300048907 Bacteria 3063
250 Ga0496106_0029017 3300048909 Bacteria 4123
251 Ga0496107_0173889 3300048910 Bacteria 1598
252 Ga0496108_0083412 3300048911 Bacteria 2711
253 Ga0496112_0002261 3300048915 Bacteria 15391
254 Ga0496112_0133305 3300048915 Bacteria 2455
255 Ga0496114_0000066 3300048917 Bacteria 76456
256 Ga0496114_0002032 3300048917 Bacteria 15398
257 Ga0496114_0075602 3300048917 Bacteria 2837
258 Ga0496115_0032855 3300048918 Bacteria 4096
259 Ga0496119_0014356 3300048922 Bacteria 6207
260 Ga0496119_0040013 3300048922 Bacteria 3005
261 Ga0496120_0002399 3300048923 Bacteria 19066
262 Ga0496121_0156043 3300048924 Bacteria 1675
263 Ga0496126_0030496 3300048929 Bacteria 5108
264 Ga0501034_0004782 3300049571 Bacteria 14985
265 Ga0501046_0003357 3300049580 Bacteria 14703
266 Ga0501046_0019496 3300049580 Bacteria 5626
267 Ga0501047_0118406 3300049581 Unclassified 2530
268 Ga0501048_0010178 3300049582 Bacteria 7033
269 Ga0501067_0004642 3300049583 Bacteria 7611
270 Ga0501070_0000513 3300049586 Bacteria 35492
271 Ga0501044_0041548 3300049823 Unclassified 4788
272 Ga0501044_0049047 3300049823 Bacteria 4358
273 nmdc:mga00v17_13806_c1 3300050491 Bacteria 4492
274 nmdc:mga0yw44_29553_c2 3300050492 Bacteria 1837
275 nmdc:mga0k408_2715_c1 3300050493 Bacteria 9393
276 nmdc:mga0k408_50707_c1 3300050493 Bacteria 2403
277 nmdc:mga06z11_5820_c1 3300050494 Bacteria 4974
278 nmdc:mga04h51_1243_c1 3300050495 Bacteria 5897
279 nmdc:mga05p37_37381_c1 3300050507 Bacteria 5952
280 nmdc:mga05p37_85804_c1 3300050507 Bacteria 3880
281 nmdc:mga09592_17220_c1 3300050508 Bacteria 5918
282 nmdc:mga09592_206533_c1 3300050508 Bacteria 1701
283 nmdc:mga06r32_100989_c1 3300050510 Bacteria 2831
284 nmdc:mga08y16_17336_c1 3300050511 Bacteria 7582
285 nmdc:mga08y16_4461_c1 3300050511 Bacteria 14635
286 nmdc:mga0n895_85902_c1 3300050512 Bacteria 3142
287 nmdc:mga0rr50_25713_c1 3300050513 Bacteria 4097
288 nmdc:mga0rr50_62751_c1 3300050513 Bacteria 2804
289 nmdc:mga08x19_58064_c1 3300050514 Bacteria 2502
290 nmdc:mga0a205_150632_c1 3300050515 Bacteria 2226
291 Ga0500562_014085 3300053108 Bacteria 2046
292 Ga0500616_0003268 3300053153 Bacteria 12513
293 Ga0500616_0003660 3300053153 Bacteria 11529
294 Ga0500620_000818 3300053155 Bacteria 5415
295 Ga0500622_0005735 3300053156 Bacteria 7377
296 2509394826 2509276022 Bacteria 6200534
297 2512960642 2512875024 Bacteria 7195110
298 2513608739 2513237090 Bacteria 7096802
299 2514036273 2513237164 Bacteria 7563725
300 2547370914 2547132103 Bacteria 5115736
301 2599936486 2599185301 Bacteria 6161860
302 2673165214 2671180531 Bacteria 9045424
303 2688069578 2687453257 Bacteria 6784659
304 2756671446 2756170246 Bacteria 7451806
305 2788433582 2786546940 Bacteria 6396474
306 2843692628 2843690924 Bacteria 5169057
307 2856323022 2856320880 Bacteria 7263508
308 2856367980 2856364286 Bacteria 6939991
309 2857351898 2857349434 Bacteria 7926032
310 2869282573 2869278585 Bacteria 7077053
311 2869290401 2869285874 Bacteria 6901219
312 2871432685 2871429161 Bacteria 6547891
313 2871469187 2871466892 Bacteria 6923287
314 2874152652 2874146452 Bacteria 7533118
315 2874160052 2874155637 Bacteria 6724144
316 2874171027 2874168670 Bacteria 8062617
317 2876418568 2876413966 Bacteria 6831344
318 2878744587 2878738818 Bacteria 7136951
319 2878750299 2878745973 Bacteria 6867388
320 2883293270 2883291878 Bacteria 5894118
321 2883356221 2883354860 Bacteria 5865246
322 2889418184 2889415604 Bacteria 8048700
323 2903500033 2903492973 Bacteria 13473544
324 2906312657 2906308376 Bacteria 6841989
325 2906325366 2906321335 Bacteria 6579571
326 2906383126 2906378014 Bacteria 6911440
327 2909043548 2909042592 Bacteria 6499737
328 2920114407 2920107658 Bacteria 10042636
329 2924782617 2924776078 Bacteria 7492003
330 2937819198 2937813078 Bacteria 7783518
331 2937827745 2937822353 Bacteria 7290551
332 2937881260 2937877337 Bacteria 7246526
333 2937977350 2937972304 Bacteria 7532020
334 2958039356 2958034702 Bacteria 6989922
335 2958042048 2958041894 Bacteria 13082850
336 2958053016 2958041894 Bacteria 13082850
337 2958070627 2958064165 Bacteria 7158582
338 2958088183 2958084443 Bacteria 7312792
339 2958134789 2958130278 Bacteria 6897202
340 2958147011 2958144490 Bacteria 6677056
341 2958186431 2958179912 Bacteria 6874908
342 2961084930 2961077736 Bacteria 7079850
343 2968020683 2968016561 Bacteria 7022047
344 2968119220 2968117919 Bacteria 6536078
345 2970473980 2970469710 Bacteria 6969209
346 2970597182 2970593180 Bacteria 7073582
347 2977848445 2977843712 Bacteria 6753583
348 2977944853 2977942078 Bacteria 7570577
349 2987639082 2987636660 Bacteria 8088555
350 3004204675 3004203850 Bacteria 7307914
351 3004289672 3004289098 Bacteria 6135450
352 3004335843 3004334049 Bacteria 8449246
353 8004392607 8004387939 Bacteria 7049250
354 8004645215 8004640170 Bacteria 6723001
355 8004718916 8004714634 Bacteria 6776161
356 Ga0105249_10039065
357 JGI24739J22299_10005537
358 JGI25157J39369_1000502
359 rootL2_10020137
360 rootH1_10000064
361 rootH1_10051731
362 Ga0070658_10007440
363 Ga0070676_10008606
364 Ga0070683_100028197
365 Ga0070690_100013217
366 Ga0070666_10082946
367 Ga0070680_100056377
368 Ga0068868_100054458
369 Ga0068868_100062322
370 Ga0068868_100159328
371 Ga0070689_100000001
372 Ga0070689_100006572
373 Ga0070689_100059094
374 Ga0070687_100004458
375 Ga0070687_100022633
376 Ga0070668_100054432
377 Ga0070669_100004920
378 Ga0070675_100053367
379 Ga0070671_100001713
380 Ga0070674_100037216
381 Ga0070673_100020202
382 Ga0070673_100063990
383 Ga0070673_100081399
384 Ga0070708_100023406
385 Ga0070708_100106178
386 Ga0070662_100109944
387 Ga0070681_10026440
388 Ga0070681_10167532
389 Ga0068867_100113814
390 Ga0070685_10059712
391 Ga0070706_100002969
392 Ga0070706_100023950
393 Ga0070706_100167982
394 Ga0070707_100017690
395 Ga0070698_100013851
396 Ga0070698_100032211
397 Ga0070698_100072777
398 Ga0070698_100090966
399 Ga0070699_100002253
400 Ga0070679_100085198
401 Ga0070684_100003684
402 Ga0070684_100003710
403 Ga0070697_100107459
404 Ga0068853_100007265
405 Ga0070672_100006434
406 Ga0070672_100046547
407 Ga0070672_100082090
408 Ga0070696_100060157
409 Ga0070665_100040588
410 Ga0068855_100007348
411 Ga0068855_100033902
412 Ga0068855_100084707
413 Ga0068855_100152463
414 Ga0070702_100105727
415 Ga0068859_100002898
416 Ga0068866_10081412
417 Ga0068861_100003626
418 Ga0068861_100043678
419 Ga0068861_100131943
420 Ga0068863_100026502
421 Ga0068863_100056571
422 Ga0068863_100145164
423 Ga0068858_100041712
424 Ga0068858_100041979
425 Ga0068860_100047631
426 Ga0068862_100022249
427 Ga0068862_100076670
428 Ga0081540_1014907
429 Ga0081539_10001521
430 Ga0075365_10001944
431 Ga0075365_10112408
432 Ga0075368_10035650
433 Ga0075364_10013311
434 Ga0075362_10000833
435 Ga0075367_10014500
436 Ga0075366_10029502
437 Ga0075428_100069396
438 Ga0075428_100207020
439 Ga0075431_100015217
440 Ga0075433_10132184
441 Ga0075429_100043136
442 Ga0097620_100002898
443 Ga0075435_100017046
444 Ga0105240_10002249
445 Ga0105240_10224983
446 Ga0111539_10001232
447 Ga0111539_10026273
448 Ga0111539_10056887
449 Ga0105245_10049086
450 Ga0114129_10038869
451 Ga0114129_10136079
452 Ga0105243_10042459
453 Ga0105248_10115545
454 Ga0105237_10001163
455 Ga0105237_10012187
456 Ga0105237_10012993
457 Ga0105237_10063893
458 Ga0105237_10118276
459 Ga0105238_10003552
460 Ga0105238_10012224
461 Ga0105238_10013326
462 Ga0105238_10033679
463 Ga0105238_10202657
464 Ga0105249_10046522
465 Ga0105239_10017593
466 Ga0105239_10022381
467 Ga0105239_10073080
468 Ga0157374_10000030
469 Ga0157374_10016542
470 Ga0157374_10176228
471 Ga0157375_10001676
472 Ga0157375_10068382
473 Ga0157375_10114377
474 Ga0163163_10000038
475 Ga0182008_10013005
476 Ga0157376_10000110
477 Ga0182007_10019254
478 Ga0209026_1000029
479 Ga0209759_1000393
480 Ga0209050_1000733
481 Ga0207647_10019753
482 Ga0207645_10016365
483 Ga0207684_10006140
484 Ga0207684_10031174
485 Ga0207695_10012876
486 Ga0207671_10008743
487 Ga0207671_10066276
488 Ga0207662_10004665
489 Ga0207662_10023269
490 Ga0207662_10042672
491 Ga0207652_10001028
492 Ga0207646_10003241
493 Ga0207681_10007298
494 Ga0207694_10001684
495 Ga0207694_10004759
496 Ga0207694_10013233
497 Ga0207644_10035794
498 Ga0207706_10175165
499 Ga0207670_10055857
500 Ga0207669_10000726
501 Ga0207704_10018552
502 Ga0207691_10013975
503 Ga0207691_10020029
504 Ga0207691_10159565
505 Ga0207689_10029632
506 Ga0207689_10111225
507 Ga0207661_10020573
508 Ga0207661_10031039
509 Ga0207667_10029418
510 Ga0207651_10040404
511 Ga0207639_10017602
512 Ga0207639_10052215
513 Ga0207639_10128443
514 Ga0207678_10025316
515 Ga0207708_10006088
516 Ga0207708_10011976
517 Ga0207702_10193031
518 Ga0207641_10090848
519 Ga0207641_10128845
520 Ga0207648_10008504
521 Ga0207648_10009528
522 Ga0207674_10012421
523 Ga0207674_10189847
524 Ga0207675_100018015
525 Ga0207675_100018051
526 Ga0207675_100049279
527 Ga0207675_100101795
528 Ga0207683_10088507
529 Ga0207698_10117984
530 Ga0209813_10001190
531 Ga0207428_10000309
532 Ga0207428_10005580
533 Ga0268266_10053410
534 Ga0268265_10120941
535 Ga0265319_1007533
536 Ga0265318_10000033
537 Ga0265318_10000634
538 Ga0265338_10003104
539 Ga0265338_10054686
540 Ga0265330_10000029
541 Ga0265330_10004513
542 Ga0265332_10000822
543 Ga0265332_10002159
544 Ga0265328_10000581
545 Ga0265328_10001007
546 Ga0265328_10007964
547 Ga0265320_10000294
548 Ga0265320_10005335
549 Ga0265320_10014561
550 Ga0265320_10025372
551 Ga0265329_10032394
552 Ga0265339_10047699
553 Ga0265331_10000079
554 Ga0265331_10000515
555 Ga0265316_10000643
556 Ga0265313_10000344
557 Ga0265313_10024623
558 Ga0265313_10027905
559 Ga0265314_10001235
560 Ga0265314_10002236
561 Ga0265314_10019257
562 Ga0265314_10036061
563 Ga0265342_10000127
564 Ga0265342_10002572
565 Ga0373943_0015016
566 Ga0373955_0080498
567 Ga0373927_0000058
568 Ga0373937_0007714
569 Ga0373925_0014167
570 Ga0373925_0125164
571 Ga0373925_0149043
572 Ga0395900_0038726
573 Ga0395905_0001069
574 Ga0395905_0038753
575 Ga0395905_0201288
576 Ga0439458_0010118
577 Ga0466969_0000807
578 Ga0466972_0004520
579 Ga0453684_0000001
580 Ga0466968_0009319
581 Ga0466960_0037442
582 Ga0451576_0007242
583 Ga0451576_0043431
584 Ga0495629_0063596
585 Ga0495638_0087881
586 Ga0495662_0002977
587 Ga0495664_0022917
588 Ga0495630_0000040
589 Ga0495643_0000331
590 Ga0495666_0015612
591 Ga0495640_0037316
592 Ga0495586_0000018
593 Ga0495586_0047431
594 Ga0495634_0003184
595 Ga0495634_0022108
596 Ga0495599_0006081
597 Ga0495669_0013445
598 Ga0495581_0056727
599 Ga0495674_0000489
600 Ga0495674_0053273
601 Ga0495676_0002071
602 Ga0496100_0077849
603 Ga0496101_0021246
604 Ga0496104_0082633
605 Ga0496106_0029017
606 Ga0496107_0173889
607 Ga0496108_0083412
608 Ga0496112_0002261
609 Ga0496112_0133305
610 Ga0496114_0000066
611 Ga0496114_0002032
612 Ga0496114_0075602
613 Ga0496115_0032855
614 Ga0496119_0014356
615 Ga0496119_0040013
616 Ga0496120_0002399
617 Ga0496121_0156043
618 Ga0496126_0030496
619 Ga0501034_0004782
620 Ga0501046_0003357
621 Ga0501046_0019496
622 Ga0501047_0118406
623 Ga0501048_0010178
624 Ga0501067_0004642
625 Ga0501070_0000513
626 Ga0501044_0041548
627 Ga0501044_0049047
628 nmdc:mga00v17_13806_c1
629 nmdc:mga0yw44_29553_c2
630 nmdc:mga0k408_2715_c1
631 nmdc:mga0k408_50707_c1
632 nmdc:mga06z11_5820_c1
633 nmdc:mga04h51_1243_c1
634 nmdc:mga05p37_37381_c1
635 nmdc:mga05p37_85804_c1
636 nmdc:mga09592_17220_c1
637 nmdc:mga09592_206533_c1
638 nmdc:mga06r32_100989_c1
639 nmdc:mga08y16_17336_c1
640 nmdc:mga08y16_4461_c1
641 nmdc:mga0n895_85902_c1
642 nmdc:mga0rr50_25713_c1
643 nmdc:mga0rr50_62751_c1
644 nmdc:mga08x19_58064_c1
645 nmdc:mga0a205_150632_c1
646 Ga0500562_014085
647 Ga0500616_0003268
648 Ga0500616_0003660
649 Ga0500620_000818
650 Ga0500622_0005735
651 2509394826
652 2512960642
653 2513608739
654 2514036273
655 2547370914
656 2599936486
657 2673165214
658 2688069578
659 2756671446
660 2788433582
661 2843692628
662 2856323022
663 2856367980
664 2857351898
665 2869282573
666 2869290401
667 2871432685
668 2871469187
669 2874152652
670 2874160052
671 2874171027
672 2876418568
673 2878744587
674 2878750299
675 2883293270
676 2883356221
677 2889418184
678 2903500033
679 2906312657
680 2906325366
681 2906383126
682 2909043548
683 2920114407
684 2924782617
685 2937819198
686 2937827745
687 2937881260
688 2937977350
689 2958039356
690 2958042048
691 2958053016
692 2958070627
693 2958088183
694 2958134789
695 2958147011
696 2958186431
697 2961084930
698 2968020683
699 2968119220
700 2970473980
701 2970597182
702 2977848445
703 2977944853
704 2987639082
705 3004204675
706 3004289672
707 3004335843
708 8004392607
709 8004645215
710 8004718916

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00324

AA_permease

Amino acid permease

99

515

0.83

PF13520

AA_permease_2

Amino acid permease

89

535

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
6f2g-assembly1.cif.gz_A bacterial asc transporter crystal structure in open to in conformation 0.8518 35 479
6f34-assembly1.cif.gz_A crystal structure of a bacterial cationic amino acid transporter (cat) homologue bound to arginine. 0.8423 24 477
6f2g-assembly1.cif.gz_A bacterial asc transporter crystal structure in open to in conformation 0.8226 35 479
3ob6-assembly1.cif.gz_A structure of adic(n101a) in the open-to-out arg+ bound conformation 0.8199 25 491
5j4i-assembly1.cif.gz_A crystal structure of the l-arginine/agmatine antiporter from e. coli at 2.2 angstroem resolution 0.819 26 491
ID Description Score Start End Superfamily
af_O60113_56_528_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9193 24 487 1.20.1740.10
af_B9EWF0_29_508_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9125 23 479 1.20.1740.10
af_Q9UT18_73_572_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9046 24 484 1.20.1740.10
af_P32837_68_548_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9035 23 490 1.20.1740.10
af_Q09887_36_510_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9024 23 486 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A3S0TSS8-F1-model_v4 Amino acid permease 0.9798 10 511 GO:0016020
GO:0022857
AF-A0A345D7V3-F1-model_v4 Putrescine importer PuuP 0.978 7 489 GO:0016020
GO:0022857
AF-D7DP17-F1-model_v4 Amino acid permease-associated region 0.9766 7 488 GO:0016020
GO:0022857
AF-A0A6G6X458-F1-model_v4 Amino acid permease 0.9739 18 509 GO:0016020
GO:0022857
AF-A0A7Y5NM71-F1-model_v4 Amino acid permease 0.9732 28 491 GO:0016020
GO:0022857

Map