F420164

General Info

Members Datasets Scaffolds Average Seq Length
355 213 352 173

Family's Representative Sequence

Representative Sequence 3300025936|Ga0207670_10896450|Ga0207670_108964501
Length 204
Sequence VTASTVERASLTKNHAASRKPEPLPSRLRRAARIKTMDRPYNVLFLCTGNSARSILAETILNREGRGNFRAFSAGSQPKGQVHPYALDLLRKMNFDVTALRSKSWNEFAGPGATPLDFVFTVCDNAAGETCPFWPGQPMTAHWGVPDPAAATGSEAEVRLAFADTFRRLSNRISLFVSLPLKSLDKLTLQRQLHSIGLSKGSAA

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
3 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
4 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
93 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
135 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
136 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
137 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
138 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
139 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
145 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
146 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
147 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
148 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
154 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
155 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
156 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
157 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
158 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
159 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
160 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
161 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
162 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
163 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
164 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
165 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
166 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
167 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
168 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
184 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
190 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
191 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
192 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
193 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
194 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
195 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
196 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
197 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
199 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
200 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
204 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
205 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
206 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
207 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
208 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
209 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
210 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
211 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
212 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
213 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.87
Metatranscriptomes 0.28
Isolates 0.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.82
Nodule 0.28
Rhizoplane 10.14
Rhizosphere 84.79
Stem 0
Stem Tuber 0
Unclassified 1.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_8066827 2162886012 Bacteria 943
2 rootH2_10024030 3300003320 Unclassified 3175
3 Ga0065712_10177548 3300005290 Bacteria 1209
4 Ga0065715_10231152 3300005293 Bacteria 1233
5 Ga0065707_10000450 3300005295 Bacteria 70667
6 Ga0065707_10103182 3300005295 Bacteria 2762
7 Ga0065707_10213936 3300005295 Bacteria 1253
8 Ga0070676_10131841 3300005328 Bacteria 1581
9 Ga0070690_100139509 3300005330 Bacteria 1644
10 Ga0070670_100010203 3300005331 Bacteria 8015
11 Ga0070670_100049669 3300005331 Bacteria 3606
12 Ga0070670_100100675 3300005331 Bacteria 2488
13 Ga0070670_100783618 3300005331 Bacteria 860
14 Ga0068869_100134288 3300005334 Bacteria 1905
15 Ga0068869_100159929 3300005334 Bacteria 1753
16 Ga0070666_10060834 3300005335 Bacteria 2556
17 Ga0070682_100374932 3300005337 Bacteria 1068
18 Ga0068868_100502413 3300005338 Bacteria 1062
19 Ga0070689_100062696 3300005340 Bacteria 2893
20 Ga0070689_100155551 3300005340 Bacteria 1846
21 Ga0070689_100186988 3300005340 Bacteria 1685
22 Ga0070689_100353671 3300005340 Bacteria 1233
23 Ga0070687_100156712 3300005343 Bacteria 1342
24 Ga0070687_100594962 3300005343 Bacteria 759
25 Ga0070687_100618898 3300005343 Bacteria 746
26 Ga0070661_100165473 3300005344 Bacteria 1677
27 Ga0070668_100034798 3300005347 Bacteria 3839
28 Ga0070668_101621002 3300005347 Bacteria 593
29 Ga0070669_100090683 3300005353 Bacteria 2291
30 Ga0070669_100181647 3300005353 Bacteria 1646
31 Ga0070669_100262674 3300005353 Bacteria 1378
32 Ga0070669_100767095 3300005353 Bacteria 818
33 Ga0070675_100042836 3300005354 Bacteria 3699
34 Ga0070675_100428886 3300005354 Bacteria 1183
35 Ga0070675_101055677 3300005354 Bacteria 746
36 Ga0070675_101635526 3300005354 Bacteria 594
37 Ga0070671_100039385 3300005355 Bacteria 3923
38 Ga0070674_100150480 3300005356 Bacteria 1756
39 Ga0070673_100003812 3300005364 Bacteria 9455
40 Ga0070673_100912559 3300005364 Bacteria 815
41 Ga0070673_101131838 3300005364 Bacteria 732
42 Ga0070688_100016534 3300005365 Bacteria 4221
43 Ga0070667_100098253 3300005367 Bacteria 2526
44 Ga0070667_100200655 3300005367 Bacteria 1770
45 Ga0070701_10385150 3300005438 Bacteria 885
46 Ga0070705_100290320 3300005440 Bacteria 1167
47 Ga0070700_100044368 3300005441 Bacteria 2738
48 Ga0070708_101067049 3300005445 Bacteria 757
49 Ga0070663_100038812 3300005455 Bacteria 3324
50 Ga0070663_100153384 3300005455 Bacteria 1768
51 Ga0070678_100032214 3300005456 Bacteria 3626
52 Ga0070662_100470130 3300005457 Bacteria 1046
53 Ga0068867_100035074 3300005459 Bacteria 3637
54 Ga0068867_100819337 3300005459 Bacteria 831
55 Ga0070685_10304627 3300005466 Bacteria 1075
56 Ga0070684_100064419 3300005535 Bacteria 3215
57 Ga0068853_100028919 3300005539 Bacteria 4666
58 Ga0068853_101636604 3300005539 Bacteria 624
59 Ga0070672_100072962 3300005543 Bacteria 2734
60 Ga0070672_100167729 3300005543 Bacteria 1824
61 Ga0070672_100244430 3300005543 Bacteria 1510
62 Ga0070686_100166192 3300005544 Bacteria 1557
63 Ga0070695_100295638 3300005545 Bacteria 1195
64 Ga0070665_100038518 3300005548 Bacteria 4806
65 Ga0068855_100251414 3300005563 Bacteria 1972
66 Ga0070664_100468371 3300005564 Bacteria 1158
67 Ga0068857_100008746 3300005577 Bacteria 8769
68 Ga0068856_100068418 3300005614 Bacteria 3510
69 Ga0068856_101598679 3300005614 Bacteria 665
70 Ga0070702_100092317 3300005615 Bacteria 1838
71 Ga0070702_100469534 3300005615 Bacteria 917
72 Ga0068852_100098089 3300005616 Bacteria 2638
73 Ga0068852_101286009 3300005616 Bacteria 753
74 Ga0068859_100059400 3300005617 Bacteria 3852
75 Ga0068859_100136670 3300005617 Bacteria 2524
76 Ga0068859_100255821 3300005617 Bacteria 1842
77 Ga0068864_100041179 3300005618 Bacteria 3951
78 Ga0068864_100117966 3300005618 Bacteria 2369
79 Ga0068861_100019345 3300005719 Bacteria 4865
80 Ga0068861_100142669 3300005719 Bacteria 1956
81 Ga0068861_100829990 3300005719 Bacteria 870
82 Ga0068851_10022877 3300005834 Bacteria 3050
83 Ga0068863_100006356 3300005841 Bacteria 11586
84 Ga0068858_100002811 3300005842 Bacteria 17506
85 Ga0068858_100092576 3300005842 Bacteria 2814
86 Ga0068860_100123593 3300005843 Bacteria 2480
87 Ga0068860_100164355 3300005843 Bacteria 2142
88 Ga0068862_100213382 3300005844 Bacteria 1745
89 Ga0068862_100236108 3300005844 Bacteria 1660
90 Ga0081455_10001657 3300005937 Bacteria 26985
91 Ga0081455_10173844 3300005937 Bacteria 1637
92 Ga0081455_10261261 3300005937 Bacteria 1261
93 Ga0081455_10495968 3300005937 Bacteria 821
94 Ga0081538_10014917 3300005981 Bacteria 6051
95 Ga0081538_10044923 3300005981 Bacteria 2747
96 Ga0075365_10453413 3300006038 Bacteria 906
97 Ga0075364_10365226 3300006051 Bacteria 984
98 Ga0070716_100411966 3300006173 Bacteria 975
99 Ga0097621_100076061 3300006237 Bacteria 2784
100 Ga0097621_100413925 3300006237 Bacteria 1209
101 Ga0068871_100034856 3300006358 Bacteria 3996
102 Ga0068871_100112815 3300006358 Bacteria 2288
103 Ga0068871_100123007 3300006358 Bacteria 2194
104 Ga0075428_100073907 3300006844 Bacteria 3724
105 Ga0075428_100247218 3300006844 Bacteria 1923
106 Ga0075428_100278509 3300006844 Bacteria 1800
107 Ga0075428_100310512 3300006844 Bacteria 1695
108 Ga0075428_100750758 3300006844 Bacteria 1038
109 Ga0075430_100000276 3300006846 Bacteria 36027
110 Ga0075430_100417961 3300006846 Unclassified 1107
111 Ga0075434_100598701 3300006871 Bacteria 1121
112 Ga0068865_100329885 3300006881 Bacteria 1230
113 Ga0068865_101099143 3300006881 Bacteria 700
114 Ga0097620_100059400 3300006931 Bacteria 3852
115 Ga0097620_100136670 3300006931 Bacteria 2524
116 Ga0097620_100255812 3300006931 Bacteria 1842
117 Ga0105240_10067583 3300009093 Bacteria 4430
118 Ga0111539_10000273 3300009094 Bacteria 61676
119 Ga0111539_12578746 3300009094 Bacteria 589
120 Ga0105245_10165825 3300009098 Bacteria 2100
121 Ga0105247_10029610 3300009101 Bacteria 3319
122 Ga0114129_10154656 3300009147 Bacteria 3137
123 Ga0114129_10406824 3300009147 Bacteria 1793
124 Ga0114129_10645046 3300009147 Bacteria 1367
125 Ga0105243_10017778 3300009148 Bacteria 5379
126 Ga0105243_10040116 3300009148 Bacteria 3654
127 Ga0105243_11126980 3300009148 Bacteria 794
128 Ga0105241_10010389 3300009174 Bacteria 6832
129 Ga0105241_10145104 3300009174 Bacteria 1936
130 Ga0105242_10671822 3300009176 Bacteria 1010
131 Ga0105242_11375078 3300009176 Unclassified 732
132 Ga0105248_10005428 3300009177 Bacteria 14007
133 Ga0105248_10362687 3300009177 Bacteria 1631
134 Ga0105248_10624676 3300009177 Bacteria 1215
135 Ga0105238_10012617 3300009551 Bacteria 8529
136 Ga0105238_10318525 3300009551 Bacteria 1541
137 Ga0105249_10028354 3300009553 Bacteria 5054
138 Ga0105249_10213387 3300009553 Bacteria 1895
139 Ga0105249_10513050 3300009553 Bacteria 1245
140 Ga0105249_11077741 3300009553 Bacteria 873
141 Ga0099796_10000246 3300010159 Bacteria 8562
142 Ga0105239_10008773 3300010375 Bacteria 11443
143 Ga0105246_10056167 3300011119 Bacteria 2720
144 Ga0157374_10045456 3300013296 Bacteria 4064
145 Ga0157374_10261107 3300013296 Bacteria 1706
146 Ga0157378_10095413 3300013297 Bacteria 2709
147 Ga0157378_10253598 3300013297 Bacteria 1685
148 Ga0157378_10430553 3300013297 Bacteria 1306
149 Ga0163162_10002542 3300013306 Bacteria 17266
150 Ga0163162_10384953 3300013306 Bacteria 1536
151 Ga0163162_10460219 3300013306 Bacteria 1404
152 Ga0163162_10618389 3300013306 Bacteria 1209
153 Ga0157372_10701842 3300013307 Bacteria 1177
154 Ga0157375_10004280 3300013308 Bacteria 12382
155 Ga0157375_10014491 3300013308 Bacteria 7034
156 Ga0163163_10004598 3300014325 Bacteria 11784
157 Ga0163163_10031699 3300014325 Bacteria 5103
158 Ga0163163_10078160 3300014325 Bacteria 3305
159 Ga0157380_10000130 3300014326 Bacteria 41786
160 Ga0157380_10098791 3300014326 Bacteria 2426
161 Ga0157380_10270382 3300014326 Bacteria 1549
162 Ga0157379_10073025 3300014968 Bacteria 3070
163 Ga0157379_10178570 3300014968 Bacteria 1918
164 Ga0157379_10257159 3300014968 Bacteria 1586
165 Ga0157379_10351652 3300014968 Bacteria 1349
166 Ga0157376_10043871 3300014969 Bacteria 3672
167 Ga0157376_10199979 3300014969 Bacteria 1838
168 Ga0157376_10201268 3300014969 Bacteria 1832
169 Ga0163161_10039181 3300017792 Bacteria 3401
170 Ga0163161_10734420 3300017792 Bacteria 825
171 Ga0224572_1004446 3300024225 Bacteria 2439
172 Ga0209257_1000391 3300025304 Bacteria 87258
173 Ga0207656_10022691 3300025321 Bacteria 2521
174 Ga0207642_10051228 3300025899 Bacteria 1867
175 Ga0207680_10007774 3300025903 Bacteria 5239
176 Ga0207699_10143179 3300025906 Bacteria 1573
177 Ga0207699_10558221 3300025906 Bacteria 831
178 Ga0207645_10139315 3300025907 Bacteria 1580
179 Ga0207643_10031163 3300025908 Bacteria 2971
180 Ga0207707_11013001 3300025912 Bacteria 681
181 Ga0207662_10018188 3300025918 Bacteria 3983
182 Ga0207662_10595924 3300025918 Bacteria 768
183 Ga0207681_10133030 3300025923 Bacteria 1841
184 Ga0207681_10397810 3300025923 Bacteria 1112
185 Ga0207681_10529154 3300025923 Bacteria 968
186 Ga0207694_10301913 3300025924 Bacteria 1318
187 Ga0207650_10005392 3300025925 Bacteria 8726
188 Ga0207650_10118733 3300025925 Bacteria 2056
189 Ga0207650_10268666 3300025925 Bacteria 1385
190 Ga0207659_10011542 3300025926 Bacteria 5583
191 Ga0207659_10656771 3300025926 Bacteria 896
192 Ga0207644_10036704 3300025931 Bacteria 3442
193 Ga0207686_10735581 3300025934 Bacteria 786
194 Ga0207709_10018621 3300025935 Bacteria 3892
195 Ga0207670_10069032 3300025936 Bacteria 2437
196 Ga0207670_10286350 3300025936 Bacteria 1286
197 Ga0207670_10299038 3300025936 Bacteria 1260
198 Ga0207670_10896450 3300025936 Bacteria 743
199 Ga0207669_10629543 3300025937 Bacteria 875
200 Ga0207704_10017244 3300025938 Bacteria 3737
201 Ga0207704_11054514 3300025938 Bacteria 689
202 Ga0207691_10017863 3300025940 Bacteria 6721
203 Ga0207691_10132337 3300025940 Bacteria 2202
204 Ga0207691_10301643 3300025940 Bacteria 1376
205 Ga0207711_10006474 3300025941 Bacteria 9856
206 Ga0207711_10363705 3300025941 Bacteria 1341
207 Ga0207689_10083896 3300025942 Bacteria 2619
208 Ga0207689_10135612 3300025942 Bacteria 2026
209 Ga0207651_10008528 3300025960 Bacteria 5541
210 Ga0207651_10780002 3300025960 Bacteria 846
211 Ga0207712_10042741 3300025961 Bacteria 3123
212 Ga0207640_10114633 3300025981 Bacteria 1918
213 Ga0207658_10132394 3300025986 Bacteria 2005
214 Ga0207658_10370367 3300025986 Bacteria 1252
215 Ga0207703_10019243 3300026035 Bacteria 5332
216 Ga0207703_10130980 3300026035 Bacteria 2166
217 Ga0207639_10574996 3300026041 Bacteria 1037
218 Ga0207678_10446483 3300026067 Bacteria 1124
219 Ga0207678_10548503 3300026067 Bacteria 1011
220 Ga0207702_11927424 3300026078 Bacteria 582
221 Ga0207641_10057098 3300026088 Bacteria 3319
222 Ga0207648_10009696 3300026089 Bacteria 9209
223 Ga0207648_10155938 3300026089 Bacteria 2015
224 Ga0207648_10714344 3300026089 Bacteria 929
225 Ga0207676_10041061 3300026095 Bacteria 3548
226 Ga0207676_10251996 3300026095 Bacteria 1589
227 Ga0207674_10025848 3300026116 Bacteria 6251
228 Ga0207675_100011463 3300026118 Bacteria 8291
229 Ga0207675_100018767 3300026118 Bacteria 6454
230 Ga0207675_100748422 3300026118 Bacteria 988
231 Ga0207675_100752908 3300026118 Bacteria 985
232 Ga0207683_10006335 3300026121 Bacteria 10136
233 Ga0207428_10000053 3300027907 Bacteria 175238
234 Ga0268266_10856708 3300028379 Bacteria 878
235 Ga0268265_10036844 3300028380 Bacteria 3586
236 Ga0268264_10102009 3300028381 Bacteria 2496
237 Ga0268264_10156306 3300028381 Bacteria 2050
238 Ga0268264_11817239 3300028381 Bacteria 619
239 Ga0265760_10039397 3300031090 Bacteria 1406
240 Ga0265325_10009859 3300031241 Bacteria 5561
241 Ga0265331_10093933 3300031250 Bacteria 1385
242 Ga0265327_10004193 3300031251 Bacteria 12980
243 Ga0307513_10038819 3300031456 Bacteria 5285
244 Ga0307513_10149367 3300031456 Bacteria 2249
245 Ga0316575_10049991 3300031665 Bacteria 1664
246 Ga0316579_10012156 3300031691 Bacteria 3677
247 Ga0307412_11092814 3300031911 Bacteria 709
248 Ga0307409_100050142 3300031995 Bacteria 3187
249 Ga0307409_100710974 3300031995 Bacteria 1005
250 Ga0307409_101776622 3300031995 Bacteria 646
251 Ga0307416_100875906 3300032002 Bacteria 997
252 Ga0307416_103222380 3300032002 Bacteria 546
253 Ga0307414_10457243 3300032004 Bacteria 1121
254 Ga0307411_10398597 3300032005 Bacteria 1137
255 Ga0307415_100790575 3300032126 Bacteria 865
256 Ga0373958_0039246 3300034819 Bacteria 962
257 Ga0373928_0013910 3300035084 Bacteria 1620
258 Ga0373956_0072764 3300035119 Bacteria 1570
259 Ga0395900_0212206 3300037418 Bacteria 1954
260 Ga0395898_0077816 3300037466 Bacteria 3201
261 Ga0436364_0172492 3300037853 Bacteria 1150
262 Ga0395901_0153537 3300038443 Bacteria 2418
263 Ga0400489_12814 3300039093 Bacteria 4771
264 Ga0450913_021970 3300042117 Bacteria 591
265 Ga0450890_061711 3300042127 Bacteria 588
266 Ga0439459_0045030 3300042438 Bacteria 951
267 Ga0495592_0207381 3300046454 Bacteria 1318
268 Ga0495638_0003041 3300046460 Bacteria 13361
269 Ga0495605_0043537 3300046474 Bacteria 2225
270 Ga0495584_0017223 3300046491 Bacteria 3682
271 Ga0495663_0010587 3300046525 Bacteria 2566
272 Ga0495598_0128911 3300046537 Bacteria 865
273 Ga0495667_0139975 3300046559 Bacteria 1560
274 Ga0495588_0206237 3300046674 Bacteria 1038
275 Ga0495589_0059381 3300046794 Bacteria 1880
276 Ga0495672_0106808 3300047320 Bacteria 1509
277 Ga0496100_0043110 3300048903 Bacteria 2885
278 Ga0496100_0292299 3300048903 Bacteria 1218
279 Ga0496101_0176525 3300048904 Bacteria 1643
280 Ga0496101_0730182 3300048904 Bacteria 782
281 Ga0496101_1238497 3300048904 Bacteria 584
282 Ga0496102_0171047 3300048905 Bacteria 2045
283 Ga0496102_0376243 3300048905 Bacteria 1337
284 Ga0496103_0027306 3300048906 Bacteria 3458
285 Ga0496104_0073313 3300048907 Bacteria 3257
286 Ga0496104_0103330 3300048907 Bacteria 2730
287 Ga0496105_0000707 3300048908 Bacteria 22599
288 Ga0496106_0058271 3300048909 Bacteria 2924
289 Ga0496106_0176430 3300048909 Bacteria 1695
290 Ga0496107_0037816 3300048910 Bacteria 3464
291 Ga0496107_0174194 3300048910 Bacteria 1597
292 Ga0496107_0424244 3300048910 Bacteria 989
293 Ga0496108_0003990 3300048911 Bacteria 11846
294 Ga0496108_0028354 3300048911 Bacteria 4632
295 Ga0496108_0107963 3300048911 Bacteria 2377
296 Ga0496108_0291363 3300048911 Bacteria 1421
297 Ga0496108_0461444 3300048911 Bacteria 1110
298 Ga0496109_0008372 3300048912 Bacteria 8788
299 Ga0496109_0024763 3300048912 Bacteria 5338
300 Ga0496109_0106829 3300048912 Bacteria 2600
301 Ga0496109_0232920 3300048912 Bacteria 1733
302 Ga0496110_0058143 3300048913 Bacteria 3405
303 Ga0496110_0910404 3300048913 Bacteria 786
304 Ga0496110_1147476 3300048913 Bacteria 685
305 Ga0496111_0066503 3300048914 Bacteria 2618
306 Ga0496112_0004743 3300048915 Bacteria 11586
307 Ga0496112_0006836 3300048915 Bacteria 10054
308 Ga0496112_0329080 3300048915 Bacteria 1472
309 Ga0496113_0170342 3300048916 Bacteria 1724
310 Ga0496114_0045212 3300048917 Bacteria 3657
311 Ga0496115_0037425 3300048918 Bacteria 3845
312 Ga0496126_0231080 3300048929 Bacteria 1550
313 Ga0501034_0149016 3300049571 Bacteria 2316
314 Ga0501034_0292126 3300049571 Bacteria 1568
315 Ga0501036_0118001 3300049572 Unclassified 2241
316 Ga0501038_0153997 3300049574 Unclassified 1873
317 Ga0501042_0012003 3300049578 Bacteria 5858
318 Ga0501042_0119351 3300049578 Bacteria 1899
319 Ga0501048_0315182 3300049582 Bacteria 1114
320 Ga0501067_0145583 3300049583 Bacteria 1320
321 Ga0501071_0114883 3300049587 Unclassified 1992
322 Ga0501074_0349957 3300049590 Bacteria 1049
323 Ga0501077_0106155 3300049593 Unclassified 1780
324 Ga0501077_0318685 3300049593 Bacteria 991
325 Ga0501079_0172561 3300049741 Unclassified 1686
326 Ga0501080_0538202 3300049742 Unclassified 1041
327 Ga0501081_0029868 3300049743 Unclassified 3685
328 Ga0501081_0224121 3300049743 Bacteria 1368
329 Ga0501081_0485698 3300049743 Bacteria 920
330 Ga0501083_0421851 3300049744 Bacteria 868
331 Ga0501035_0780221 3300049822 Unclassified 765
332 Ga0501045_0162581 3300049824 Unclassified 1662
333 nmdc:mga00v17_146037_c1 3300050491 Bacteria 1518
334 nmdc:mga0yw44_3603_c1 3300050492 Bacteria 6909
335 nmdc:mga05p37_1110793_c1 3300050507 Bacteria 827
336 nmdc:mga05p37_132481_c2 3300050507 Bacteria 1781
337 nmdc:mga08y16_30_c1 3300050511 Bacteria 197110
338 nmdc:mga08y16_419911_c1 3300050511 Bacteria 1367
339 nmdc:mga0n895_215252_c1 3300050512 Bacteria 1951
340 nmdc:mga0rr50_886673_c1 3300050513 Bacteria 761
341 nmdc:mga0a205_378456_c1 3300050515 Bacteria 1281
342 Ga0495619_0027742 3300053085 Bacteria 3650
343 Ga0495619_0399660 3300053085 Bacteria 949
344 Ga0500592_001954 3300053116 Bacteria 3311
345 Ga0500658_0121014 3300053134 Bacteria 1160
346 Ga0500568_0219118 3300053139 Bacteria 695
347 Ga0500577_0143240 3300053142 Bacteria 1009
348 Ga0500577_0174070 3300053142 Bacteria 922
349 Ga0501084_0015930 3300054114 Bacteria 6237
350 Ga0501084_1165992 3300054114 Bacteria 646
351 Ga0501082_0196803 3300060353 Unclassified 1753
352 Ga0530510_0121695 3300061734 Bacteria 1916

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031251 Ga0265327_10004193 Ga0265327_1000419312 160
2 3300003320 rootH2_10024030 rootH2_100240302 163
3 3300005344 Ga0070661_100165473 Ga0070661_1001654732 163
4 3300005455 Ga0070663_100038812 Ga0070663_1000388123 163
5 3300005535 Ga0070684_100064419 Ga0070684_1000644194 163
6 3300005539 Ga0068853_100028919 Ga0068853_1000289193 163
7 3300005548 Ga0070665_100038518 Ga0070665_1000385182 163
8 3300005563 Ga0068855_100251414 Ga0068855_1002514142 163
9 3300005577 Ga0068857_100008746 Ga0068857_1000087463 163
10 3300005614 Ga0068856_100068418 Ga0068856_1000684184 163
11 3300005616 Ga0068852_100098089 Ga0068852_1000980894 163
12 3300006358 Ga0068871_100112815 Ga0068871_1001128152 163
13 3300009093 Ga0105240_10067583 Ga0105240_100675834 163
14 3300009098 Ga0105245_10165825 Ga0105245_101658252 163
15 3300009174 Ga0105241_10010389 Ga0105241_100103897 163
16 3300009177 Ga0105248_10624676 Ga0105248_106246762 163
17 3300009551 Ga0105238_10012617 Ga0105238_100126177 163
18 3300010375 Ga0105239_10008773 Ga0105239_100087736 163
19 3300013296 Ga0157374_10261107 Ga0157374_102611072 163
20 3300013297 Ga0157378_10095413 Ga0157378_100954132 163
21 3300013307 Ga0157372_10701842 Ga0157372_107018422 163
22 3300014969 Ga0157376_10043871 Ga0157376_100438713 163
23 3300005328 Ga0070676_10131841 Ga0070676_101318413 164
24 3300005330 Ga0070690_100139509 Ga0070690_1001395093 164
25 3300005334 Ga0068869_100134288 Ga0068869_1001342882 164
26 3300005335 Ga0070666_10060834 Ga0070666_100608342 164
27 3300005340 Ga0070689_100062696 Ga0070689_1000626963 164
28 3300005343 Ga0070687_100594962 Ga0070687_1005949621 164
29 3300005347 Ga0070668_100034798 Ga0070668_1000347984 164
30 3300005353 Ga0070669_100090683 Ga0070669_1000906832 164
31 3300005354 Ga0070675_100042836 Ga0070675_1000428362 164
32 3300005355 Ga0070671_100039385 Ga0070671_1000393853 164
33 3300005356 Ga0070674_100150480 Ga0070674_1001504802 164
34 3300005364 Ga0070673_100003812 Ga0070673_1000038128 164
35 3300005365 Ga0070688_100016534 Ga0070688_1000165345 164
36 3300005367 Ga0070667_100098253 Ga0070667_1000982533 164
37 3300005456 Ga0070678_100032214 Ga0070678_1000322145 164
38 3300005457 Ga0070662_100470130 Ga0070662_1004701302 164
39 3300005459 Ga0068867_100035074 Ga0068867_1000350742 164
40 3300005459 Ga0068867_100819337 Ga0068867_1008193372 164
41 3300005466 Ga0070685_10304627 Ga0070685_103046272 164
42 3300005543 Ga0070672_100072962 Ga0070672_1000729623 164
43 3300005543 Ga0070672_100167729 Ga0070672_1001677292 164
44 3300005617 Ga0068859_100136670 Ga0068859_1001366703 164
45 3300005618 Ga0068864_100117966 Ga0068864_1001179662 164
46 3300005719 Ga0068861_100142669 Ga0068861_1001426692 164
47 3300005719 Ga0068861_100829990 Ga0068861_1008299901 164
48 3300005834 Ga0068851_10022877 Ga0068851_100228774 164
49 3300005841 Ga0068863_100006356 Ga0068863_10000635610 164
50 3300005842 Ga0068858_100002811 Ga0068858_1000028113 164
51 3300005843 Ga0068860_100123593 Ga0068860_1001235931 164
52 3300005844 Ga0068862_100236108 Ga0068862_1002361083 164
53 3300006237 Ga0097621_100076061 Ga0097621_1000760613 164
54 3300006358 Ga0068871_100034856 Ga0068871_1000348565 164
55 3300006931 Ga0097620_100136670 Ga0097620_1001366703 164
56 3300009176 Ga0105242_11375078 Ga0105242_113750782 164
57 3300009177 Ga0105248_10005428 Ga0105248_100054283 164
58 3300009553 Ga0105249_11077741 Ga0105249_110777412 164
59 3300013296 Ga0157374_10045456 Ga0157374_100454563 164
60 3300013297 Ga0157378_10253598 Ga0157378_102535982 164
61 3300013306 Ga0163162_10002542 Ga0163162_1000254216 164
62 3300013306 Ga0163162_10384953 Ga0163162_103849531 164
63 3300013308 Ga0157375_10004280 Ga0157375_100042809 164
64 3300014325 Ga0163163_10031699 Ga0163163_100316992 164
65 3300014326 Ga0157380_10098791 Ga0157380_100987912 164
66 3300014326 Ga0157380_10270382 Ga0157380_102703821 164
67 3300014968 Ga0157379_10178570 Ga0157379_101785702 164
68 3300014968 Ga0157379_10257159 Ga0157379_102571591 164
69 3300014969 Ga0157376_10199979 Ga0157376_101999792 164
70 3300017792 Ga0163161_10734420 Ga0163161_107344202 164
71 3300025321 Ga0207656_10022691 Ga0207656_100226913 164
72 3300025899 Ga0207642_10051228 Ga0207642_100512282 164
73 3300025903 Ga0207680_10007774 Ga0207680_100077745 164
74 3300025907 Ga0207645_10139315 Ga0207645_101393152 164
75 3300025918 Ga0207662_10595924 Ga0207662_105959241 164
76 3300025923 Ga0207681_10133030 Ga0207681_101330302 164
77 3300025926 Ga0207659_10011542 Ga0207659_100115425 164
78 3300025931 Ga0207644_10036704 Ga0207644_100367043 164
79 3300025936 Ga0207670_10069032 Ga0207670_100690322 164
80 3300025940 Ga0207691_10017863 Ga0207691_100178633 164
81 3300025940 Ga0207691_10132337 Ga0207691_101323372 164
82 3300025941 Ga0207711_10006474 Ga0207711_100064748 164
83 3300025942 Ga0207689_10135612 Ga0207689_101356122 164
84 3300025960 Ga0207651_10008528 Ga0207651_100085283 164
85 3300025986 Ga0207658_10132394 Ga0207658_101323942 164
86 3300026035 Ga0207703_10019243 Ga0207703_100192435 164
87 3300026067 Ga0207678_10446483 Ga0207678_104464832 164
88 3300026088 Ga0207641_10057098 Ga0207641_100570983 164
89 3300026089 Ga0207648_10009696 Ga0207648_100096966 164
90 3300026089 Ga0207648_10714344 Ga0207648_107143442 164
91 3300026095 Ga0207676_10041061 Ga0207676_100410614 164
92 3300026118 Ga0207675_100018767 Ga0207675_1000187675 164
93 3300026118 Ga0207675_100748422 Ga0207675_1007484222 164
94 3300026121 Ga0207683_10006335 Ga0207683_100063358 164
95 3300028379 Ga0268266_10856708 Ga0268266_108567081 164
96 3300028381 Ga0268264_11817239 Ga0268264_118172391 164
97 3300034819 Ga0373958_0039246 Ga0373958_0039246_319_813 164
98 3300035084 Ga0373928_0013910 Ga0373928_0013910_316_810 164
99 3300046537 Ga0495598_0128911 Ga0495598_0128911_201_695 164
100 3300048904 Ga0496101_0730182 Ga0496101_0730182_61_555 164
101 3300048905 Ga0496102_0171047 Ga0496102_0171047_1318_1812 164
102 3300048909 Ga0496106_0058271 Ga0496106_0058271_124_618 164
103 3300048910 Ga0496107_0174194 Ga0496107_0174194_237_731 164
104 3300048911 Ga0496108_0107963 Ga0496108_0107963_1017_1511 164
105 3300049571 Ga0501034_0149016 Ga0501034_0149016_1000_1497 164
106 3300049574 Ga0501038_0153997 Ga0501038_0153997_163_741 164
107 3300049741 Ga0501079_0172561 Ga0501079_0172561_905_1483 164
108 iso_pu_bacteria 2599185301 2599937194 165
109 iso_pu_bacteria 2888337043 2888337618 165
110 iso_pu_bacteria 2958064165 2958070196 165
111 3300005615 Ga0070702_100469534 Ga0070702_1004695342 166
112 3300035119 Ga0373956_0072764 Ga0373956_0072764_1049_1549 166
113 3300046794 Ga0495589_0059381 Ga0495589_0059381_428_928 166
114 3300005354 Ga0070675_101635526 Ga0070675_1016355261 167
115 3300006038 Ga0075365_10453413 Ga0075365_104534132 167
116 3300031911 Ga0307412_11092814 Ga0307412_110928141 167
117 3300048912 Ga0496109_0232920 Ga0496109_0232920_117_623 167
118 3300048913 Ga0496110_0910404 Ga0496110_0910404_78_584 167
119 3300049572 Ga0501036_0118001 Ga0501036_0118001_1034_1621 167
120 3300049578 Ga0501042_0012003 Ga0501042_0012003_868_1455 167
121 3300049582 Ga0501048_0315182 Ga0501048_0315182_166_753 167
122 3300049587 Ga0501071_0114883 Ga0501071_0114883_1001_1588 167
123 3300049590 Ga0501074_0349957 Ga0501074_0349957_113_700 167
124 3300049593 Ga0501077_0106155 Ga0501077_0106155_343_930 167
125 3300049742 Ga0501080_0538202 Ga0501080_0538202_205_792 167
126 3300049743 Ga0501081_0029868 Ga0501081_0029868_2073_2660 167
127 3300049822 Ga0501035_0780221 Ga0501035_0780221_40_627 167
128 3300049824 Ga0501045_0162581 Ga0501045_0162581_258_845 167
129 3300054114 Ga0501084_0015930 Ga0501084_0015930_63_650 167
130 3300060353 Ga0501082_0196803 Ga0501082_0196803_880_1467 167
131 3300005340 Ga0070689_100186988 Ga0070689_1001869882 168
132 3300005347 Ga0070668_101621002 Ga0070668_1016210021 168
133 3300005353 Ga0070669_100262674 Ga0070669_1002626742 168
134 3300005441 Ga0070700_100044368 Ga0070700_1000443683 168
135 3300005545 Ga0070695_100295638 Ga0070695_1002956383 168
136 3300005937 Ga0081455_10173844 Ga0081455_101738442 168
137 3300005937 Ga0081455_10495968 Ga0081455_104959682 168
138 3300006844 Ga0075428_100247218 Ga0075428_1002472182 168
139 3300006844 Ga0075428_100750758 Ga0075428_1007507581 168
140 3300006846 Ga0075430_100000276 Ga0075430_10000027624 168
141 3300009094 Ga0111539_12578746 Ga0111539_125787461 168
142 3300009147 Ga0114129_10406824 Ga0114129_104068243 168
143 3300009148 Ga0105243_11126980 Ga0105243_111269802 168
144 3300009553 Ga0105249_10513050 Ga0105249_105130501 168
145 3300024225 Ga0224572_1004446 Ga0224572_10044463 168
146 3300025304 Ga0209257_1000391 Ga0209257_100039148 168
147 3300025923 Ga0207681_10529154 Ga0207681_105291542 168
148 3300031090 Ga0265760_10039397 Ga0265760_100393973 168
149 3300031456 Ga0307513_10038819 Ga0307513_100388194 168
150 3300031456 Ga0307513_10149367 Ga0307513_101493673 168
151 3300032002 Ga0307416_100875906 Ga0307416_1008759062 168
152 3300032002 Ga0307416_103222380 Ga0307416_1032223801 168
153 3300032126 Ga0307415_100790575 Ga0307415_1007905752 168
154 3300048903 Ga0496100_0292299 Ga0496100_0292299_285_791 168
155 3300048904 Ga0496101_1238497 Ga0496101_1238497_64_570 168
156 3300048905 Ga0496102_0376243 Ga0496102_0376243_485_991 168
157 3300048907 Ga0496104_0103330 Ga0496104_0103330_1327_1833 168
158 3300048910 Ga0496107_0424244 Ga0496107_0424244_417_926 168
159 3300048911 Ga0496108_0461444 Ga0496108_0461444_304_810 168
160 3300048915 Ga0496112_0329080 Ga0496112_0329080_956_1462 168
161 3300048929 Ga0496126_0231080 Ga0496126_0231080_377_883 168
162 3300049571 Ga0501034_0292126 Ga0501034_0292126_184_690 168
163 3300049578 Ga0501042_0119351 Ga0501042_0119351_838_1344 168
164 3300053134 Ga0500658_0121014 Ga0500658_0121014_22_528 168
165 3300053139 Ga0500568_0219118 Ga0500568_0219118_40_546 168
166 3300005295 Ga0065707_10103182 Ga0065707_101031823 169
167 3300005981 Ga0081538_10014917 Ga0081538_100149174 169
168 3300006846 Ga0075430_100417961 Ga0075430_1004179611 169
169 3300009094 Ga0111539_10000273 Ga0111539_1000027325 169
170 3300010159 Ga0099796_10000246 Ga0099796_1000024611 169
171 3300025936 Ga0207670_10896450 Ga0207670_108964501 169
172 3300025937 Ga0207669_10629543 Ga0207669_106295432 169
173 3300026118 Ga0207675_100752908 Ga0207675_1007529082 169
174 3300027907 Ga0207428_10000053 Ga0207428_1000005355 169
175 3300031995 Ga0307409_100710974 Ga0307409_1007109742 169
176 3300039093 Ga0400489_12814 Ga0400489_12814_4134_4643 169
177 3300042127 Ga0450890_061711 Ga0450890_061711_26_535 169
178 3300046525 Ga0495663_0010587 Ga0495663_0010587_488_1000 169
179 3300048911 Ga0496108_0028354 Ga0496108_0028354_2004_2537 169
180 3300048912 Ga0496109_0024763 Ga0496109_0024763_1293_1826 169
181 3300048913 Ga0496110_0058143 Ga0496110_0058143_2050_2583 169
182 3300048914 Ga0496111_0066503 Ga0496111_0066503_2050_2583 169
183 3300048915 Ga0496112_0006836 Ga0496112_0006836_2050_2583 169
184 3300048916 Ga0496113_0170342 Ga0496113_0170342_1149_1682 169
185 3300050511 nmdc:mga08y16_30_c1 nmdc:mga08y16_30_c1_171793_172302 169
186 3300050515 nmdc:mga0a205_378456_c1 nmdc:mga0a205_378456_c1_741_1250 169
187 3300053116 Ga0500592_001954 Ga0500592_001954_1870_2382 169
188 3300053142 Ga0500577_0143240 Ga0500577_0143240_161_673 169
189 3300005353 Ga0070669_100181647 Ga0070669_1001816472 170
190 3300031995 Ga0307409_100050142 Ga0307409_1000501422 170
191 3300032004 Ga0307414_10457243 Ga0307414_104572432 170
192 3300032005 Ga0307411_10398597 Ga0307411_103985972 170
193 3300046491 Ga0495584_0017223 Ga0495584_0017223_983_1516 170
194 3300053142 Ga0500577_0174070 Ga0500577_0174070_36_560 170
195 3300005295 Ga0065707_10000450 Ga0065707_1000045028 171
196 3300005614 Ga0068856_101598679 Ga0068856_1015986791 171
197 3300014326 Ga0157380_10000130 Ga0157380_100001303 171
198 3300026078 Ga0207702_11927424 Ga0207702_119274241 171
199 3300031250 Ga0265331_10093933 Ga0265331_100939332 171
200 3300031691 Ga0316579_10012156 Ga0316579_100121562 171
201 3300037418 Ga0395900_0212206 Ga0395900_0212206_212_748 171
202 3300037466 Ga0395898_0077816 Ga0395898_0077816_1118_1654 171
203 3300037853 Ga0436364_0172492 Ga0436364_0172492_87_614 171
204 3300038443 Ga0395901_0153537 Ga0395901_0153537_823_1359 171
205 3300042117 Ga0450913_021970 Ga0450913_021970_34_555 171
206 3300049743 Ga0501081_0485698 Ga0501081_0485698_43_567 171
207 3300005331 Ga0070670_100049669 Ga0070670_1000496694 172
208 3300005337 Ga0070682_100374932 Ga0070682_1003749322 172
209 3300005340 Ga0070689_100353671 Ga0070689_1003536712 172
210 3300005367 Ga0070667_100200655 Ga0070667_1002006551 172
211 3300005438 Ga0070701_10385150 Ga0070701_103851501 172
212 3300005440 Ga0070705_100290320 Ga0070705_1002903202 172
213 3300005445 Ga0070708_101067049 Ga0070708_1010670491 172
214 3300005455 Ga0070663_100153384 Ga0070663_1001533842 172
215 3300005543 Ga0070672_100244430 Ga0070672_1002444303 172
216 3300005544 Ga0070686_100166192 Ga0070686_1001661922 172
217 3300005615 Ga0070702_100092317 Ga0070702_1000923172 172
218 3300005617 Ga0068859_100255821 Ga0068859_1002558213 172
219 3300005719 Ga0068861_100019345 Ga0068861_1000193452 172
220 3300005844 Ga0068862_100213382 Ga0068862_1002133822 172
221 3300006051 Ga0075364_10365226 Ga0075364_103652262 172
222 3300006173 Ga0070716_100411966 Ga0070716_1004119662 172
223 3300006237 Ga0097621_100413925 Ga0097621_1004139251 172
224 3300006844 Ga0075428_100073907 Ga0075428_1000739074 172
225 3300006844 Ga0075428_100278509 Ga0075428_1002785093 172
226 3300006871 Ga0075434_100598701 Ga0075434_1005987012 172
227 3300006881 Ga0068865_100329885 Ga0068865_1003298852 172
228 3300006881 Ga0068865_101099143 Ga0068865_1010991432 172
229 3300006931 Ga0097620_100255812 Ga0097620_1002558122 172
230 3300009147 Ga0114129_10645046 Ga0114129_106450462 172
231 3300009148 Ga0105243_10040116 Ga0105243_100401162 172
232 3300009176 Ga0105242_10671822 Ga0105242_106718221 172
233 3300009177 Ga0105248_10362687 Ga0105248_103626872 172
234 3300009553 Ga0105249_10213387 Ga0105249_102133872 172
235 3300013297 Ga0157378_10430553 Ga0157378_104305532 172
236 3300013306 Ga0163162_10460219 Ga0163162_104602192 172
237 3300013308 Ga0157375_10014491 Ga0157375_100144919 172
238 3300014968 Ga0157379_10073025 Ga0157379_100730254 172
239 3300014969 Ga0157376_10201268 Ga0157376_102012682 172
240 3300017792 Ga0163161_10039181 Ga0163161_100391814 172
241 3300025906 Ga0207699_10558221 Ga0207699_105582211 172
242 3300025923 Ga0207681_10397810 Ga0207681_103978101 172
243 3300025925 Ga0207650_10118733 Ga0207650_101187334 172
244 3300025934 Ga0207686_10735581 Ga0207686_107355811 172
245 3300025935 Ga0207709_10018621 Ga0207709_100186212 172
246 3300025936 Ga0207670_10286350 Ga0207670_102863502 172
247 3300025938 Ga0207704_10017244 Ga0207704_100172444 172
248 3300025940 Ga0207691_10301643 Ga0207691_103016433 172
249 3300025941 Ga0207711_10363705 Ga0207711_103637052 172
250 3300025981 Ga0207640_10114633 Ga0207640_101146331 172
251 3300025986 Ga0207658_10370367 Ga0207658_103703673 172
252 3300026067 Ga0207678_10548503 Ga0207678_105485031 172
253 3300026089 Ga0207648_10155938 Ga0207648_101559383 172
254 3300026118 Ga0207675_100011463 Ga0207675_1000114635 172
255 3300028380 Ga0268265_10036844 Ga0268265_100368442 172
256 3300028381 Ga0268264_10156306 Ga0268264_101563062 172
257 3300031241 Ga0265325_10009859 Ga0265325_100098593 172
258 3300031665 Ga0316575_10049991 Ga0316575_100499912 172
259 3300031995 Ga0307409_101776622 Ga0307409_1017766222 172
260 3300046460 Ga0495638_0003041 Ga0495638_0003041_10614_11153 172
261 3300046559 Ga0495667_0139975 Ga0495667_0139975_445_975 172
262 3300047320 Ga0495672_0106808 Ga0495672_0106808_878_1417 172
263 3300048903 Ga0496100_0043110 Ga0496100_0043110_2230_2763 172
264 3300048904 Ga0496101_0176525 Ga0496101_0176525_277_810 172
265 3300048907 Ga0496104_0073313 Ga0496104_0073313_1790_2323 172
266 3300048909 Ga0496106_0176430 Ga0496106_0176430_278_811 172
267 3300048910 Ga0496107_0037816 Ga0496107_0037816_1985_2518 172
268 3300048911 Ga0496108_0003990 Ga0496108_0003990_8348_8887 172
269 3300048911 Ga0496108_0291363 Ga0496108_0291363_535_1068 172
270 3300048912 Ga0496109_0106829 Ga0496109_0106829_164_697 172
271 3300048913 Ga0496110_1147476 Ga0496110_1147476_83_622 172
272 3300048917 Ga0496114_0045212 Ga0496114_0045212_936_1469 172
273 3300048918 Ga0496115_0037425 Ga0496115_0037425_1517_2050 172
274 3300049583 Ga0501067_0145583 Ga0501067_0145583_499_1038 172
275 3300049744 Ga0501083_0421851 Ga0501083_0421851_12_533 172
276 3300050491 nmdc:mga00v17_146037_c1 nmdc:mga00v17_146037_c1_166_708 172
277 3300050492 nmdc:mga0yw44_3603_c1 nmdc:mga0yw44_3603_c1_520_1062 172
278 3300050507 nmdc:mga05p37_1110793_c1 nmdc:mga05p37_1110793_c1_252_791 172
279 3300054114 Ga0501084_1165992 Ga0501084_1165992_24_563 172
280 3300061734 Ga0530510_0121695 Ga0530510_0121695_212_751 172
281 3300005290 Ga0065712_10177548 Ga0065712_101775482 173
282 3300005331 Ga0070670_100010203 Ga0070670_1000102035 173
283 3300005331 Ga0070670_100100675 Ga0070670_1001006752 173
284 3300005334 Ga0068869_100159929 Ga0068869_1001599292 173
285 3300005338 Ga0068868_100502413 Ga0068868_1005024132 173
286 3300005340 Ga0070689_100155551 Ga0070689_1001555512 173
287 3300005343 Ga0070687_100156712 Ga0070687_1001567122 173
288 3300005343 Ga0070687_100618898 Ga0070687_1006188981 173
289 3300005353 Ga0070669_100767095 Ga0070669_1007670952 173
290 3300005354 Ga0070675_101055677 Ga0070675_1010556772 173
291 3300005364 Ga0070673_100912559 Ga0070673_1009125592 173
292 3300005364 Ga0070673_101131838 Ga0070673_1011318382 173
293 3300005539 Ga0068853_101636604 Ga0068853_1016366041 173
294 3300005564 Ga0070664_100468371 Ga0070664_1004683712 173
295 3300005616 Ga0068852_101286009 Ga0068852_1012860092 173
296 3300005617 Ga0068859_100059400 Ga0068859_1000594004 173
297 3300005618 Ga0068864_100041179 Ga0068864_1000411792 173
298 3300005842 Ga0068858_100092576 Ga0068858_1000925763 173
299 3300005843 Ga0068860_100164355 Ga0068860_1001643552 173
300 3300005937 Ga0081455_10001657 Ga0081455_1000165726 173
301 3300005937 Ga0081455_10261261 Ga0081455_102612611 173
302 3300005981 Ga0081538_10044923 Ga0081538_100449235 173
303 3300006358 Ga0068871_100123007 Ga0068871_1001230072 173
304 3300006844 Ga0075428_100310512 Ga0075428_1003105121 173
305 3300006931 Ga0097620_100059400 Ga0097620_1000594004 173
306 3300009101 Ga0105247_10029610 Ga0105247_100296103 173
307 3300009148 Ga0105243_10017778 Ga0105243_100177782 173
308 3300009174 Ga0105241_10145104 Ga0105241_101451042 173
309 3300009551 Ga0105238_10318525 Ga0105238_103185252 173
310 3300011119 Ga0105246_10056167 Ga0105246_100561672 173
311 3300013306 Ga0163162_10618389 Ga0163162_106183892 173
312 3300014325 Ga0163163_10004598 Ga0163163_100045987 173
313 3300014325 Ga0163163_10078160 Ga0163163_100781604 173
314 3300014968 Ga0157379_10351652 Ga0157379_103516522 173
315 3300025906 Ga0207699_10143179 Ga0207699_101431791 173
316 3300025908 Ga0207643_10031163 Ga0207643_100311634 173
317 3300025912 Ga0207707_11013001 Ga0207707_110130012 173
318 3300025918 Ga0207662_10018188 Ga0207662_100181882 173
319 3300025924 Ga0207694_10301913 Ga0207694_103019132 173
320 3300025925 Ga0207650_10005392 Ga0207650_100053927 173
321 3300025925 Ga0207650_10268666 Ga0207650_102686662 173
322 3300025926 Ga0207659_10656771 Ga0207659_106567712 173
323 3300025936 Ga0207670_10299038 Ga0207670_102990382 173
324 3300025938 Ga0207704_11054514 Ga0207704_110545142 173
325 3300025942 Ga0207689_10083896 Ga0207689_100838963 173
326 3300025960 Ga0207651_10780002 Ga0207651_107800022 173
327 3300026035 Ga0207703_10130980 Ga0207703_101309802 173
328 3300026041 Ga0207639_10574996 Ga0207639_105749962 173
329 3300026095 Ga0207676_10251996 Ga0207676_102519962 173
330 3300026116 Ga0207674_10025848 Ga0207674_100258486 173
331 3300028381 Ga0268264_10102009 Ga0268264_101020093 173
332 3300042438 Ga0439459_0045030 Ga0439459_0045030_348_890 173
333 3300046454 Ga0495592_0207381 Ga0495592_0207381_638_1177 173
334 3300046474 Ga0495605_0043537 Ga0495605_0043537_732_1274 173
335 3300048906 Ga0496103_0027306 Ga0496103_0027306_1942_2484 173
336 3300048908 Ga0496105_0000707 Ga0496105_0000707_1908_2450 173
337 3300048912 Ga0496109_0008372 Ga0496109_0008372_2329_2871 173
338 3300048915 Ga0496112_0004743 Ga0496112_0004743_10824_11366 173
339 3300049593 Ga0501077_0318685 Ga0501077_0318685_206_748 173
340 3300049743 Ga0501081_0224121 Ga0501081_0224121_489_1031 173
341 3300050512 nmdc:mga0n895_215252_c1 nmdc:mga0n895_215252_c1_976_1515 173
342 3300053085 Ga0495619_0027742 Ga0495619_0027742_1113_1655 173
343 3300046674 Ga0495588_0206237 Ga0495588_0206237_396_944 174
344 3300050513 nmdc:mga0rr50_886673_c1 nmdc:mga0rr50_886673_c1_66_662 174
345 3300053085 Ga0495619_0399660 Ga0495619_0399660_323_910 174
346 3300005293 Ga0065715_10231152 Ga0065715_102311522 175
347 3300005295 Ga0065707_10213936 Ga0065707_102139362 175
348 3300005331 Ga0070670_100783618 Ga0070670_1007836181 175
349 3300005354 Ga0070675_100428886 Ga0070675_1004288861 175
350 3300009147 Ga0114129_10154656 Ga0114129_101546563 175
351 3300025961 Ga0207712_10042741 Ga0207712_100427412 175
352 3300050507 nmdc:mga05p37_132481_c2 nmdc:mga05p37_132481_c2_38_634 175
353 3300050511 nmdc:mga08y16_419911_c1 nmdc:mga08y16_419911_c1_487_1083 175
354 2162886012 MBSR1b_contig_8066827 MBSR1b_0596.00002150 179
355 3300009553 Ga0105249_10028354 Ga0105249_100283544 179

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01451

LMWPc

Low molecular weight phosphotyrosine protein phosphatase

43

177

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p6m-assembly1.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus 0.9407 10 148
8p6m-assembly1.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus 0.9202 10 148
8p6m-assembly1.cif.gz_A arsenate reductase (arsc2) from deinococcus indicus 0.9125 10 153
8p5n-assembly2.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus, co-crystallized with arsenate 0.9047 10 148
8p6m-assembly1.cif.gz_A arsenate reductase (arsc2) from deinococcus indicus 0.899 10 153
ID Description Score Start End Superfamily
1jl3B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8914 10 146 3.40.50.2300
1jl3C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8589 11 146 3.40.50.2300
1y1lA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8562 12 148 3.40.50.2300
1jl3B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.855 10 146 3.40.50.2300
2myuA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8501 9 146 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A6G6WN77-F1-model_v4 Arsenate reductase ArsC 0.9967 7 168 GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-A0A1F4ARG2-F1-model_v4 Phosphotyrosine protein phosphatase I domain-containing protein 0.9938 9 169 GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-A0A1Q3JQI2-F1-model_v4 ArsR family transcriptional regulator 0.9925 7 149 GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-A0A434U3P1-F1-model_v4 Arsenate reductase ArsC 0.992 6 167 GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-A0A0P1EPZ7-F1-model_v4 Arsenate reductase (EC 1.20.4.-) 0.9906 6 170 GO:0004726
GO:0016491
GO:0030946
GO:0046685
GO:0140793

Feature Viewer

pLDDT pTM Quality
89.02 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map