F420153

General Info

Members Datasets Scaffolds Average Seq Length
355 242 323 165

Family's Representative Sequence

Representative Sequence 3300025916|Ga0207663_10002126|Ga0207663_100021265
Length 169
Sequence MAQPYVGEIRMFAGNFAPAGWMFCEGQLLPISEFETLFNLIGTTYGGDGQSTFALPDLRGRIPIHFGNGFTLAETGGVETVTLTVSQIPAHSHPYLGSTNLATGVVPTGQSGGKGGVSTILPYGTDVPVSPLSPSAVGSTGGSQPHNNFQPYLCVDFIISLFGIFPSQT

Samples

Sample ID Description Type Environment
1 2721755523 Delftia sp. HK171 Isolate Unclassified
2 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
3 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
4 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
5 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
6 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
7 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
8 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
9 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
10 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
11 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
12 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
13 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
14 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
15 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
16 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
17 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
18 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
19 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
20 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
21 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
22 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
23 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
24 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
25 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
26 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
27 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
28 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
29 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
30 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
31 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
32 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
34 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
35 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
36 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
37 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
38 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
39 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
40 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
41 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
49 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
50 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
51 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
56 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
57 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
58 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
59 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
62 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
84 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
125 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
126 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
127 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
172 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
173 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
174 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
176 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
177 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
178 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
181 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
182 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
183 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
184 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
185 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
186 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
187 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
188 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
189 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
190 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
191 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
192 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
193 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
194 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
195 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
196 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
197 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
198 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
199 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
200 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
201 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
202 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
208 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
211 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
212 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
213 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
214 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
215 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
218 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
219 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
220 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
221 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
222 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
223 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
226 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
227 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
228 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
229 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
230 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
231 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
233 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
242 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.63
Metatranscriptomes 5.35
Isolates 9.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.25
Nodule 7.89
Rhizoplane 1.97
Rhizosphere 83.94
Stem 0
Stem Tuber 0
Unclassified 3.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10026327 3300001979 Bacteria 1949
2 JGI25406J46586_10000076 3300003203 Bacteria 44212
3 Ga0058859_11371178 3300004798 Bacteria 1963
4 Ga0058861_12049764 3300004800 Bacteria 3881
5 Ga0058862_10051553 3300004803 Bacteria 3291
6 Ga0058862_11482339 3300004803 Bacteria 775
7 Ga0070670_100007296 3300005331 Bacteria 9375
8 Ga0068869_100226439 3300005334 Bacteria 1484
9 Ga0070666_10003376 3300005335 Bacteria 9678
10 Ga0070682_100177029 3300005337 Bacteria 1487
11 Ga0068868_100249247 3300005338 Bacteria 1494
12 Ga0070689_100977498 3300005340 Unclassified 752
13 Ga0070673_100158962 3300005364 Bacteria 1920
14 Ga0070688_100349492 3300005365 Bacteria 1082
15 Ga0070659_100268215 3300005366 Viruses 1418
16 Ga0070667_100033296 3300005367 Bacteria 4306
17 Ga0070667_100050111 3300005367 Bacteria 3518
18 Ga0070709_10000009 3300005434 Bacteria 178953
19 Ga0070709_10000373 3300005434 Bacteria 27557
20 Ga0070711_100000313 3300005439 Bacteria 25173
21 Ga0070711_100238053 3300005439 Bacteria 1422
22 Ga0070705_100078149 3300005440 Bacteria 2023
23 Ga0070700_100773184 3300005441 Bacteria 771
24 Ga0070694_100375015 3300005444 Bacteria 1108
25 Ga0070708_100001289 3300005445 Bacteria 19265
26 Ga0070708_100230401 3300005445 Bacteria 1738
27 Ga0070708_100292586 3300005445 Bacteria 1533
28 Ga0070708_100393868 3300005445 Bacteria 1306
29 Ga0070708_100445005 3300005445 Bacteria 1222
30 Ga0070663_100011452 3300005455 Bacteria 5569
31 Ga0070663_100036080 3300005455 Bacteria 3434
32 Ga0070681_10002753 3300005458 Bacteria 16213
33 Ga0070681_10224052 3300005458 Bacteria 1795
34 Ga0068867_100107888 3300005459 Bacteria 2134
35 Ga0070685_10002224 3300005466 Bacteria 10011
36 Ga0070706_100014913 3300005467 Bacteria 7178
37 Ga0070706_100076709 3300005467 Bacteria 3093
38 Ga0070707_100132030 3300005468 Bacteria 2428
39 Ga0070707_100189315 3300005468 Bacteria 2006
40 Ga0070707_100535695 3300005468 Bacteria 1133
41 Ga0070707_101504891 3300005468 Bacteria 640
42 Ga0070698_100014743 3300005471 Bacteria 8257
43 Ga0070698_100080253 3300005471 Bacteria 3257
44 Ga0070698_100319069 3300005471 Bacteria 1484
45 Ga0070698_100356698 3300005471 Bacteria 1394
46 Ga0070698_100536103 3300005471 Bacteria 1109
47 Ga0070699_100029384 3300005518 Bacteria 4739
48 Ga0070699_100223211 3300005518 Bacteria 1679
49 Ga0070699_100264536 3300005518 Bacteria 1538
50 Ga0070679_100032425 3300005530 Bacteria 5167
51 Ga0070679_100365368 3300005530 Bacteria 1390
52 Ga0070684_100143749 3300005535 Bacteria 2159
53 Ga0070697_100000652 3300005536 Bacteria 26194
54 Ga0070697_100029688 3300005536 Unclassified 4386
55 Ga0070697_100577209 3300005536 Bacteria 987
56 Ga0070697_100607474 3300005536 Bacteria 962
57 Ga0070697_100814943 3300005536 Bacteria 826
58 Ga0068853_100011726 3300005539 Bacteria 7122
59 Ga0068853_100351915 3300005539 Bacteria 1370
60 Ga0070695_100080665 3300005545 Bacteria 2151
61 Ga0070696_100261645 3300005546 Bacteria 1312
62 Ga0070693_100027584 3300005547 Bacteria 3080
63 Ga0070665_100003278 3300005548 Bacteria 17372
64 Ga0068855_100073046 3300005563 Bacteria 3986
65 Ga0068855_100165553 3300005563 Bacteria 2507
66 Ga0068855_100590997 3300005563 Bacteria 1198
67 Ga0068855_100603499 3300005563 Bacteria 1183
68 Ga0070664_100262477 3300005564 Bacteria 1554
69 Ga0068857_100135835 3300005577 Bacteria 2220
70 Ga0068854_100320019 3300005578 Bacteria 1260
71 Ga0068856_100069469 3300005614 Bacteria 3483
72 Ga0068856_101163323 3300005614 Bacteria 788
73 Ga0068852_100072822 3300005616 Bacteria 3020
74 Ga0068859_100035697 3300005617 Bacteria 4989
75 Ga0068859_100188853 3300005617 Bacteria 2144
76 Ga0068859_101119552 3300005617 Bacteria 866
77 Ga0068864_101484144 3300005618 Bacteria 681
78 Ga0068851_10001672 3300005834 Bacteria 9706
79 Ga0068870_10021098 3300005840 Bacteria 3182
80 Ga0068863_100033985 3300005841 Bacteria 4857
81 Ga0068863_100200615 3300005841 Bacteria 1919
82 Ga0068863_100246444 3300005841 Bacteria 1725
83 Ga0068858_100000909 3300005842 Bacteria 30679
84 Ga0068860_100038278 3300005843 Bacteria 4587
85 Ga0068862_100006996 3300005844 Bacteria 9365
86 Ga0068862_101065997 3300005844 Bacteria 802
87 Ga0081539_10000229 3300005985 Bacteria 131455
88 Ga0070717_10000191 3300006028 Bacteria 43325
89 Ga0070717_10091487 3300006028 Bacteria 2569
90 Ga0070717_10581820 3300006028 Bacteria 1015
91 Ga0070717_10652605 3300006028 Viruses 955
92 Ga0075365_10250654 3300006038 Bacteria 1244
93 Ga0070716_100000020 3300006173 Bacteria 79851
94 Ga0070716_100073507 3300006173 Bacteria 2017
95 Ga0070712_101271256 3300006175 Bacteria 641
96 Ga0075369_10255692 3300006186 Bacteria 814
97 Ga0097621_100184579 3300006237 Bacteria 1804
98 Ga0097621_100694685 3300006237 Unclassified 936
99 Ga0097621_100859165 3300006237 Bacteria 843
100 Ga0068871_100116481 3300006358 Bacteria 2253
101 Ga0068871_100892186 3300006358 Bacteria 824
102 Ga0068871_101043073 3300006358 Bacteria 763
103 Ga0075428_100316599 3300006844 Bacteria 1677
104 Ga0075431_100094262 3300006847 Bacteria 3089
105 Ga0075433_10068170 3300006852 Bacteria 3123
106 Ga0075434_100011576 3300006871 Bacteria 8328
107 Ga0075434_100119618 3300006871 Bacteria 2648
108 Ga0075429_100000502 3300006880 Bacteria 29456
109 Ga0068865_100095436 3300006881 Bacteria 2167
110 Ga0075436_100001244 3300006914 Bacteria 17316
111 Ga0075436_100027991 3300006914 Bacteria 3879
112 Ga0075436_100048677 3300006914 Bacteria 2925
113 Ga0097620_100035697 3300006931 Bacteria 4989
114 Ga0097620_101119519 3300006931 Bacteria 866
115 Ga0075435_100011911 3300007076 Bacteria 6422
116 Ga0075435_100157412 3300007076 Bacteria 1912
117 Ga0075435_100257991 3300007076 Bacteria 1485
118 Ga0099794_10232315 3300007265 Unclassified 949
119 Ga0105240_10000239 3300009093 Bacteria 109259
120 Ga0105240_10050241 3300009093 Bacteria 5259
121 Ga0105240_11000478 3300009093 Bacteria 894
122 Ga0105245_10447033 3300009098 Bacteria 1300
123 Ga0105245_10536185 3300009098 Bacteria 1191
124 Ga0105247_10720634 3300009101 Bacteria 753
125 Ga0114129_10021626 3300009147 Bacteria 9130
126 Ga0105241_10033703 3300009174 Bacteria 3845
127 Ga0105241_10315001 3300009174 Bacteria 1347
128 Ga0105241_10792969 3300009174 Bacteria 872
129 Ga0105242_10467397 3300009176 Bacteria 1192
130 Ga0105248_10525997 3300009177 Bacteria 1334
131 Ga0105237_10016724 3300009545 Bacteria 7616
132 Ga0105237_10101105 3300009545 Bacteria 2875
133 Ga0105237_10832340 3300009545 Bacteria 930
134 Ga0105238_10001918 3300009551 Bacteria 20874
135 Ga0105238_10019377 3300009551 Bacteria 6929
136 Ga0105249_10021608 3300009553 Bacteria 5762
137 Ga0105249_10953029 3300009553 Bacteria 926
138 Ga0105239_10021673 3300010375 Bacteria 7083
139 Ga0105239_10027070 3300010375 Bacteria 6312
140 Ga0105239_11065707 3300010375 Bacteria 930
141 Ga0105246_10002517 3300011119 Bacteria 11080
142 Ga0105246_10677682 3300011119 Bacteria 901
143 Ga0105246_11879566 3300011119 Bacteria 574
144 Ga0157373_10003863 3300013100 Bacteria 11320
145 Ga0157370_11124935 3300013104 Bacteria 709
146 Ga0157369_10041257 3300013105 Bacteria 5038
147 Ga0157369_10626715 3300013105 Bacteria 1109
148 Ga0157378_11253118 3300013297 Bacteria 782
149 Ga0163162_10043702 3300013306 Bacteria 4486
150 Ga0163162_10374740 3300013306 Bacteria 1556
151 Ga0163162_11486444 3300013306 Bacteria 772
152 Ga0163163_10003458 3300014325 Bacteria 13422
153 Ga0157380_10000235 3300014326 Bacteria 33292
154 Ga0157380_12148398 3300014326 Bacteria 622
155 Ga0157379_10039121 3300014968 Bacteria 4231
156 Ga0206349_1402693 3300020075 Bacteria 1659
157 Ga0206354_10644897 3300020081 Bacteria 742
158 Ga0206353_11977533 3300020082 Bacteria 1308
159 Ga0154015_1206444 3300020610 Bacteria 2254
160 Ga0213873_10085119 3300021358 Bacteria 891
161 Ga0213874_10198035 3300021377 Bacteria 721
162 Ga0213875_10004818 3300021388 Bacteria 7333
163 Ga0224712_10143508 3300022467 Bacteria 1053
164 Ga0207656_10004827 3300025321 Bacteria 4732
165 Ga0207680_10025694 3300025903 Bacteria 3251
166 Ga0207680_10178398 3300025903 Bacteria 1435
167 Ga0207680_10367996 3300025903 Bacteria 1012
168 Ga0207647_10005321 3300025904 Bacteria 9459
169 Ga0207647_10096611 3300025904 Bacteria 1758
170 Ga0207699_10000020 3300025906 Bacteria 179154
171 Ga0207699_10000092 3300025906 Bacteria 66083
172 Ga0207643_10011131 3300025908 Bacteria 4857
173 Ga0207684_10000358 3300025910 Bacteria 62368
174 Ga0207684_10003775 3300025910 Bacteria 14638
175 Ga0207684_10213328 3300025910 Bacteria 1665
176 Ga0207654_10018025 3300025911 Bacteria 3702
177 Ga0207654_10452579 3300025911 Bacteria 900
178 Ga0207695_10000082 3300025913 Bacteria 284333
179 Ga0207695_10026988 3300025913 Bacteria 6398
180 Ga0207695_10077681 3300025913 Bacteria 3371
181 Ga0207671_10008103 3300025914 Bacteria 8970
182 Ga0207671_10083498 3300025914 Bacteria 2398
183 Ga0207663_10002126 3300025916 Bacteria 9451
184 Ga0207649_10008919 3300025920 Bacteria 5476
185 Ga0207652_10006426 3300025921 Bacteria 9477
186 Ga0207646_10001844 3300025922 Bacteria 25581
187 Ga0207646_10316667 3300025922 Bacteria 1410
188 Ga0207646_10857653 3300025922 Bacteria 807
189 Ga0207694_10001472 3300025924 Bacteria 20135
190 Ga0207694_10001626 3300025924 Bacteria 18893
191 Ga0207650_10043835 3300025925 Bacteria 3286
192 Ga0207650_10244212 3300025925 Bacteria 1452
193 Ga0207687_10098226 3300025927 Bacteria 2149
194 Ga0207700_10275003 3300025928 Bacteria 1447
195 Ga0207700_10870032 3300025928 Bacteria 806
196 Ga0207690_10725401 3300025932 Bacteria 818
197 Ga0207706_10282362 3300025933 Bacteria 1448
198 Ga0207686_10402711 3300025934 Bacteria 1043
199 Ga0207670_10673336 3300025936 Bacteria 855
200 Ga0207670_10784840 3300025936 Bacteria 793
201 Ga0207665_10000045 3300025939 Bacteria 79809
202 Ga0207665_10080870 3300025939 Bacteria 2236
203 Ga0207665_11125464 3300025939 Bacteria 626
204 Ga0207711_10692164 3300025941 Unclassified 951
205 Ga0207689_10127622 3300025942 Bacteria 2092
206 Ga0207689_10188618 3300025942 Bacteria 1701
207 Ga0207661_10263634 3300025944 Bacteria 1536
208 Ga0207679_10206258 3300025945 Bacteria 1645
209 Ga0207667_10184292 3300025949 Bacteria 2143
210 Ga0207667_10207659 3300025949 Bacteria 2008
211 Ga0207667_10341633 3300025949 Bacteria 1528
212 Ga0207667_10875836 3300025949 Bacteria 891
213 Ga0207651_10072093 3300025960 Bacteria 2451
214 Ga0207712_10003134 3300025961 Bacteria 10543
215 Ga0207658_10022467 3300025986 Bacteria 4392
216 Ga0207703_10001939 3300026035 Bacteria 18306
217 Ga0207703_10454391 3300026035 Bacteria 1197
218 Ga0207639_10000008 3300026041 Bacteria 434844
219 Ga0207639_10000663 3300026041 Bacteria 23749
220 Ga0207678_10007943 3300026067 Bacteria 9359
221 Ga0207678_10041035 3300026067 Bacteria 4012
222 Ga0207708_10042120 3300026075 Bacteria 3481
223 Ga0207702_10044802 3300026078 Bacteria 3719
224 Ga0207702_11006881 3300026078 Bacteria 827
225 Ga0207641_10073626 3300026088 Bacteria 2944
226 Ga0207641_10099476 3300026088 Bacteria 2559
227 Ga0207641_10373259 3300026088 Bacteria 1364
228 Ga0207648_10171820 3300026089 Bacteria 1916
229 Ga0207674_10219918 3300026116 Bacteria 1847
230 Ga0207675_100109547 3300026118 Bacteria 2606
231 Ga0207698_10072501 3300026142 Bacteria 2738
232 Ga0268266_10000008 3300028379 Bacteria 1161875
233 Ga0268265_10086988 3300028380 Bacteria 2485
234 Ga0268265_10852873 3300028380 Bacteria 891
235 Ga0268264_10499384 3300028381 Bacteria 1186
236 Ga0265338_10275779 3300028800 Bacteria 1231
237 Ga0307508_10049689 3300031616 Bacteria 3735
238 Ga0373929_0000008 3300035085 Bacteria 298561
239 Ga0373923_0058841 3300035111 Bacteria 1628
240 Ga0373957_0173621 3300035120 Viruses 891
241 Ga0373961_0000245 3300035241 Bacteria 25270
242 Ga0373933_0050164 3300035724 Bacteria 2490
243 Ga0373937_0039775 3300036401 Viruses 4285
244 Ga0395905_0004035 3300037471 Bacteria 15411
245 Ga0436364_0019595 3300037853 Bacteria 18406
246 Ga0436364_0110751 3300037853 Bacteria 2417
247 Ga0436365_0935740 3300039437 Bacteria 4144
248 Ga0436365_1818776 3300039437 Bacteria 939
249 Ga0436363_1137676 3300039450 Bacteria 4309
250 Ga0436362_0781285 3300039453 Bacteria 703
251 Ga0436362_1224636 3300039453 Bacteria 2911
252 Ga0436362_1263296 3300039453 Bacteria 1002
253 Ga0451800_1081215 3300041459 Bacteria 699
254 Ga0451807_1898185 3300041486 Bacteria 1011
255 Ga0451853_2879237 3300041512 Bacteria 1259
256 Ga0439434_0283087 3300042435 Bacteria 571
257 Ga0439435_0035403 3300042436 Bacteria 1376
258 Ga0439460_0074597 3300042461 Bacteria 1056
259 Ga0451577_0725770 3300042876 Bacteria 899
260 Ga0466961_0237432 3300044693 Bacteria 1121
261 Ga0466963_0015226 3300044694 Bacteria 4758
262 Ga0453684_0000548 3300044712 Bacteria 142109
263 Ga0453684_0005024 3300044712 Bacteria 26860
264 Ga0453684_0032446 3300044712 Bacteria 7309
265 Ga0453684_0225520 3300044712 Bacteria 2167
266 Ga0453684_1044968 3300044712 Bacteria 866
267 Ga0466960_0001712 3300044901 Bacteria 8049
268 Ga0451576_0042106 3300045051 Bacteria 4823
269 Ga0466967_0154377 3300045976 Bacteria 2149
270 Ga0495629_0929036 3300046459 Unclassified 569
271 Ga0495630_0705572 3300046517 Unclassified 772
272 Ga0495645_0229545 3300046543 Viruses 1244
273 Ga0495604_0657322 3300047317 Unclassified 668
274 Ga0495672_0026267 3300047320 Unclassified 3717
275 Ga0496103_0162467 3300048906 Bacteria 1433
276 Ga0496104_0886395 3300048907 Bacteria 797
277 Ga0496105_0240357 3300048908 Bacteria 1470
278 Ga0496110_0008976 3300048913 Bacteria 8063
279 Ga0496111_0052900 3300048914 Bacteria 2933
280 Ga0496126_0246310 3300048929 Bacteria 1491
281 Ga0501039_0084860 3300049575 Bacteria 2467
282 Ga0501043_0118002 3300049579 Bacteria 2082
283 Ga0501067_0037433 3300049583 Bacteria 2695
284 Ga0501068_0017311 3300049584 Bacteria 4167
285 Ga0501069_0285731 3300049585 Bacteria 966
286 Ga0501070_0175622 3300049586 Bacteria 1764
287 Ga0501072_0721860 3300049588 Bacteria 783
288 Ga0501081_0384474 3300049743 Bacteria 1038
289 Ga0501035_0835888 3300049822 Bacteria 733
290 nmdc:mga03n38_78755_c1 3300050490 Bacteria 1543
291 nmdc:mga00v17_73476_c1 3300050491 Bacteria 2123
292 nmdc:mga0yw44_759921_c1 3300050492 Bacteria 658
293 nmdc:mga06z11_50152_c1 3300050494 Bacteria 2132
294 nmdc:mga05p37_3621_c1 3300050507 Bacteria 18061
295 nmdc:mga09592_1390_c1 3300050508 Bacteria 19348
296 nmdc:mga0qj67_6159_c1 3300050509 Bacteria 8793
297 nmdc:mga06r32_63215_c1 3300050510 Bacteria 3567
298 nmdc:mga0n895_177297_c1 3300050512 Bacteria 2162
299 nmdc:mga0n895_36897_c1 3300050512 Bacteria 4723
300 nmdc:mga0n895_533098_c1 3300050512 Bacteria 1181
301 nmdc:mga0n895_7983_c1 3300050512 Bacteria 9127
302 nmdc:mga0rr50_145584_c1 3300050513 Bacteria 1910
303 nmdc:mga0rr50_546763_c1 3300050513 Bacteria 986
304 nmdc:mga0rr50_8787_c1 3300050513 Bacteria 6304
305 nmdc:mga08x19_17_c1 3300050514 Bacteria 313678
306 nmdc:mga08x19_205046_c1 3300050514 Bacteria 1352
307 nmdc:mga08x19_31272_c1 3300050514 Bacteria 3348
308 nmdc:mga08x19_44515_c1 3300050514 Bacteria 2834
309 nmdc:mga0a205_68467_c1 3300050515 Bacteria 3428
310 nmdc:mga0sz30_188353_c1 3300050516 Bacteria 916
311 Ga0495655_0000072 3300053083 Bacteria 20024
312 Ga0500616_0005133 3300053153 Bacteria 9010
313 Ga0501084_1029393 3300054114 Bacteria 692
314 Ga0587070_111389 3300059491 Bacteria 643
315 Ga0587077_075552 3300059493 Bacteria 762
316 Ga0587092_012392 3300059512 Bacteria 1202
317 Ga0587069_007644 3300059642 Bacteria 1341
318 Ga0587079_034517 3300059647 Bacteria 990
319 Ga0587110_004874 3300059654 Bacteria 1186
320 Ga0587071_069126 3300060344 Bacteria 766
321 Ga0587111_0028759 3300060346 Bacteria 1121
322 Ga0587111_0031419 3300060346 Bacteria 1086
323 Ga0587111_0105372 3300060346 Bacteria 708

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042436 Ga0439435_0035403 Ga0439435_0035403_471_977 144
2 3300042461 Ga0439460_0074597 Ga0439460_0074597_100_606 144
3 3300005439 Ga0070711_100238053 Ga0070711_1002380533 146
4 3300006028 Ga0070717_10652605 Ga0070717_106526052 146
5 3300025928 Ga0207700_10275003 Ga0207700_102750032 146
6 3300035111 Ga0373923_0058841 Ga0373923_0058841_1094_1606 147
7 3300035120 Ga0373957_0173621 Ga0373957_0173621_351_863 147
8 3300035724 Ga0373933_0050164 Ga0373933_0050164_1757_2269 147
9 3300036401 Ga0373937_0039775 Ga0373937_0039775_301_813 147
10 3300046459 Ga0495629_0929036 Ga0495629_0929036_12_524 147
11 3300046517 Ga0495630_0705572 Ga0495630_0705572_29_541 147
12 3300046543 Ga0495645_0229545 Ga0495645_0229545_712_1224 147
13 3300047317 Ga0495604_0657322 Ga0495604_0657322_58_570 147
14 3300025939 Ga0207665_11125464 Ga0207665_111254642 149
15 3300004800 Ga0058861_12049764 Ga0058861_120497643 151
16 3300004803 Ga0058862_10051553 Ga0058862_100515533 151
17 3300005458 Ga0070681_10002753 Ga0070681_100027538 151
18 3300005530 Ga0070679_100032425 Ga0070679_1000324251 151
19 3300025921 Ga0207652_10006426 Ga0207652_100064264 151
20 3300049575 Ga0501039_0084860 Ga0501039_0084860_487_999 151
21 3300049579 Ga0501043_0118002 Ga0501043_0118002_1164_1676 151
22 3300049586 Ga0501070_0175622 Ga0501070_0175622_306_818 151
23 3300005471 Ga0070698_100536103 Ga0070698_1005361032 153
24 3300050514 nmdc:mga08x19_17_c1 nmdc:mga08x19_17_c1_224061_224531 153
25 iso_pu_bacteria 2869169390 2869173695 153
26 iso_pu_bacteria 2869242130 2869247563 153
27 iso_pu_bacteria 2871481445 2871486511 153
28 iso_pu_bacteria 2874116593 2874116604 153
29 iso_pu_bacteria 2876386047 2876387758 153
30 iso_pu_bacteria 2876420981 2876427803 153
31 iso_pu_bacteria 2906401398 2906407465 153
32 iso_pu_bacteria 2924741084 2924745260 153
33 3300048929 Ga0496126_0246310 Ga0496126_0246310_517_993 155
34 3300059512 Ga0587092_012392 Ga0587092_012392_551_1054 155
35 3300006237 Ga0097621_100184579 Ga0097621_1001845793 156
36 3300006358 Ga0068871_100892186 Ga0068871_1008921862 156
37 3300011119 Ga0105246_10677682 Ga0105246_106776821 156
38 3300044712 Ga0453684_0032446 Ga0453684_0032446_5320_5793 156
39 3300053083 Ga0495655_0000072 Ga0495655_0000072_6677_7186 156
40 3300059647 Ga0587079_034517 Ga0587079_034517_421_930 156
41 3300060344 Ga0587071_069126 Ga0587071_069126_227_736 156
42 3300060346 Ga0587111_0031419 Ga0587111_0031419_29_538 156
43 3300005366 Ga0070659_100268215 Ga0070659_1002682152 157
44 3300005468 Ga0070707_101504891 Ga0070707_1015048911 157
45 3300005617 Ga0068859_100188853 Ga0068859_1001888533 157
46 3300005844 Ga0068862_100006996 Ga0068862_1000069964 157
47 3300006028 Ga0070717_10581820 Ga0070717_105818202 157
48 3300007265 Ga0099794_10232315 Ga0099794_102323152 157
49 3300010375 Ga0105239_10027070 Ga0105239_100270702 157
50 3300014326 Ga0157380_10000235 Ga0157380_1000023524 157
51 3300025922 Ga0207646_10857653 Ga0207646_108576531 157
52 3300025936 Ga0207670_10784840 Ga0207670_107848401 157
53 3300025949 Ga0207667_10341633 Ga0207667_103416332 157
54 3300026078 Ga0207702_11006881 Ga0207702_110068812 157
55 3300037471 Ga0395905_0004035 Ga0395905_0004035_10583_11062 157
56 3300042435 Ga0439434_0283087 Ga0439434_0283087_79_552 157
57 3300044694 Ga0466963_0015226 Ga0466963_0015226_2328_2801 157
58 3300044712 Ga0453684_0000548 Ga0453684_0000548_64423_64899 157
59 3300044712 Ga0453684_1044968 Ga0453684_1044968_375_848 157
60 3300045976 Ga0466967_0154377 Ga0466967_0154377_1646_2122 157
61 3300047320 Ga0495672_0026267 Ga0495672_0026267_440_916 157
62 3300048907 Ga0496104_0886395 Ga0496104_0886395_86_559 157
63 3300050512 nmdc:mga0n895_177297_c1 nmdc:mga0n895_177297_c1_726_1202 157
64 3300050513 nmdc:mga0rr50_546763_c1 nmdc:mga0rr50_546763_c1_271_744 157
65 3300050514 nmdc:mga08x19_205046_c1 nmdc:mga08x19_205046_c1_259_735 157
66 3300006871 Ga0075434_100119618 Ga0075434_1001196184 161
67 3300050512 nmdc:mga0n895_533098_c1 nmdc:mga0n895_533098_c1_354_857 161
68 iso_pu_bacteria 8004640170 8004644295 161
69 3300005547 Ga0070693_100027584 Ga0070693_1000275843 162
70 3300006914 Ga0075436_100001244 Ga0075436_1000012443 163
71 3300025910 Ga0207684_10000358 Ga0207684_100003583 163
72 iso_pu_bacteria 2721755523 2722882505 163
73 iso_pu_bacteria 2839138175 2839141239 163
74 iso_pu_bacteria 2869256925 2869262506 163
75 iso_pu_bacteria 2871435913 2871443040 163
76 iso_pu_bacteria 2908739725 2908747875 163
77 iso_pu_bacteria 2919683626 2919684231 163
78 iso_pu_bacteria 2924733363 2924740521 163
79 iso_pu_bacteria 2937861824 2937867158 163
80 iso_pu_bacteria 2937980651 2937986026 163
81 iso_pu_bacteria 2958108152 2958114253 163
82 iso_pu_bacteria 2961183825 2961189225 163
83 iso_pu_bacteria 2968138860 2968140052 163
84 iso_pu_bacteria 2970532167 2970532237 163
85 iso_pu_bacteria 2970619444 2970620610 163
86 iso_pu_bacteria 2970627176 2970630347 163
87 iso_pu_bacteria 2977851361 2977853486 163
88 iso_pu_bacteria 2977907340 2977912521 163
89 iso_pu_bacteria 2979764755 2979769433 163
90 iso_pu_bacteria 2979772303 2979773320 163
91 iso_pu_bacteria 2996386984 2996389083 163
92 iso_pu_bacteria 3004248173 3004253963 163
93 iso_pu_bacteria 3004268573 3004269500 163
94 iso_pu_bacteria 8004727605 8004731880 163
95 3300005445 Ga0070708_100393868 Ga0070708_1003938682 164
96 3300005467 Ga0070706_100014913 Ga0070706_1000149134 164
97 3300005468 Ga0070707_100132030 Ga0070707_1001320303 164
98 3300005471 Ga0070698_100080253 Ga0070698_1000802535 164
99 3300005536 Ga0070697_100029688 Ga0070697_1000296884 164
100 3300005841 Ga0068863_100246444 Ga0068863_1002464442 164
101 3300025910 Ga0207684_10213328 Ga0207684_102133282 164
102 3300025922 Ga0207646_10316667 Ga0207646_103166672 164
103 3300026088 Ga0207641_10073626 Ga0207641_100736263 164
104 3300044693 Ga0466961_0237432 Ga0466961_0237432_331_831 164
105 3300059491 Ga0587070_111389 Ga0587070_111389_30_533 164
106 3300004803 Ga0058862_11482339 Ga0058862_114823392 165
107 3300005444 Ga0070694_100375015 Ga0070694_1003750151 165
108 3300005536 Ga0070697_100000652 Ga0070697_1000006527 165
109 3300005545 Ga0070695_100080665 Ga0070695_1000806652 165
110 3300013104 Ga0157370_11124935 Ga0157370_111249351 165
111 3300013297 Ga0157378_11253118 Ga0157378_112531182 165
112 3300025903 Ga0207680_10178398 Ga0207680_101783982 165
113 3300004798 Ga0058859_11371178 Ga0058859_113711782 166
114 3300005340 Ga0070689_100977498 Ga0070689_1009774982 166
115 3300005445 Ga0070708_100230401 Ga0070708_1002304012 166
116 3300005518 Ga0070699_100029384 Ga0070699_1000293843 166
117 3300005536 Ga0070697_100607474 Ga0070697_1006074742 166
118 3300005844 Ga0068862_101065997 Ga0068862_1010659972 166
119 3300006173 Ga0070716_100000020 Ga0070716_10000002067 166
120 3300006173 Ga0070716_100073507 Ga0070716_1000735072 166
121 3300006175 Ga0070712_101271256 Ga0070712_1012712561 166
122 3300006237 Ga0097621_100694685 Ga0097621_1006946852 166
123 3300006844 Ga0075428_100316599 Ga0075428_1003165993 166
124 3300009177 Ga0105248_10525997 Ga0105248_105259972 166
125 3300025939 Ga0207665_10000045 Ga0207665_100000455 166
126 3300025939 Ga0207665_10080870 Ga0207665_100808702 166
127 3300025941 Ga0207711_10692164 Ga0207711_106921642 166
128 3300028380 Ga0268265_10852873 Ga0268265_108528732 166
129 3300031616 Ga0307508_10049689 Ga0307508_100496892 166
130 3300049583 Ga0501067_0037433 Ga0501067_0037433_170_679 166
131 3300049585 Ga0501069_0285731 Ga0501069_0285731_216_725 166
132 3300059493 Ga0587077_075552 Ga0587077_075552_177_689 166
133 3300001979 JGI24740J21852_10026327 JGI24740J21852_100263272 167
134 3300003203 JGI25406J46586_10000076 JGI25406J46586_100000764 167
135 3300005331 Ga0070670_100007296 Ga0070670_1000072967 167
136 3300005334 Ga0068869_100226439 Ga0068869_1002264392 167
137 3300005335 Ga0070666_10003376 Ga0070666_100033769 167
138 3300005337 Ga0070682_100177029 Ga0070682_1001770292 167
139 3300005338 Ga0068868_100249247 Ga0068868_1002492472 167
140 3300005364 Ga0070673_100158962 Ga0070673_1001589623 167
141 3300005365 Ga0070688_100349492 Ga0070688_1003494922 167
142 3300005367 Ga0070667_100033296 Ga0070667_1000332962 167
143 3300005367 Ga0070667_100050111 Ga0070667_1000501113 167
144 3300005434 Ga0070709_10000009 Ga0070709_100000093 167
145 3300005434 Ga0070709_10000373 Ga0070709_1000037318 167
146 3300005439 Ga0070711_100000313 Ga0070711_10000031310 167
147 3300005440 Ga0070705_100078149 Ga0070705_1000781492 167
148 3300005441 Ga0070700_100773184 Ga0070700_1007731841 167
149 3300005445 Ga0070708_100001289 Ga0070708_1000012893 167
150 3300005445 Ga0070708_100292586 Ga0070708_1002925862 167
151 3300005445 Ga0070708_100445005 Ga0070708_1004450051 167
152 3300005455 Ga0070663_100011452 Ga0070663_1000114522 167
153 3300005455 Ga0070663_100036080 Ga0070663_1000360806 167
154 3300005458 Ga0070681_10224052 Ga0070681_102240522 167
155 3300005459 Ga0068867_100107888 Ga0068867_1001078882 167
156 3300005466 Ga0070685_10002224 Ga0070685_100022243 167
157 3300005467 Ga0070706_100076709 Ga0070706_1000767093 167
158 3300005468 Ga0070707_100189315 Ga0070707_1001893152 167
159 3300005468 Ga0070707_100535695 Ga0070707_1005356952 167
160 3300005471 Ga0070698_100014743 Ga0070698_1000147434 167
161 3300005471 Ga0070698_100319069 Ga0070698_1003190693 167
162 3300005471 Ga0070698_100356698 Ga0070698_1003566981 167
163 3300005518 Ga0070699_100223211 Ga0070699_1002232112 167
164 3300005518 Ga0070699_100264536 Ga0070699_1002645362 167
165 3300005530 Ga0070679_100365368 Ga0070679_1003653682 167
166 3300005535 Ga0070684_100143749 Ga0070684_1001437494 167
167 3300005536 Ga0070697_100577209 Ga0070697_1005772091 167
168 3300005536 Ga0070697_100814943 Ga0070697_1008149432 167
169 3300005539 Ga0068853_100011726 Ga0068853_1000117265 167
170 3300005539 Ga0068853_100351915 Ga0068853_1003519153 167
171 3300005546 Ga0070696_100261645 Ga0070696_1002616452 167
172 3300005548 Ga0070665_100003278 Ga0070665_10000327816 167
173 3300005563 Ga0068855_100073046 Ga0068855_1000730463 167
174 3300005563 Ga0068855_100165553 Ga0068855_1001655533 167
175 3300005563 Ga0068855_100590997 Ga0068855_1005909973 167
176 3300005563 Ga0068855_100603499 Ga0068855_1006034992 167
177 3300005564 Ga0070664_100262477 Ga0070664_1002624773 167
178 3300005577 Ga0068857_100135835 Ga0068857_1001358353 167
179 3300005578 Ga0068854_100320019 Ga0068854_1003200192 167
180 3300005614 Ga0068856_100069469 Ga0068856_1000694693 167
181 3300005614 Ga0068856_101163323 Ga0068856_1011633232 167
182 3300005616 Ga0068852_100072822 Ga0068852_1000728222 167
183 3300005617 Ga0068859_100035697 Ga0068859_1000356977 167
184 3300005617 Ga0068859_101119552 Ga0068859_1011195522 167
185 3300005618 Ga0068864_101484144 Ga0068864_1014841442 167
186 3300005834 Ga0068851_10001672 Ga0068851_100016723 167
187 3300005840 Ga0068870_10021098 Ga0068870_100210983 167
188 3300005841 Ga0068863_100033985 Ga0068863_1000339853 167
189 3300005841 Ga0068863_100200615 Ga0068863_1002006153 167
190 3300005842 Ga0068858_100000909 Ga0068858_1000009093 167
191 3300005843 Ga0068860_100038278 Ga0068860_1000382785 167
192 3300005985 Ga0081539_10000229 Ga0081539_1000022921 167
193 3300006028 Ga0070717_10000191 Ga0070717_1000019147 167
194 3300006028 Ga0070717_10091487 Ga0070717_100914873 167
195 3300006038 Ga0075365_10250654 Ga0075365_102506542 167
196 3300006186 Ga0075369_10255692 Ga0075369_102556922 167
197 3300006237 Ga0097621_100859165 Ga0097621_1008591652 167
198 3300006358 Ga0068871_100116481 Ga0068871_1001164813 167
199 3300006358 Ga0068871_101043073 Ga0068871_1010430732 167
200 3300006847 Ga0075431_100094262 Ga0075431_1000942622 167
201 3300006852 Ga0075433_10068170 Ga0075433_100681705 167
202 3300006871 Ga0075434_100011576 Ga0075434_1000115763 167
203 3300006880 Ga0075429_100000502 Ga0075429_10000050210 167
204 3300006881 Ga0068865_100095436 Ga0068865_1000954363 167
205 3300006914 Ga0075436_100027991 Ga0075436_1000279912 167
206 3300006914 Ga0075436_100048677 Ga0075436_1000486774 167
207 3300006931 Ga0097620_100035697 Ga0097620_1000356977 167
208 3300006931 Ga0097620_101119519 Ga0097620_1011195192 167
209 3300007076 Ga0075435_100011911 Ga0075435_1000119114 167
210 3300007076 Ga0075435_100157412 Ga0075435_1001574123 167
211 3300007076 Ga0075435_100257991 Ga0075435_1002579912 167
212 3300009093 Ga0105240_10000239 Ga0105240_1000023969 167
213 3300009093 Ga0105240_10050241 Ga0105240_100502413 167
214 3300009093 Ga0105240_11000478 Ga0105240_110004782 167
215 3300009098 Ga0105245_10447033 Ga0105245_104470332 167
216 3300009098 Ga0105245_10536185 Ga0105245_105361852 167
217 3300009101 Ga0105247_10720634 Ga0105247_107206342 167
218 3300009147 Ga0114129_10021626 Ga0114129_100216262 167
219 3300009174 Ga0105241_10033703 Ga0105241_100337033 167
220 3300009174 Ga0105241_10315001 Ga0105241_103150012 167
221 3300009174 Ga0105241_10792969 Ga0105241_107929692 167
222 3300009176 Ga0105242_10467397 Ga0105242_104673972 167
223 3300009545 Ga0105237_10016724 Ga0105237_100167247 167
224 3300009545 Ga0105237_10101105 Ga0105237_101011053 167
225 3300009545 Ga0105237_10832340 Ga0105237_108323402 167
226 3300009551 Ga0105238_10001918 Ga0105238_1000191812 167
227 3300009551 Ga0105238_10019377 Ga0105238_100193773 167
228 3300009553 Ga0105249_10021608 Ga0105249_100216083 167
229 3300009553 Ga0105249_10953029 Ga0105249_109530291 167
230 3300010375 Ga0105239_10021673 Ga0105239_100216732 167
231 3300010375 Ga0105239_11065707 Ga0105239_110657072 167
232 3300011119 Ga0105246_10002517 Ga0105246_100025173 167
233 3300011119 Ga0105246_11879566 Ga0105246_118795661 167
234 3300013100 Ga0157373_10003863 Ga0157373_100038634 167
235 3300013105 Ga0157369_10041257 Ga0157369_100412573 167
236 3300013105 Ga0157369_10626715 Ga0157369_106267152 167
237 3300013306 Ga0163162_10043702 Ga0163162_100437023 167
238 3300013306 Ga0163162_10374740 Ga0163162_103747402 167
239 3300013306 Ga0163162_11486444 Ga0163162_114864441 167
240 3300014325 Ga0163163_10003458 Ga0163163_100034585 167
241 3300014326 Ga0157380_12148398 Ga0157380_121483982 167
242 3300014968 Ga0157379_10039121 Ga0157379_100391213 167
243 3300020075 Ga0206349_1402693 Ga0206349_14026933 167
244 3300020081 Ga0206354_10644897 Ga0206354_106448971 167
245 3300020082 Ga0206353_11977533 Ga0206353_119775332 167
246 3300020610 Ga0154015_1206444 Ga0154015_12064442 167
247 3300021358 Ga0213873_10085119 Ga0213873_100851191 167
248 3300021377 Ga0213874_10198035 Ga0213874_101980351 167
249 3300021388 Ga0213875_10004818 Ga0213875_100048183 167
250 3300022467 Ga0224712_10143508 Ga0224712_101435082 167
251 3300025321 Ga0207656_10004827 Ga0207656_100048273 167
252 3300025903 Ga0207680_10025694 Ga0207680_100256946 167
253 3300025903 Ga0207680_10367996 Ga0207680_103679961 167
254 3300025904 Ga0207647_10005321 Ga0207647_100053213 167
255 3300025904 Ga0207647_10096611 Ga0207647_100966112 167
256 3300025906 Ga0207699_10000020 Ga0207699_10000020134 167
257 3300025906 Ga0207699_10000092 Ga0207699_1000009240 167
258 3300025908 Ga0207643_10011131 Ga0207643_100111317 167
259 3300025910 Ga0207684_10003775 Ga0207684_100037757 167
260 3300025911 Ga0207654_10018025 Ga0207654_100180253 167
261 3300025911 Ga0207654_10452579 Ga0207654_104525792 167
262 3300025913 Ga0207695_10000082 Ga0207695_10000082216 167
263 3300025913 Ga0207695_10026988 Ga0207695_100269885 167
264 3300025913 Ga0207695_10077681 Ga0207695_100776812 167
265 3300025914 Ga0207671_10008103 Ga0207671_100081039 167
266 3300025914 Ga0207671_10083498 Ga0207671_100834984 167
267 3300025916 Ga0207663_10002126 Ga0207663_100021265 167
268 3300025920 Ga0207649_10008919 Ga0207649_100089194 167
269 3300025922 Ga0207646_10001844 Ga0207646_100018447 167
270 3300025924 Ga0207694_10001472 Ga0207694_1000147210 167
271 3300025924 Ga0207694_10001626 Ga0207694_100016263 167
272 3300025925 Ga0207650_10043835 Ga0207650_100438353 167
273 3300025925 Ga0207650_10244212 Ga0207650_102442123 167
274 3300025927 Ga0207687_10098226 Ga0207687_100982262 167
275 3300025928 Ga0207700_10870032 Ga0207700_108700322 167
276 3300025932 Ga0207690_10725401 Ga0207690_107254012 167
277 3300025933 Ga0207706_10282362 Ga0207706_102823622 167
278 3300025934 Ga0207686_10402711 Ga0207686_104027111 167
279 3300025936 Ga0207670_10673336 Ga0207670_106733361 167
280 3300025942 Ga0207689_10127622 Ga0207689_101276223 167
281 3300025942 Ga0207689_10188618 Ga0207689_101886183 167
282 3300025944 Ga0207661_10263634 Ga0207661_102636341 167
283 3300025945 Ga0207679_10206258 Ga0207679_102062582 167
284 3300025949 Ga0207667_10184292 Ga0207667_101842923 167
285 3300025949 Ga0207667_10207659 Ga0207667_102076593 167
286 3300025949 Ga0207667_10875836 Ga0207667_108758362 167
287 3300025960 Ga0207651_10072093 Ga0207651_100720933 167
288 3300025961 Ga0207712_10003134 Ga0207712_100031347 167
289 3300025986 Ga0207658_10022467 Ga0207658_100224673 167
290 3300026035 Ga0207703_10001939 Ga0207703_100019393 167
291 3300026035 Ga0207703_10454391 Ga0207703_104543912 167
292 3300026041 Ga0207639_10000008 Ga0207639_1000000830 167
293 3300026041 Ga0207639_10000663 Ga0207639_1000066320 167
294 3300026067 Ga0207678_10007943 Ga0207678_100079439 167
295 3300026067 Ga0207678_10041035 Ga0207678_100410353 167
296 3300026075 Ga0207708_10042120 Ga0207708_100421207 167
297 3300026078 Ga0207702_10044802 Ga0207702_100448024 167
298 3300026088 Ga0207641_10099476 Ga0207641_100994762 167
299 3300026088 Ga0207641_10373259 Ga0207641_103732592 167
300 3300026089 Ga0207648_10171820 Ga0207648_101718203 167
301 3300026116 Ga0207674_10219918 Ga0207674_102199182 167
302 3300026118 Ga0207675_100109547 Ga0207675_1001095473 167
303 3300026142 Ga0207698_10072501 Ga0207698_100725013 167
304 3300028379 Ga0268266_10000008 Ga0268266_10000008903 167
305 3300028380 Ga0268265_10086988 Ga0268265_100869883 167
306 3300028381 Ga0268264_10499384 Ga0268264_104993842 167
307 3300028800 Ga0265338_10275779 Ga0265338_102757792 167
308 3300035085 Ga0373929_0000008 Ga0373929_0000008_108200_108703 167
309 3300035241 Ga0373961_0000245 Ga0373961_0000245_21352_21861 167
310 3300037853 Ga0436364_0019595 Ga0436364_0019595_1553_2059 167
311 3300037853 Ga0436364_0110751 Ga0436364_0110751_68_571 167
312 3300039437 Ga0436365_0935740 Ga0436365_0935740_1479_1985 167
313 3300039437 Ga0436365_1818776 Ga0436365_1818776_107_613 167
314 3300039450 Ga0436363_1137676 Ga0436363_1137676_20_526 167
315 3300039453 Ga0436362_0781285 Ga0436362_0781285_69_575 167
316 3300039453 Ga0436362_1224636 Ga0436362_1224636_1012_1518 167
317 3300039453 Ga0436362_1263296 Ga0436362_1263296_271_777 167
318 3300041459 Ga0451800_1081215 Ga0451800_1081215_109_672 167
319 3300041486 Ga0451807_1898185 Ga0451807_1898185_447_953 167
320 3300041512 Ga0451853_2879237 Ga0451853_2879237_716_1219 167
321 3300042876 Ga0451577_0725770 Ga0451577_0725770_356_865 167
322 3300044712 Ga0453684_0005024 Ga0453684_0005024_22843_23346 167
323 3300044712 Ga0453684_0225520 Ga0453684_0225520_1011_1514 167
324 3300044901 Ga0466960_0001712 Ga0466960_0001712_1352_1858 167
325 3300045051 Ga0451576_0042106 Ga0451576_0042106_1112_1615 167
326 3300048906 Ga0496103_0162467 Ga0496103_0162467_434_943 167
327 3300048908 Ga0496105_0240357 Ga0496105_0240357_53_556 167
328 3300048913 Ga0496110_0008976 Ga0496110_0008976_3639_4142 167
329 3300048914 Ga0496111_0052900 Ga0496111_0052900_2158_2661 167
330 3300049584 Ga0501068_0017311 Ga0501068_0017311_412_915 167
331 3300049588 Ga0501072_0721860 Ga0501072_0721860_47_550 167
332 3300049743 Ga0501081_0384474 Ga0501081_0384474_493_996 167
333 3300049822 Ga0501035_0835888 Ga0501035_0835888_23_529 167
334 3300050490 nmdc:mga03n38_78755_c1 nmdc:mga03n38_78755_c1_870_1373 167
335 3300050491 nmdc:mga00v17_73476_c1 nmdc:mga00v17_73476_c1_821_1324 167
336 3300050492 nmdc:mga0yw44_759921_c1 nmdc:mga0yw44_759921_c1_71_574 167
337 3300050494 nmdc:mga06z11_50152_c1 nmdc:mga06z11_50152_c1_1052_1555 167
338 3300050507 nmdc:mga05p37_3621_c1 nmdc:mga05p37_3621_c1_105_608 167
339 3300050508 nmdc:mga09592_1390_c1 nmdc:mga09592_1390_c1_11203_11706 167
340 3300050509 nmdc:mga0qj67_6159_c1 nmdc:mga0qj67_6159_c1_7879_8382 167
341 3300050510 nmdc:mga06r32_63215_c1 nmdc:mga06r32_63215_c1_1054_1557 167
342 3300050512 nmdc:mga0n895_36897_c1 nmdc:mga0n895_36897_c1_1848_2351 167
343 3300050512 nmdc:mga0n895_7983_c1 nmdc:mga0n895_7983_c1_5185_5688 167
344 3300050513 nmdc:mga0rr50_145584_c1 nmdc:mga0rr50_145584_c1_709_1212 167
345 3300050513 nmdc:mga0rr50_8787_c1 nmdc:mga0rr50_8787_c1_1347_1853 167
346 3300050514 nmdc:mga08x19_31272_c1 nmdc:mga08x19_31272_c1_1966_2469 167
347 3300050514 nmdc:mga08x19_44515_c1 nmdc:mga08x19_44515_c1_860_1366 167
348 3300050515 nmdc:mga0a205_68467_c1 nmdc:mga0a205_68467_c1_686_1192 167
349 3300050516 nmdc:mga0sz30_188353_c1 nmdc:mga0sz30_188353_c1_286_789 167
350 3300053153 Ga0500616_0005133 Ga0500616_0005133_7359_7865 167
351 3300054114 Ga0501084_1029393 Ga0501084_1029393_121_624 167
352 3300059642 Ga0587069_007644 Ga0587069_007644_534_1043 167
353 3300059654 Ga0587110_004874 Ga0587110_004874_631_1134 167
354 3300060346 Ga0587111_0028759 Ga0587111_0028759_546_1055 167
355 3300060346 Ga0587111_0105372 Ga0587111_0105372_96_602 167

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07484

Collar

Phage Tail Collar Domain

7

63

0.99

Feature Viewer

pLDDT pTM Quality
67.28 0.47 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map