F420146

General Info

Members Datasets Scaffolds Average Seq Length
355 225 710 337

Family's Representative Sequence

Representative Sequence 3300025261|Ga0209233_1001631|Ga0209233_10016317
Length 382
Sequence MEYGPTIGAGGEPVPDVVRGQGRGGARPHRQFQNHWEDFMGRLNFARAAICGVVFAGLMGATAAYADGAVVGLITKTEGNPFFVKMREGAQAEATKLGLTLKTYAGKFDGDNDSQVAAIEDLIAAGAKGFAIVPSDSSAIVPTIKKARDAGLLVIDLDTPTDPITAVDATFATDNFKAGNLIGAWAKGTLGDKAASAKIAFLDLATNQPTVDYLRDQGFMQGFGIDIKDPKKYGDEDDKRICGHEMTGGAEDGGRTAMETLLQKCPDVNVMYTINEPAAAGGYQALKAAGKDDGSVLVVSIDGGCPGVKNVGAGVIGATSQQYPLKMAAMAMDAIAAFAKDGTKPTVPEAGFIDTGATLITDKPVAGVQSITSAEGLKICWG

Samples

Sample ID Description Type Environment
1 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
65 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
66 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
67 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
104 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
105 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
106 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
107 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
108 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
109 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
110 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
111 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
112 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
113 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
114 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
115 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
116 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
117 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
118 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
119 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
120 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
121 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
122 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
123 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
124 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
125 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
126 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
127 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
134 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
135 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
136 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
137 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
138 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
139 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
140 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
141 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
142 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
143 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
144 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
145 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
146 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
152 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
153 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
154 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
168 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
169 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
170 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
171 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
172 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
173 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
174 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
175 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
177 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
178 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
179 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
180 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
181 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
182 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
183 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300059609 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 227R_SD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300059629 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
215 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
216 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
217 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
218 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
219 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
220 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
221 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
222 2932401849 Devosia sp. 2618 Isolate Rhizosphere
223 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
224 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
225 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 80.56
Metatranscriptomes 16.06
Isolates 3.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.54
Nodule 0.85
Rhizoplane 2.82
Rhizosphere 83.94
Stem 0
Stem Tuber 0
Unclassified 0.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209233_1001631 3300025261 Bacteria 8730
2 JGI25156J39149_1005825 3300002705 Bacteria 3482
3 JGI25157J39369_1001027 3300002741 Bacteria 12885
4 JGI25406J46586_10004820 3300003203 Bacteria 6272
5 JGI25406J46586_10012758 3300003203 Bacteria 3632
6 JGI25406J46586_10035576 3300003203 Bacteria 1817
7 JGI25165J46597_1000016 3300003214 Bacteria 377866
8 Ga0007409J51694_1015741 3300003575 Bacteria 1743
9 Ga0007409J51694_1022246 3300003575 Bacteria 1136
10 Ga0007409J51694_1043664 3300003575 Bacteria 1206
11 Ga0058863_10002528 3300004799 Bacteria 1233
12 Ga0058863_11941704 3300004799 Bacteria 1224
13 Ga0058861_11870310 3300004800 Bacteria 1224
14 Ga0070658_10002384 3300005327 Bacteria 15783
15 Ga0070658_10068797 3300005327 Bacteria 2895
16 Ga0070658_10146122 3300005327 Bacteria 1977
17 Ga0070660_100073407 3300005339 Bacteria 2675
18 Ga0070660_100074904 3300005339 Bacteria 2649
19 Ga0070661_100002956 3300005344 Bacteria 11725
20 Ga0070661_100177155 3300005344 Bacteria 1621
21 Ga0070668_100029857 3300005347 Bacteria 4142
22 Ga0070668_100068027 3300005347 Bacteria 2768
23 Ga0070669_100185642 3300005353 Bacteria 1629
24 Ga0070673_100231990 3300005364 Bacteria 1601
25 Ga0070659_100025829 3300005366 Bacteria 4517
26 Ga0070659_100045728 3300005366 Bacteria 3430
27 Ga0070659_100221008 3300005366 Bacteria 1563
28 Ga0070667_100026653 3300005367 Bacteria 4808
29 Ga0070667_100180147 3300005367 Bacteria 1868
30 Ga0070700_100117411 3300005441 Bacteria 1778
31 Ga0070663_100007652 3300005455 Bacteria 6590
32 Ga0070678_100227081 3300005456 Bacteria 1554
33 Ga0070681_10138204 3300005458 Bacteria 2366
34 Ga0070699_100245579 3300005518 Bacteria 1599
35 Ga0068853_100112447 3300005539 Bacteria 2420
36 Ga0070665_100025941 3300005548 Bacteria 5902
37 Ga0070665_100256309 3300005548 Bacteria 1750
38 Ga0070704_100198708 3300005549 Bacteria 1617
39 Ga0068855_100043568 3300005563 Bacteria 5315
40 Ga0068854_100056539 3300005578 Bacteria 2828
41 Ga0068854_100126131 3300005578 Bacteria 1949
42 Ga0068856_100029490 3300005614 Bacteria 5359
43 Ga0068852_100005219 3300005616 Bacteria 9263
44 Ga0068852_100476599 3300005616 Bacteria 1239
45 Ga0068859_100050436 3300005617 Bacteria 4180
46 Ga0068866_10039864 3300005718 Bacteria 2322
47 Ga0068861_100253545 3300005719 Bacteria 1502
48 Ga0068861_100261233 3300005719 Bacteria 1482
49 Ga0068870_10021921 3300005840 Bacteria 3133
50 Ga0068863_100236377 3300005841 Bacteria 1763
51 Ga0068862_100084954 3300005844 Bacteria 2750
52 Ga0081540_1029022 3300005983 Bacteria 3091
53 Ga0081539_10000625 3300005985 Bacteria 71667
54 Ga0081539_10000637 3300005985 Bacteria 70993
55 Ga0081539_10003049 3300005985 Bacteria 21640
56 Ga0081539_10003444 3300005985 Bacteria 19435
57 Ga0081539_10011727 3300005985 Bacteria 6874
58 Ga0081539_10011985 3300005985 Bacteria 6757
59 Ga0081539_10074995 3300005985 Bacteria 1799
60 Ga0075365_10054896 3300006038 Bacteria 2643
61 Ga0070715_10027339 3300006163 Bacteria 2279
62 Ga0070712_100220412 3300006175 Bacteria 1501
63 Ga0068865_100019996 3300006881 Bacteria 4339
64 Ga0097620_100050436 3300006931 Bacteria 4180
65 Ga0105240_10116036 3300009093 Bacteria 3231
66 Ga0105240_10512028 3300009093 Bacteria 1333
67 Ga0111539_10141357 3300009094 Bacteria 2818
68 Ga0105241_10070558 3300009174 Bacteria 2711
69 Ga0105242_10085276 3300009176 Bacteria 2648
70 Ga0105248_10106197 3300009177 Bacteria 3166
71 Ga0105237_10001906 3300009545 Bacteria 26600
72 Ga0105238_10028901 3300009551 Bacteria 5648
73 Ga0105238_10033342 3300009551 Bacteria 5242
74 Ga0105239_10095224 3300010375 Bacteria 3289
75 Ga0105239_10547420 3300010375 Bacteria 1318
76 Ga0105246_10126819 3300011119 Bacteria 1900
77 Ga0157371_10013041 3300013102 Bacteria 6328
78 Ga0157371_10052221 3300013102 Bacteria 2903
79 Ga0157370_10009366 3300013104 Bacteria 10474
80 Ga0157370_10013336 3300013104 Bacteria 8465
81 Ga0157370_10411834 3300013104 Bacteria 1244
82 Ga0157369_10019547 3300013105 Bacteria 7579
83 Ga0157369_10104502 3300013105 Bacteria 3016
84 Ga0157369_10214144 3300013105 Bacteria 2018
85 Ga0157374_10032892 3300013296 Bacteria 4727
86 Ga0157372_10128722 3300013307 Bacteria 2911
87 Ga0157372_10449512 3300013307 Bacteria 1502
88 Ga0157372_10456826 3300013307 Bacteria 1489
89 Ga0163163_10085665 3300014325 Bacteria 3159
90 Ga0157379_10373573 3300014968 Bacteria 1307
91 Ga0182005_1025826 3300015265 Bacteria 1603
92 Ga0163161_10093954 3300017792 Bacteria 2223
93 Ga0206356_10938532 3300020070 Bacteria 1758
94 Ga0206356_11281493 3300020070 Bacteria 1150
95 Ga0206351_10089958 3300020077 Bacteria 1340
96 Ga0206351_10760914 3300020077 Bacteria 1198
97 Ga0206352_10445410 3300020078 Bacteria 1246
98 Ga0206352_10532224 3300020078 Bacteria 1523
99 Ga0206352_11166553 3300020078 Bacteria 1220
100 Ga0206350_10552220 3300020080 Bacteria 1133
101 Ga0209026_1000005 3300025250 Bacteria 731387
102 Ga0209759_1000106 3300025256 Bacteria 149959
103 Ga0209233_1000068 3300025261 Bacteria 377969
104 Ga0209025_1076526 3300025294 Bacteria 1159
105 Ga0207642_10162150 3300025899 Bacteria 1201
106 Ga0207688_10045019 3300025901 Bacteria 2461
107 Ga0207647_10027394 3300025904 Bacteria 3715
108 Ga0207685_10118503 3300025905 Bacteria 1158
109 Ga0207645_10117316 3300025907 Bacteria 1726
110 Ga0207643_10033378 3300025908 Bacteria 2879
111 Ga0207705_10003617 3300025909 Bacteria 11774
112 Ga0207705_10083427 3300025909 Bacteria 2331
113 Ga0207684_10072784 3300025910 Bacteria 2919
114 Ga0207654_10113149 3300025911 Bacteria 1692
115 Ga0207695_10043453 3300025913 Bacteria 4789
116 Ga0207695_10117850 3300025913 Bacteria 2627
117 Ga0207671_10000168 3300025914 Bacteria 100117
118 Ga0207671_10251866 3300025914 Bacteria 1388
119 Ga0207657_10003579 3300025919 Bacteria 16574
120 Ga0207657_10074907 3300025919 Bacteria 2857
121 Ga0207657_10320489 3300025919 Bacteria 1226
122 Ga0207649_10013572 3300025920 Bacteria 4550
123 Ga0207652_10247985 3300025921 Bacteria 1606
124 Ga0207694_10013184 3300025924 Bacteria 6223
125 Ga0207706_10086365 3300025933 Bacteria 2758
126 Ga0207686_10071337 3300025934 Bacteria 2235
127 Ga0207669_10117933 3300025937 Bacteria 1795
128 Ga0207691_10078229 3300025940 Bacteria 2977
129 Ga0207689_10005049 3300025942 Bacteria 11894
130 Ga0207689_10030336 3300025942 Bacteria 4506
131 Ga0207679_10063067 3300025945 Bacteria 2765
132 Ga0207667_10008878 3300025949 Bacteria 11896
133 Ga0207667_10023438 3300025949 Bacteria 6797
134 Ga0207712_10007694 3300025961 Bacteria 6813
135 Ga0207668_10006469 3300025972 Bacteria 6927
136 Ga0207640_10061579 3300025981 Bacteria 2486
137 Ga0207658_10064346 3300025986 Bacteria 2751
138 Ga0207639_10001998 3300026041 Bacteria 13745
139 Ga0207639_10115273 3300026041 Bacteria 2197
140 Ga0207678_10021057 3300026067 Bacteria 5716
141 Ga0207678_10023358 3300026067 Bacteria 5407
142 Ga0207678_10056960 3300026067 Bacteria 3364
143 Ga0207678_10091943 3300026067 Bacteria 2593
144 Ga0207708_10012373 3300026075 Bacteria 6359
145 Ga0207708_10115870 3300026075 Bacteria 2084
146 Ga0207702_10008133 3300026078 Bacteria 8875
147 Ga0207702_10034572 3300026078 Bacteria 4226
148 Ga0207674_10054248 3300026116 Bacteria 4081
149 Ga0207675_100111130 3300026118 Bacteria 2586
150 Ga0207675_100228371 3300026118 Bacteria 1795
151 Ga0207683_10032231 3300026121 Bacteria 4552
152 Ga0207683_10165989 3300026121 Bacteria 1998
153 Ga0207698_10009753 3300026142 Bacteria 6133
154 Ga0207698_10091441 3300026142 Bacteria 2491
155 Ga0268266_10000691 3300028379 Bacteria 45474
156 Ga0268266_10004502 3300028379 Bacteria 13321
157 Ga0268265_10021966 3300028380 Bacteria 4478
158 Ga0307517_10074881 3300028786 Bacteria 2978
159 Ga0307515_10004370 3300028794 Bacteria 29310
160 Ga0307515_10016695 3300028794 Bacteria 13425
161 Ga0307515_10031929 3300028794 Bacteria 8747
162 Ga0307515_10032128 3300028794 Bacteria 8711
163 Ga0307515_10072941 3300028794 Bacteria 4623
164 Ga0307512_10025405 3300030522 Bacteria 5249
165 Ga0265330_10046612 3300031235 Bacteria 1910
166 Ga0265340_10000264 3300031247 Bacteria 27200
167 Ga0265316_10009686 3300031344 Bacteria 8845
168 Ga0307513_10000004 3300031456 Bacteria 558931
169 Ga0307513_10003112 3300031456 Bacteria 22645
170 Ga0307513_10034606 3300031456 Bacteria 5666
171 Ga0307513_10117695 3300031456 Bacteria 2634
172 Ga0307509_10010313 3300031507 Bacteria 11476
173 Ga0307408_100390225 3300031548 Bacteria 1193
174 Ga0265313_10006384 3300031595 Bacteria 8365
175 Ga0265342_10007507 3300031712 Bacteria 7977
176 Ga0307516_10001634 3300031730 Bacteria 30915
177 Ga0307516_10009002 3300031730 Bacteria 11183
178 Ga0307516_10010387 3300031730 Bacteria 10241
179 Ga0307516_10062773 3300031730 Bacteria 3599
180 Ga0307516_10062844 3300031730 Bacteria 3596
181 Ga0307516_10081209 3300031730 Bacteria 3085
182 Ga0307516_10214297 3300031730 Bacteria 1638
183 Ga0307405_10086286 3300031731 Bacteria 2066
184 Ga0307405_10247002 3300031731 Bacteria 1325
185 Ga0307413_10120912 3300031824 Bacteria 1774
186 Ga0307410_10216341 3300031852 Bacteria 1471
187 Ga0307410_10271259 3300031852 Bacteria 1327
188 Ga0307407_10022238 3300031903 Bacteria 3286
189 Ga0307407_10022445 3300031903 Bacteria 3275
190 Ga0307412_10022169 3300031911 Bacteria 3890
191 Ga0307412_10225630 3300031911 Bacteria 1439
192 Ga0307409_100052931 3300031995 Bacteria 3116
193 Ga0307409_100096008 3300031995 Bacteria 2444
194 Ga0307416_100124744 3300032002 Bacteria 2304
195 Ga0307416_100602650 3300032002 Bacteria 1178
196 Ga0307414_10122708 3300032004 Bacteria 2000
197 Ga0307415_100010755 3300032126 Bacteria 5199
198 Ga0307415_100034981 3300032126 Bacteria 3277
199 Ga0307415_100052709 3300032126 Bacteria 2768
200 Ga0373948_0007197 3300034817 Bacteria 1864
201 Ga0373939_0029750 3300035114 Bacteria 1566
202 Ga0373942_0008089 3300035207 Bacteria 2446
203 Ga0373962_0014526 3300035242 Bacteria 2007
204 Ga0373937_0197433 3300036401 Bacteria 1891
205 Ga0395899_0121916 3300037312 Bacteria 1866
206 Ga0395900_0007854 3300037418 Bacteria 10995
207 Ga0395900_0430451 3300037418 Bacteria 1279
208 Ga0395898_0020956 3300037466 Bacteria 6632
209 Ga0395898_0145109 3300037466 Bacteria 2272
210 Ga0395901_0013798 3300038443 Bacteria 8216
211 Ga0395901_0216411 3300038443 Bacteria 2004
212 Ga0436365_1202722 3300039437 Bacteria 1313
213 Ga0436363_0844810 3300039450 Bacteria 3405
214 Ga0436362_0756631 3300039453 Unclassified 1358
215 Ga0439465_0018416 3300041413 Bacteria 2182
216 Ga0451791_0167513 3300041451 Bacteria 3722
217 Ga0451797_0018404 3300041453 Bacteria 1370
218 Ga0451795_0977500 3300041456 Bacteria 969
219 Ga0451795_0989321 3300041456 Bacteria 3263
220 Ga0451853_0199027 3300041512 Bacteria 2417
221 Ga0451853_1360360 3300041512 Bacteria 1273
222 Ga0439432_033292 3300042006 Bacteria 1659
223 Ga0439463_020397 3300042016 Bacteria 1653
224 Ga0439435_0011139 3300042436 Bacteria 2152
225 Ga0453684_0288839 3300044712 Bacteria 1868
226 Ga0495650_0035630 3300046471 Bacteria 2188
227 Ga0495686_0090755 3300047472 Bacteria 1855
228 Ga0496108_0000136 3300048911 Bacteria 71114
229 Ga0496108_0284459 3300048911 Bacteria 1439
230 Ga0496110_0340884 3300048913 Bacteria 1365
231 Ga0496111_0041994 3300048914 Bacteria 3283
232 Ga0496114_0032178 3300048917 Bacteria 4316
233 Ga0496120_0008764 3300048923 Bacteria 7273
234 Ga0496125_0001401 3300048928 Bacteria 35263
235 Ga0496125_0144314 3300048928 Bacteria 1649
236 Ga0496126_0030068 3300048929 Bacteria 5153
237 Ga0501308_005731 3300049128 Bacteria 1249
238 Ga0501320_005339 3300049536 Bacteria 1167
239 Ga0501031_0013840 3300049568 Bacteria 5256
240 Ga0501031_0074719 3300049568 Bacteria 2207
241 Ga0501032_0030953 3300049569 Bacteria 3670
242 Ga0501033_0011584 3300049570 Bacteria 6747
243 Ga0501034_0000066 3300049571 Bacteria 184727
244 Ga0501034_0016038 3300049571 Bacteria 7689
245 Ga0501034_0114500 3300049571 Bacteria 2685
246 Ga0501034_0156010 3300049571 Bacteria 2256
247 Ga0501034_0262777 3300049571 Bacteria 1668
248 Ga0501036_0144698 3300049572 Bacteria 2005
249 Ga0501037_0000353 3300049573 Bacteria 38814
250 Ga0501037_0246324 3300049573 Bacteria 1251
251 Ga0501038_0048499 3300049574 Bacteria 3675
252 Ga0501038_0224696 3300049574 Bacteria 1496
253 Ga0501043_0000022 3300049579 Bacteria 154467
254 Ga0501043_0029814 3300049579 Bacteria 4287
255 Ga0501043_0162219 3300049579 Bacteria 1746
256 Ga0501046_0052536 3300049580 Bacteria 3211
257 Ga0501046_0123090 3300049580 Bacteria 1972
258 Ga0501047_0010891 3300049581 Bacteria 8598
259 Ga0501047_0024456 3300049581 Bacteria 5795
260 Ga0501047_0175886 3300049581 Bacteria 2008
261 Ga0501047_0207736 3300049581 Bacteria 1817
262 Ga0501048_0252382 3300049582 Bacteria 1252
263 Ga0501068_0012468 3300049584 Bacteria 4823
264 Ga0501068_0017830 3300049584 Bacteria 4110
265 Ga0501068_0165777 3300049584 Bacteria 1393
266 Ga0501069_0000035 3300049585 Bacteria 88215
267 Ga0501069_0034369 3300049585 Bacteria 2792
268 Ga0501070_0000103 3300049586 Bacteria 74597
269 Ga0501070_0006180 3300049586 Bacteria 10204
270 Ga0501070_0014927 3300049586 Bacteria 6534
271 Ga0501070_0030503 3300049586 Bacteria 4518
272 Ga0501070_0033271 3300049586 Bacteria 4313
273 Ga0501070_0085562 3300049586 Bacteria 2610
274 Ga0501070_0092004 3300049586 Bacteria 2510
275 Ga0501070_0142908 3300049586 Bacteria 1976
276 Ga0501071_0003562 3300049587 Bacteria 9746
277 Ga0501073_0018748 3300049589 Bacteria 5003
278 Ga0501073_0019725 3300049589 Bacteria 4866
279 Ga0501073_0095824 3300049589 Bacteria 2061
280 Ga0501074_0000327 3300049590 Bacteria 27615
281 Ga0501074_0158650 3300049590 Bacteria 1615
282 Ga0501079_0311004 3300049741 Bacteria 1233
283 Ga0501080_0025712 3300049742 Bacteria 5467
284 Ga0501080_0079920 3300049742 Bacteria 3039
285 Ga0501080_0197742 3300049742 Bacteria 1846
286 Ga0501035_0000139 3300049822 Bacteria 88322
287 Ga0501035_0005035 3300049822 Bacteria 12519
288 Ga0501035_0037518 3300049822 Bacteria 4389
289 Ga0501035_0069914 3300049822 Bacteria 3110
290 Ga0501035_0078276 3300049822 Bacteria 2921
291 Ga0501044_0000578 3300049823 Bacteria 44504
292 Ga0501044_0009388 3300049823 Bacteria 10659
293 Ga0501044_0056678 3300049823 Bacteria 4023
294 Ga0501044_0071659 3300049823 Bacteria 3523
295 Ga0501044_0141710 3300049823 Bacteria 2392
296 Ga0501044_0144729 3300049823 Bacteria 2363
297 nmdc:mga0n895_545521_c1 3300050512 Bacteria 1165
298 Ga0500569_004552 3300053109 Bacteria 2921
299 Ga0500604_0000260 3300053151 Bacteria 14903
300 Ga0500616_0034463 3300053153 Bacteria 2757
301 Ga0500634_0000002 3300053161 Bacteria 252372
302 Ga0501084_0078793 3300054114 Bacteria 2761
303 Ga0587066_002827 3300059490 Bacteria 1966
304 Ga0587070_005511 3300059491 Bacteria 1663
305 Ga0587073_0023587 3300059492 Bacteria 1206
306 Ga0587077_001864 3300059493 Bacteria 2377
307 Ga0587077_003499 3300059493 Bacteria 1981
308 Ga0587077_005136 3300059493 Bacteria 1771
309 Ga0587080_014106 3300059503 Bacteria 1232
310 Ga0587080_016774 3300059503 Bacteria 1160
311 Ga0587082_002596 3300059504 Bacteria 2064
312 Ga0587082_010786 3300059504 Bacteria 1326
313 Ga0587082_017661 3300059504 Bacteria 1127
314 Ga0587083_0000224 3300059505 Bacteria 4272
315 Ga0587083_0001483 3300059505 Bacteria 2656
316 Ga0587083_0026068 3300059505 Bacteria 1126
317 Ga0587086_008743 3300059507 Bacteria 1190
318 Ga0587088_002421 3300059508 Bacteria 2120
319 Ga0587090_005927 3300059510 Bacteria 1553
320 Ga0587091_010099 3300059511 Bacteria 1437
321 Ga0587091_019195 3300059511 Bacteria 1172
322 Ga0587092_015355 3300059512 Bacteria 1120
323 Ga0587098_006848 3300059604 Bacteria 1168
324 Ga0587106_000625 3300059605 Bacteria 2642
325 Ga0587106_000739 3300059605 Bacteria 2529
326 Ga0587125_003706 3300059607 Bacteria 1318
327 Ga0587131_001734 3300059609 Bacteria 1109
328 Ga0587099_005668 3300059622 Bacteria 1131
329 Ga0587117_005240 3300059627 Bacteria 1393
330 Ga0587127_001905 3300059629 Bacteria 1220
331 Ga0587128_013344 3300059630 Bacteria 1158
332 Ga0587130_003677 3300059631 Bacteria 1308
333 Ga0587068_020427 3300059641 Bacteria 1082
334 Ga0587072_005500 3300059643 Bacteria 1893
335 Ga0587072_009885 3300059643 Bacteria 1532
336 Ga0587075_001986 3300059644 Bacteria 2093
337 Ga0587076_017884 3300059645 Bacteria 1135
338 Ga0587079_003798 3300059647 Bacteria 2002
339 Ga0587105_000807 3300059651 Bacteria 1448
340 Ga0587107_005398 3300059652 Bacteria 1350
341 Ga0587110_000795 3300059654 Bacteria 2045
342 Ga0587114_008203 3300059655 Bacteria 1220
343 Ga0587111_0002428 3300060346 Bacteria 2483
344 2503203516 2503198000 Bacteria 6884444
345 2599939899 2599185301 Bacteria 6161860
346 2753272268 2751185782 Bacteria 11227053
347 2792750792 2791355123 Bacteria 8049106
348 2816505472 2816332139 Bacteria 9138787
349 2837653991 2837651117 Bacteria 3772164
350 2869168109 2869162929 Bacteria 6399702
351 2898795786 2898795034 Bacteria 4294459
352 2932402380 2932401849 Bacteria 4262978
353 2937828414 2937822353 Bacteria 7290551
354 2939669974 2939669807 Bacteria 5028511
355 2958066147 2958064165 Bacteria 7158582
356 Ga0209233_1001631
357 JGI25156J39149_1005825
358 JGI25157J39369_1001027
359 JGI25406J46586_10004820
360 JGI25406J46586_10012758
361 JGI25406J46586_10035576
362 JGI25165J46597_1000016
363 Ga0007409J51694_1015741
364 Ga0007409J51694_1022246
365 Ga0007409J51694_1043664
366 Ga0058863_10002528
367 Ga0058863_11941704
368 Ga0058861_11870310
369 Ga0070658_10002384
370 Ga0070658_10068797
371 Ga0070658_10146122
372 Ga0070660_100073407
373 Ga0070660_100074904
374 Ga0070661_100002956
375 Ga0070661_100177155
376 Ga0070668_100029857
377 Ga0070668_100068027
378 Ga0070669_100185642
379 Ga0070673_100231990
380 Ga0070659_100025829
381 Ga0070659_100045728
382 Ga0070659_100221008
383 Ga0070667_100026653
384 Ga0070667_100180147
385 Ga0070700_100117411
386 Ga0070663_100007652
387 Ga0070678_100227081
388 Ga0070681_10138204
389 Ga0070699_100245579
390 Ga0068853_100112447
391 Ga0070665_100025941
392 Ga0070665_100256309
393 Ga0070704_100198708
394 Ga0068855_100043568
395 Ga0068854_100056539
396 Ga0068854_100126131
397 Ga0068856_100029490
398 Ga0068852_100005219
399 Ga0068852_100476599
400 Ga0068859_100050436
401 Ga0068866_10039864
402 Ga0068861_100253545
403 Ga0068861_100261233
404 Ga0068870_10021921
405 Ga0068863_100236377
406 Ga0068862_100084954
407 Ga0081540_1029022
408 Ga0081539_10000625
409 Ga0081539_10000637
410 Ga0081539_10003049
411 Ga0081539_10003444
412 Ga0081539_10011727
413 Ga0081539_10011985
414 Ga0081539_10074995
415 Ga0075365_10054896
416 Ga0070715_10027339
417 Ga0070712_100220412
418 Ga0068865_100019996
419 Ga0097620_100050436
420 Ga0105240_10116036
421 Ga0105240_10512028
422 Ga0111539_10141357
423 Ga0105241_10070558
424 Ga0105242_10085276
425 Ga0105248_10106197
426 Ga0105237_10001906
427 Ga0105238_10028901
428 Ga0105238_10033342
429 Ga0105239_10095224
430 Ga0105239_10547420
431 Ga0105246_10126819
432 Ga0157371_10013041
433 Ga0157371_10052221
434 Ga0157370_10009366
435 Ga0157370_10013336
436 Ga0157370_10411834
437 Ga0157369_10019547
438 Ga0157369_10104502
439 Ga0157369_10214144
440 Ga0157374_10032892
441 Ga0157372_10128722
442 Ga0157372_10449512
443 Ga0157372_10456826
444 Ga0163163_10085665
445 Ga0157379_10373573
446 Ga0182005_1025826
447 Ga0163161_10093954
448 Ga0206356_10938532
449 Ga0206356_11281493
450 Ga0206351_10089958
451 Ga0206351_10760914
452 Ga0206352_10445410
453 Ga0206352_10532224
454 Ga0206352_11166553
455 Ga0206350_10552220
456 Ga0209026_1000005
457 Ga0209759_1000106
458 Ga0209233_1000068
459 Ga0209025_1076526
460 Ga0207642_10162150
461 Ga0207688_10045019
462 Ga0207647_10027394
463 Ga0207685_10118503
464 Ga0207645_10117316
465 Ga0207643_10033378
466 Ga0207705_10003617
467 Ga0207705_10083427
468 Ga0207684_10072784
469 Ga0207654_10113149
470 Ga0207695_10043453
471 Ga0207695_10117850
472 Ga0207671_10000168
473 Ga0207671_10251866
474 Ga0207657_10003579
475 Ga0207657_10074907
476 Ga0207657_10320489
477 Ga0207649_10013572
478 Ga0207652_10247985
479 Ga0207694_10013184
480 Ga0207706_10086365
481 Ga0207686_10071337
482 Ga0207669_10117933
483 Ga0207691_10078229
484 Ga0207689_10005049
485 Ga0207689_10030336
486 Ga0207679_10063067
487 Ga0207667_10008878
488 Ga0207667_10023438
489 Ga0207712_10007694
490 Ga0207668_10006469
491 Ga0207640_10061579
492 Ga0207658_10064346
493 Ga0207639_10001998
494 Ga0207639_10115273
495 Ga0207678_10021057
496 Ga0207678_10023358
497 Ga0207678_10056960
498 Ga0207678_10091943
499 Ga0207708_10012373
500 Ga0207708_10115870
501 Ga0207702_10008133
502 Ga0207702_10034572
503 Ga0207674_10054248
504 Ga0207675_100111130
505 Ga0207675_100228371
506 Ga0207683_10032231
507 Ga0207683_10165989
508 Ga0207698_10009753
509 Ga0207698_10091441
510 Ga0268266_10000691
511 Ga0268266_10004502
512 Ga0268265_10021966
513 Ga0307517_10074881
514 Ga0307515_10004370
515 Ga0307515_10016695
516 Ga0307515_10031929
517 Ga0307515_10032128
518 Ga0307515_10072941
519 Ga0307512_10025405
520 Ga0265330_10046612
521 Ga0265340_10000264
522 Ga0265316_10009686
523 Ga0307513_10000004
524 Ga0307513_10003112
525 Ga0307513_10034606
526 Ga0307513_10117695
527 Ga0307509_10010313
528 Ga0307408_100390225
529 Ga0265313_10006384
530 Ga0265342_10007507
531 Ga0307516_10001634
532 Ga0307516_10009002
533 Ga0307516_10010387
534 Ga0307516_10062773
535 Ga0307516_10062844
536 Ga0307516_10081209
537 Ga0307516_10214297
538 Ga0307405_10086286
539 Ga0307405_10247002
540 Ga0307413_10120912
541 Ga0307410_10216341
542 Ga0307410_10271259
543 Ga0307407_10022238
544 Ga0307407_10022445
545 Ga0307412_10022169
546 Ga0307412_10225630
547 Ga0307409_100052931
548 Ga0307409_100096008
549 Ga0307416_100124744
550 Ga0307416_100602650
551 Ga0307414_10122708
552 Ga0307415_100010755
553 Ga0307415_100034981
554 Ga0307415_100052709
555 Ga0373948_0007197
556 Ga0373939_0029750
557 Ga0373942_0008089
558 Ga0373962_0014526
559 Ga0373937_0197433
560 Ga0395899_0121916
561 Ga0395900_0007854
562 Ga0395900_0430451
563 Ga0395898_0020956
564 Ga0395898_0145109
565 Ga0395901_0013798
566 Ga0395901_0216411
567 Ga0436365_1202722
568 Ga0436363_0844810
569 Ga0436362_0756631
570 Ga0439465_0018416
571 Ga0451791_0167513
572 Ga0451797_0018404
573 Ga0451795_0977500
574 Ga0451795_0989321
575 Ga0451853_0199027
576 Ga0451853_1360360
577 Ga0439432_033292
578 Ga0439463_020397
579 Ga0439435_0011139
580 Ga0453684_0288839
581 Ga0495650_0035630
582 Ga0495686_0090755
583 Ga0496108_0000136
584 Ga0496108_0284459
585 Ga0496110_0340884
586 Ga0496111_0041994
587 Ga0496114_0032178
588 Ga0496120_0008764
589 Ga0496125_0001401
590 Ga0496125_0144314
591 Ga0496126_0030068
592 Ga0501308_005731
593 Ga0501320_005339
594 Ga0501031_0013840
595 Ga0501031_0074719
596 Ga0501032_0030953
597 Ga0501033_0011584
598 Ga0501034_0000066
599 Ga0501034_0016038
600 Ga0501034_0114500
601 Ga0501034_0156010
602 Ga0501034_0262777
603 Ga0501036_0144698
604 Ga0501037_0000353
605 Ga0501037_0246324
606 Ga0501038_0048499
607 Ga0501038_0224696
608 Ga0501043_0000022
609 Ga0501043_0029814
610 Ga0501043_0162219
611 Ga0501046_0052536
612 Ga0501046_0123090
613 Ga0501047_0010891
614 Ga0501047_0024456
615 Ga0501047_0175886
616 Ga0501047_0207736
617 Ga0501048_0252382
618 Ga0501068_0012468
619 Ga0501068_0017830
620 Ga0501068_0165777
621 Ga0501069_0000035
622 Ga0501069_0034369
623 Ga0501070_0000103
624 Ga0501070_0006180
625 Ga0501070_0014927
626 Ga0501070_0030503
627 Ga0501070_0033271
628 Ga0501070_0085562
629 Ga0501070_0092004
630 Ga0501070_0142908
631 Ga0501071_0003562
632 Ga0501073_0018748
633 Ga0501073_0019725
634 Ga0501073_0095824
635 Ga0501074_0000327
636 Ga0501074_0158650
637 Ga0501079_0311004
638 Ga0501080_0025712
639 Ga0501080_0079920
640 Ga0501080_0197742
641 Ga0501035_0000139
642 Ga0501035_0005035
643 Ga0501035_0037518
644 Ga0501035_0069914
645 Ga0501035_0078276
646 Ga0501044_0000578
647 Ga0501044_0009388
648 Ga0501044_0056678
649 Ga0501044_0071659
650 Ga0501044_0141710
651 Ga0501044_0144729
652 nmdc:mga0n895_545521_c1
653 Ga0500569_004552
654 Ga0500604_0000260
655 Ga0500616_0034463
656 Ga0500634_0000002
657 Ga0501084_0078793
658 Ga0587066_002827
659 Ga0587070_005511
660 Ga0587073_0023587
661 Ga0587077_001864
662 Ga0587077_003499
663 Ga0587077_005136
664 Ga0587080_014106
665 Ga0587080_016774
666 Ga0587082_002596
667 Ga0587082_010786
668 Ga0587082_017661
669 Ga0587083_0000224
670 Ga0587083_0001483
671 Ga0587083_0026068
672 Ga0587086_008743
673 Ga0587088_002421
674 Ga0587090_005927
675 Ga0587091_010099
676 Ga0587091_019195
677 Ga0587092_015355
678 Ga0587098_006848
679 Ga0587106_000625
680 Ga0587106_000739
681 Ga0587125_003706
682 Ga0587131_001734
683 Ga0587099_005668
684 Ga0587117_005240
685 Ga0587127_001905
686 Ga0587128_013344
687 Ga0587130_003677
688 Ga0587068_020427
689 Ga0587072_005500
690 Ga0587072_009885
691 Ga0587075_001986
692 Ga0587076_017884
693 Ga0587079_003798
694 Ga0587105_000807
695 Ga0587107_005398
696 Ga0587110_000795
697 Ga0587114_008203
698 Ga0587111_0002428
699 2503203516
700 2599939899
701 2753272268
702 2792750792
703 2816505472
704 2837653991
705 2869168109
706 2898795786
707 2932402380
708 2937828414
709 2939669974
710 2958066147

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13407

Peripla_BP_4

Periplasmic binding protein domain

71

344

0.91

PF00532

Peripla_BP_1

Periplasmic binding proteins and sugar binding domain of LacI family

68

347

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
7e7m-assembly4.cif.gz_D crystal structure analysis of the streptococcus agalactiae ribose binding protein rbsb 0.8848 23 302
5dte-assembly3.cif.gz_C crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose 0.8823 26 302
4ry9-assembly2.cif.gz_B crystal structure of carbohydrate transporter solute binding protein veis_2079 from verminephrobacter eiseniae ef01-2, target efi-511009, a complex with d-talitol 0.8807 25 302
4zjp-assembly1.cif.gz_A structure of an abc-transporter solute binding protein (sbp_ipr025997) from actinobacillus succinogenes (asuc_0197, target efi-511067) with bound beta-d-ribopyranose 0.8801 23 302
2gx6-assembly1.cif.gz_A rational stabilization of e. coli ribose binding protein 0.8765 25 302
ID Description Score Start End Superfamily
4ry9B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9093 25 118 3.40.50.2300
4rxmB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9081 25 105 3.40.50.2300
4wzzA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9064 24 116 3.40.50.2300
5dteD02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.904 116 268 3.40.50.2300
3brsB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9028 23 118 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A528B2M1-F1-model_v4 Sugar ABC transporter substrate-binding protein 0.9755 117 323 GO:0030246
GO:0030313
AF-A0A382UPX3-F1-model_v4 Periplasmic binding protein domain-containing protein 0.9702 24 311 GO:0030246
GO:0030313
AF-A0A531LN69-F1-model_v4 Sugar ABC transporter substrate-binding protein 0.97 81 193
AF-A0A528WHR5-F1-model_v4 Sugar ABC transporter substrate-binding protein 0.9658 126 323 GO:0030246
GO:0030313
AF-A0A531LN69-F1-model_v4 Sugar ABC transporter substrate-binding protein 0.9617 81 193

Map