F420189

General Info

Members Datasets Scaffolds Average Seq Length
355 268 710 112

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100523907|Ga0307408_1005239072
Length 121
Sequence MSALPMNSTDSLDWTDICAVDDILPNTGVCALVADLHVAVFRTGSDQFFAIDNVDPKSGASVLSRGLIGSLSGRVVVASPLYKNHFDLQTGECLEMPEHSVRTYSVRAVRGRVSVACAPAA

Samples

Sample ID Description Type Environment
1 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
4 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
5 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
44 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
64 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
65 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
66 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
73 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
102 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
107 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
108 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
109 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
110 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
111 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
112 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
116 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
117 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
118 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
119 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
120 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
121 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
122 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
123 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
124 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
125 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
128 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
129 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
130 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
131 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
132 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
133 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
134 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
135 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
136 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
137 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
138 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
139 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
140 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
141 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
142 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
143 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
144 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
145 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
146 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
147 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
148 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
149 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
150 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
151 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
152 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
153 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
154 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
155 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
156 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
157 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
158 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
159 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
160 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
161 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
162 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
163 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
164 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
165 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
166 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
167 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
168 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
169 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
170 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
171 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
172 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
173 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
174 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
175 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
176 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
177 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
178 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
179 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
180 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
181 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
182 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
183 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
184 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
185 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
186 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
201 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
202 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
203 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
204 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
205 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
206 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
207 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
208 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
209 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
211 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
212 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
213 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
214 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
215 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
216 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
218 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
219 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
220 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
221 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
222 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
223 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
224 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
225 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
226 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
227 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
228 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
229 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
230 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
231 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
232 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
233 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
234 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
235 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
236 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
237 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
238 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
239 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
240 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
241 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
242 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
243 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
244 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
245 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
246 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
247 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
248 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
249 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
250 2547132374 Acidovorax radicis N35 Isolate Unclassified
251 2643221609 Acidovorax sp. Root217 Isolate Unclassified
252 2643221611 Acidovorax sp. Root219 Isolate Unclassified
253 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
254 2643221658 Variovorax sp. Root411 Isolate Unclassified
255 2643221672 Variovorax sp. Root434 Isolate Unclassified
256 2643221683 Variovorax sp. Root473 Isolate Unclassified
257 2643221717 Acidovorax sp. Root267 Isolate Unclassified
258 2738541277 Variovorax sp. GV051 Isolate Unclassified
259 2738541307 Variovorax sp. GV008 Isolate Unclassified
260 2738543012 Acidovorax sp. CF301 Isolate Unclassified
261 2738543013 Variovorax sp. BT01 Isolate Unclassified
262 2738543019 Variovorax sp. GV040 Isolate Unclassified
263 2816332133 Acidovorax radicis 2721A Isolate Unclassified
264 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
265 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
266 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
267 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
268 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.8
Metatranscriptomes 0.56
Isolates 5.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.59
Nodule 0.56
Rhizoplane 7.89
Rhizosphere 61.69
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307408_100523907 3300031548 Bacteria 1041
2 JGI25151J46595_10008387 3300003187 Bacteria 4974
3 JGI25151J46595_10119379 3300003187 Bacteria 674
4 Ga0055524_1000097 3300003775 Bacteria 108145
5 Ga0055536_1000866 3300003781 Bacteria 19673
6 Ga0055536_1011456 3300003781 Bacteria 3400
7 Ga0055534_1001970 3300003784 Bacteria 7513
8 Ga0055534_1025278 3300003784 Bacteria 955
9 Ga0055530_10000258 3300003791 Bacteria 47803
10 Ga0055530_10070956 3300003791 Bacteria 751
11 Ga0055540_1000023 3300003792 Bacteria 201131
12 Ga0055540_1001938 3300003792 Bacteria 11571
13 Ga0055540_1002300 3300003792 Bacteria 10269
14 Ga0055540_1019820 3300003792 Bacteria 1801
15 Ga0055540_1071784 3300003792 Bacteria 675
16 Ga0055531_10000089 3300003794 Bacteria 100485
17 Ga0055531_10001399 3300003794 Bacteria 17860
18 Ga0055531_10004171 3300003794 Bacteria 8907
19 Ga0065165_1048254 3300005262 Bacteria 1224
20 Ga0065714_10173615 3300005288 Bacteria 993
21 Ga0070658_11302962 3300005327 Bacteria 631
22 Ga0070690_100478318 3300005330 Bacteria 928
23 Ga0070670_101104617 3300005331 Bacteria 723
24 Ga0070677_10386631 3300005333 Bacteria 734
25 Ga0068869_100914604 3300005334 Bacteria 760
26 Ga0070666_10470997 3300005335 Bacteria 909
27 Ga0070682_100043143 3300005337 Bacteria 2788
28 Ga0070668_100999238 3300005347 Bacteria 752
29 Ga0070675_100351091 3300005354 Bacteria 1308
30 Ga0070671_101436930 3300005355 Bacteria 610
31 Ga0070674_100074936 3300005356 Bacteria 2402
32 Ga0070673_100335311 3300005364 Bacteria 1339
33 Ga0070659_100152682 3300005366 Bacteria 1885
34 Ga0070667_100009271 3300005367 Bacteria 8155
35 Ga0070663_100048284 3300005455 Bacteria 3018
36 Ga0070678_101015632 3300005456 Bacteria 763
37 Ga0070678_101217832 3300005456 Bacteria 698
38 Ga0070678_101718280 3300005456 Bacteria 591
39 Ga0070662_100016291 3300005457 Bacteria 4988
40 Ga0070685_10135167 3300005466 Bacteria 1546
41 Ga0068853_100084538 3300005539 Bacteria 2780
42 Ga0070672_100019299 3300005543 Bacteria 4946
43 Ga0070672_100612794 3300005543 Bacteria 949
44 Ga0070665_100213874 3300005548 Bacteria 1929
45 Ga0068856_100283636 3300005614 Bacteria 1673
46 Ga0068852_100015025 3300005616 Bacteria 5985
47 Ga0068864_100371889 3300005618 Bacteria 1353
48 Ga0075364_10178838 3300006051 Bacteria 1435
49 Ga0075367_10611538 3300006178 Bacteria 693
50 Ga0075366_10354701 3300006195 Bacteria 900
51 Ga0075366_10578480 3300006195 Bacteria 696
52 Ga0097621_100105313 3300006237 Bacteria 2378
53 Ga0097621_101379176 3300006237 Bacteria 667
54 Ga0075370_10031710 3300006353 Bacteria 2951
55 Ga0075370_10041970 3300006353 Bacteria 2583
56 Ga0068871_100112673 3300006358 Bacteria 2290
57 Ga0068865_100305935 3300006881 Bacteria 1274
58 Ga0075436_100531624 3300006914 Bacteria 862
59 Ga0079104_1000019 3300006946 Bacteria 269313
60 Ga0105244_10005964 3300009036 Bacteria 7986
61 Ga0105245_10868164 3300009098 Bacteria 943
62 Ga0105245_10993297 3300009098 Bacteria 883
63 Ga0105243_10013431 3300009148 Bacteria 6193
64 Ga0105243_10019807 3300009148 Bacteria 5102
65 Ga0105243_10111720 3300009148 Bacteria 2288
66 Ga0105243_11093256 3300009148 Bacteria 805
67 Ga0105243_11288786 3300009148 Bacteria 747
68 Ga0105243_12310170 3300009148 Bacteria 575
69 Ga0105241_10212351 3300009174 Bacteria 1622
70 Ga0105242_10627766 3300009176 Bacteria 1042
71 Ga0105242_11896018 3300009176 Bacteria 636
72 Ga0105248_10768284 3300009177 Bacteria 1087
73 Ga0105237_10042835 3300009545 Bacteria 4563
74 Ga0105238_10022486 3300009551 Bacteria 6427
75 Ga0105238_10837939 3300009551 Bacteria 936
76 Ga0105249_11968476 3300009553 Bacteria 657
77 Ga0105239_10237048 3300010375 Bacteria 2048
78 Ga0105246_10018369 3300011119 Bacteria 4456
79 Ga0157347_1000106 3300012502 Bacteria 4016
80 Ga0157373_10053282 3300013100 Bacteria 2877
81 Ga0157371_10573915 3300013102 Bacteria 837
82 Ga0157370_10254862 3300013104 Bacteria 1623
83 Ga0157378_11397007 3300013297 Bacteria 743
84 Ga0163162_10155841 3300013306 Bacteria 2404
85 Ga0182008_10008359 3300014497 Bacteria 5652
86 Ga0182008_10066822 3300014497 Bacteria 1769
87 Ga0157376_10539017 3300014969 Bacteria 1153
88 Ga0157376_11570849 3300014969 Bacteria 692
89 Ga0182006_1002881 3300015261 Bacteria 9141
90 Ga0182006_1025466 3300015261 Bacteria 2430
91 Ga0182007_10001242 3300015262 Bacteria 13839
92 Ga0182007_10001836 3300015262 Bacteria 11069
93 Ga0182005_1105959 3300015265 Bacteria 791
94 Ga0183362_10002 3300015683 Bacteria 1432711
95 Ga0163161_10084413 3300017792 Bacteria 2342
96 Ga0209565_1015126 3300025263 Bacteria 1748
97 Ga0209673_1012540 3300025273 Bacteria 3408
98 Ga0209675_1002411 3300025291 Bacteria 9642
99 Ga0209675_1003753 3300025291 Bacteria 7036
100 Ga0209675_1011387 3300025291 Bacteria 2954
101 Ga0209676_1000420 3300025292 Bacteria 74714
102 Ga0209676_1001131 3300025292 Bacteria 29266
103 Ga0209676_1005349 3300025292 Bacteria 6756
104 Ga0209025_1000694 3300025294 Bacteria 57446
105 Ga0209025_1015444 3300025294 Bacteria 4604
106 Ga0209564_1081157 3300025295 Bacteria 633
107 Ga0209050_1000447 3300025298 Bacteria 74743
108 Ga0209050_1004659 3300025298 Bacteria 9122
109 Ga0209050_1005003 3300025298 Bacteria 8616
110 Ga0209050_1013101 3300025298 Bacteria 3724
111 Ga0209050_1026263 3300025298 Bacteria 1955
112 Ga0209050_1038161 3300025298 Bacteria 1374
113 Ga0209256_1000051 3300025299 Bacteria 307241
114 Ga0209051_1000079 3300025303 Bacteria 201183
115 Ga0209051_1000285 3300025303 Bacteria 82429
116 Ga0209051_1001282 3300025303 Bacteria 22316
117 Ga0209051_1011655 3300025303 Bacteria 4320
118 Ga0209051_1076790 3300025303 Bacteria 980
119 Ga0209257_1000021 3300025304 Bacteria 771986
120 Ga0209257_1000183 3300025304 Bacteria 156618
121 Ga0209257_1000417 3300025304 Bacteria 82249
122 Ga0209257_1004570 3300025304 Bacteria 10587
123 Ga0209257_1037105 3300025304 Bacteria 1489
124 Ga0209257_1048898 3300025304 Bacteria 1207
125 Ga0207655_1004540 3300025728 Bacteria 9787
126 Ga0207680_10234959 3300025903 Bacteria 1261
127 Ga0207647_10125135 3300025904 Bacteria 1513
128 Ga0207671_10072333 3300025914 Bacteria 2573
129 Ga0207694_10055019 3300025924 Bacteria 3089
130 Ga0207694_10084977 3300025924 Bacteria 2490
131 Ga0207687_11166729 3300025927 Bacteria 662
132 Ga0207644_11457519 3300025931 Bacteria 575
133 Ga0207690_10092012 3300025932 Bacteria 2145
134 Ga0207706_10010058 3300025933 Bacteria 8664
135 Ga0207709_10001611 3300025935 Bacteria 15373
136 Ga0207709_10002063 3300025935 Bacteria 12988
137 Ga0207669_10025596 3300025937 Bacteria 3193
138 Ga0207691_10498018 3300025940 Bacteria 1035
139 Ga0207691_10915922 3300025940 Bacteria 733
140 Ga0207689_10794612 3300025942 Bacteria 799
141 Ga0207679_10009449 3300025945 Bacteria 6247
142 Ga0207651_10425884 3300025960 Bacteria 1134
143 Ga0207640_10018827 3300025981 Bacteria 4065
144 Ga0207658_10016169 3300025986 Bacteria 5127
145 Ga0207639_10076889 3300026041 Bacteria 2630
146 Ga0207678_10229806 3300026067 Bacteria 1588
147 Ga0207702_10131418 3300026078 Bacteria 2253
148 Ga0207648_10471751 3300026089 Bacteria 1145
149 Ga0207683_11005656 3300026121 Bacteria 774
150 Ga0207683_12144110 3300026121 Bacteria 507
151 Ga0207698_10188090 3300026142 Bacteria 1836
152 Ga0209281_1000160 3300027111 Bacteria 161071
153 Ga0209983_1089049 3300027665 Bacteria 694
154 Ga0209974_10004821 3300027876 Bacteria 4782
155 Ga0268266_10113906 3300028379 Bacteria 2399
156 Ga0268266_10381177 3300028379 Bacteria 1330
157 Ga0268264_11004655 3300028381 Bacteria 841
158 Ga0307515_10000757 3300028794 Bacteria 74840
159 Ga0307515_10116054 3300028794 Bacteria 3077
160 Ga0265332_10001890 3300031238 Bacteria 11103
161 Ga0307513_10006906 3300031456 Bacteria 14776
162 Ga0307513_10056339 3300031456 Bacteria 4197
163 Ga0307408_100000554 3300031548 Bacteria 32251
164 Ga0307408_102347548 3300031548 Bacteria 517
165 Ga0307514_10001530 3300031649 Bacteria 27605
166 Ga0307405_10003092 3300031731 Bacteria 7553
167 Ga0307405_10138913 3300031731 Bacteria 1691
168 Ga0307405_10554250 3300031731 Bacteria 931
169 Ga0307405_11678020 3300031731 Bacteria 562
170 Ga0307406_10001437 3300031901 Bacteria 13193
171 Ga0307412_10943443 3300031911 Bacteria 759
172 Ga0307412_11208551 3300031911 Bacteria 677
173 Ga0307409_100168878 3300031995 Bacteria 1923
174 Ga0307416_101127119 3300032002 Bacteria 889
175 Ga0307414_10002946 3300032004 Bacteria 8998
176 Ga0307411_10001757 3300032005 Bacteria 9141
177 Ga0307411_10240663 3300032005 Bacteria 1416
178 Ga0307510_10253706 3300033180 Bacteria 1245
179 Ga0373948_0046067 3300034817 Bacteria 925
180 Ga0373959_0025486 3300034820 Bacteria 1162
181 Ga0373940_0009067 3300035088 Bacteria 2302
182 Ga0373939_0000008 3300035114 Bacteria 77597
183 Ga0373960_0004335 3300035121 Bacteria 3245
184 Ga0373961_0188803 3300035241 Bacteria 721
185 Ga0373962_0033033 3300035242 Bacteria 1426
186 Ga0373931_0000530 3300035691 Bacteria 15634
187 Ga0395905_0002115 3300037471 Bacteria 22548
188 Ga0395905_0029372 3300037471 Bacteria 5180
189 Ga0436361_0624890 3300039447 Bacteria 6693
190 Ga0451791_1293207 3300041451 Bacteria 555
191 Ga0451793_1892597 3300041452 Bacteria 813
192 Ga0451797_0199688 3300041453 Bacteria 1145
193 Ga0451797_0676736 3300041453 Bacteria 862
194 Ga0451795_1117004 3300041456 Bacteria 641
195 Ga0451807_0732298 3300041486 Bacteria 735
196 Ga0451807_0895353 3300041486 Bacteria 928
197 Ga0451841_0218182 3300041498 Bacteria 520
198 Ga0451847_0136608 3300041503 Bacteria 682
199 Ga0451853_0633760 3300041512 Bacteria 607
200 Ga0439431_0116288 3300041997 Bacteria 744
201 Ga0439445_0058177 3300042004 Bacteria 1053
202 Ga0439445_0098487 3300042004 Bacteria 828
203 Ga0439449_0278773 3300042007 Bacteria 630
204 Ga0439455_0009298 3300042012 Bacteria 2128
205 Ga0439463_174154 3300042016 Bacteria 558
206 Ga0450911_000187 3300042115 Bacteria 24656
207 Ga0450917_004808 3300042120 Bacteria 994
208 Ga0450919_001957 3300042121 Bacteria 2677
209 Ga0450888_019304 3300042126 Bacteria 858
210 Ga0450890_001477 3300042127 Bacteria 3379
211 Ga0450891_000116 3300042129 Bacteria 7147
212 Ga0450892_001314 3300042130 Bacteria 2503
213 Ga0450895_010072 3300042132 Bacteria 804
214 Ga0450898_001671 3300042134 Bacteria 2979
215 Ga0450900_006447 3300042136 Bacteria 1419
216 Ga0450902_051955 3300042137 Bacteria 704
217 Ga0450903_009820 3300042138 Bacteria 1556
218 Ga0450889_002716 3300042144 Bacteria 1757
219 Ga0439446_0133018 3300042156 Bacteria 808
220 Ga0439458_0073100 3300042157 Bacteria 868
221 Ga0450908_043697 3300042184 Bacteria 777
222 Ga0439460_0181515 3300042461 Bacteria 712
223 Ga0450916_029840 3300042530 Bacteria 790
224 Ga0450918_000184 3300042531 Bacteria 13905
225 Ga0450893_0005395 3300042532 Bacteria 2052
226 Ga0450893_0031467 3300042532 Bacteria 947
227 Ga0450893_0072685 3300042532 Bacteria 670
228 Ga0451576_0472347 3300045051 Bacteria 1317
229 Ga0451576_1121544 3300045051 Bacteria 823
230 Ga0495592_0818687 3300046454 Bacteria 552
231 Ga0495629_0450162 3300046459 Bacteria 872
232 Ga0495639_0108674 3300046475 Bacteria 1314
233 Ga0495610_0079114 3300046512 Bacteria 1514
234 Ga0495628_0468327 3300046516 Bacteria 913
235 Ga0495637_0008465 3300046520 Bacteria 5049
236 Ga0495642_0090467 3300046528 Bacteria 1295
237 Ga0495654_0032789 3300046530 Bacteria 2632
238 Ga0495640_0275461 3300046533 Bacteria 1049
239 Ga0495587_0386923 3300046536 Bacteria 778
240 Ga0495633_0469601 3300046558 Bacteria 568
241 Ga0495667_0431717 3300046559 Bacteria 829
242 Ga0495634_0190945 3300046642 Bacteria 1278
243 Ga0495635_0709595 3300046663 Bacteria 652
244 Ga0495659_0297824 3300046664 Bacteria 681
245 Ga0495588_0059318 3300046674 Bacteria 1979
246 Ga0495657_0673613 3300046675 Bacteria 595
247 Ga0495599_0174661 3300046678 Bacteria 1325
248 Ga0495624_0463059 3300046690 Bacteria 759
249 Ga0495670_0712206 3300046691 Bacteria 547
250 Ga0495600_0271344 3300046809 Bacteria 1076
251 Ga0495680_0167401 3300047322 Bacteria 1593
252 Ga0495681_0164247 3300047470 Bacteria 923
253 Ga0496100_0046910 3300048903 Bacteria 2781
254 Ga0496101_0292115 3300048904 Bacteria 1275
255 Ga0496101_0505820 3300048904 Bacteria 954
256 Ga0496102_0747915 3300048905 Bacteria 900
257 Ga0496102_0785875 3300048905 Bacteria 874
258 Ga0496103_0198723 3300048906 Bacteria 1289
259 Ga0496103_0388038 3300048906 Bacteria 897
260 Ga0496104_0091541 3300048907 Bacteria 2907
261 Ga0496105_0019808 3300048908 Bacteria 5428
262 Ga0496106_0193388 3300048909 Bacteria 1618
263 Ga0496107_0378815 3300048910 Bacteria 1052
264 Ga0496108_0885091 3300048911 Bacteria 767
265 Ga0496109_0486175 3300048912 Bacteria 1165
266 Ga0496109_0851082 3300048912 Bacteria 850
267 Ga0496110_0057836 3300048913 Bacteria 3414
268 Ga0496110_0103961 3300048913 Bacteria 2548
269 Ga0496111_0031246 3300048914 Bacteria 3793
270 Ga0496112_0481362 3300048915 Bacteria 1178
271 Ga0496113_1082829 3300048916 Bacteria 629
272 Ga0496114_0265742 3300048917 Bacteria 1511
273 Ga0496114_0494936 3300048917 Bacteria 1081
274 Ga0496116_0015864 3300048919 Bacteria 5929
275 Ga0496116_0026974 3300048919 Bacteria 4188
276 Ga0496117_0038743 3300048920 Bacteria 3528
277 Ga0496117_0163564 3300048920 Bacteria 1301
278 Ga0496118_0006216 3300048921 Bacteria 13214
279 Ga0496121_0050978 3300048924 Bacteria 3490
280 Ga0496121_0102159 3300048924 Bacteria 2209
281 Ga0496121_0218453 3300048924 Bacteria 1344
282 Ga0496122_0475585 3300048925 Bacteria 613
283 Ga0496123_0148007 3300048926 Bacteria 1272
284 Ga0496123_0161878 3300048926 Bacteria 1192
285 Ga0496124_0088207 3300048927 Bacteria 2536
286 Ga0496124_0248670 3300048927 Bacteria 1317
287 Ga0496125_0086075 3300048928 Bacteria 2379
288 Ga0496125_0281659 3300048928 Bacteria 1029
289 Ga0496126_0664077 3300048929 Bacteria 814
290 Ga0501310_010119 3300049130 Bacteria 1048
291 Ga0501291_062217 3300049514 Bacteria 705
292 Ga0501293_014572 3300049516 Bacteria 716
293 Ga0501294_013441 3300049517 Bacteria 830
294 Ga0501299_145136 3300049522 Bacteria 594
295 Ga0501300_020049 3300049523 Bacteria 975
296 Ga0501301_032434 3300049524 Bacteria 560
297 Ga0501316_073969 3300049532 Bacteria 519
298 Ga0501207_004305 3300049654 Bacteria 1929
299 Ga0501211_007769 3300049658 Bacteria 1048
300 Ga0501222_008546 3300049662 Bacteria 1358
301 Ga0501235_031917 3300049669 Bacteria 1190
302 Ga0501235_186111 3300049669 Bacteria 556
303 Ga0501242_024386 3300049674 Bacteria 792
304 Ga0501249_003562 3300049679 Bacteria 3129
305 Ga0501249_123076 3300049679 Bacteria 634
306 Ga0501252_001309 3300049682 Bacteria 2256
307 Ga0501253_024831 3300049683 Bacteria 1090
308 Ga0501255_006094 3300049684 Bacteria 1231
309 Ga0501259_210631 3300049688 Bacteria 501
310 Ga0501221_029757 3300049704 Bacteria 1131
311 Ga0501225_0099645 3300049705 Bacteria 848
312 Ga0501229_003162 3300049706 Bacteria 1962
313 Ga0501232_077676 3300049757 Bacteria 557
314 Ga0501262_007865 3300049759 Bacteria 1297
315 Ga0501266_000372 3300049763 Bacteria 5986
316 Ga0501267_000272 3300049764 Bacteria 3777
317 Ga0501268_056944 3300049765 Bacteria 768
318 Ga0501269_029880 3300049766 Bacteria 697
319 Ga0501272_008491 3300049769 Bacteria 1128
320 Ga0501275_029120 3300049772 Bacteria 722
321 Ga0501204_037886 3300049850 Bacteria 695
322 nmdc:mga00v17_383776_c1 3300050491 Bacteria 913
323 nmdc:mga0k408_418445_c1 3300050493 Bacteria 797
324 nmdc:mga0k408_627188_c1 3300050493 Bacteria 633
325 nmdc:mga0k408_820940_c1 3300050493 Bacteria 541
326 nmdc:mga06z11_593519_c1 3300050494 Bacteria 673
327 nmdc:mga07m45_2133_c1 3300050496 Bacteria 9204
328 nmdc:mga07m45_2799_c1 3300050496 Bacteria 8251
329 nmdc:mga07m45_5683_c1 3300050496 Bacteria 6235
330 Ga0495619_0632339 3300053085 Bacteria 731
331 Ga0500607_145922 3300053121 Bacteria 1105
332 Ga0500608_046769 3300053122 Bacteria 2079
333 Ga0500618_097477 3300053125 Bacteria 661
334 Ga0500625_174616 3300053729 Bacteria 765
335 Ga0500596_081012 3300053735 Bacteria 565
336 2513226481 2513020051 Bacteria 6053213
337 2548501139 2547132374 Bacteria 5530232
338 2644057217 2643221609 Bacteria 6756331
339 2644071961 2643221611 Bacteria 6820941
340 2644245734 2643221644 Bacteria 6865017
341 2644326754 2643221658 Bacteria 6064537
342 2644399990 2643221672 Bacteria 6322190
343 2644466610 2643221683 Bacteria 5749203
344 2644645767 2643221717 Bacteria 5676132
345 2738721580 2738541277 Bacteria 7458140
346 2738885463 2738541307 Bacteria 8606193
347 2739246022 2738543012 Bacteria 7115078
348 2739249679 2738543013 Bacteria 5618633
349 2739281249 2738543019 Bacteria 7459457
350 2816471738 2816332133 Bacteria 7249298
351 2904547268 2904541872 Bacteria 8915136
352 2928119614 2928115317 Bacteria 6477646
353 2929165781 2929160207 Bacteria 9075316
354 2945912732 2945909444 Bacteria 7065066
355 2945985004 2945984333 Bacteria 7358892
356 Ga0307408_100523907
357 JGI25151J46595_10008387
358 JGI25151J46595_10119379
359 Ga0055524_1000097
360 Ga0055536_1000866
361 Ga0055536_1011456
362 Ga0055534_1001970
363 Ga0055534_1025278
364 Ga0055530_10000258
365 Ga0055530_10070956
366 Ga0055540_1000023
367 Ga0055540_1001938
368 Ga0055540_1002300
369 Ga0055540_1019820
370 Ga0055540_1071784
371 Ga0055531_10000089
372 Ga0055531_10001399
373 Ga0055531_10004171
374 Ga0065165_1048254
375 Ga0065714_10173615
376 Ga0070658_11302962
377 Ga0070690_100478318
378 Ga0070670_101104617
379 Ga0070677_10386631
380 Ga0068869_100914604
381 Ga0070666_10470997
382 Ga0070682_100043143
383 Ga0070668_100999238
384 Ga0070675_100351091
385 Ga0070671_101436930
386 Ga0070674_100074936
387 Ga0070673_100335311
388 Ga0070659_100152682
389 Ga0070667_100009271
390 Ga0070663_100048284
391 Ga0070678_101015632
392 Ga0070678_101217832
393 Ga0070678_101718280
394 Ga0070662_100016291
395 Ga0070685_10135167
396 Ga0068853_100084538
397 Ga0070672_100019299
398 Ga0070672_100612794
399 Ga0070665_100213874
400 Ga0068856_100283636
401 Ga0068852_100015025
402 Ga0068864_100371889
403 Ga0075364_10178838
404 Ga0075367_10611538
405 Ga0075366_10354701
406 Ga0075366_10578480
407 Ga0097621_100105313
408 Ga0097621_101379176
409 Ga0075370_10031710
410 Ga0075370_10041970
411 Ga0068871_100112673
412 Ga0068865_100305935
413 Ga0075436_100531624
414 Ga0079104_1000019
415 Ga0105244_10005964
416 Ga0105245_10868164
417 Ga0105245_10993297
418 Ga0105243_10013431
419 Ga0105243_10019807
420 Ga0105243_10111720
421 Ga0105243_11093256
422 Ga0105243_11288786
423 Ga0105243_12310170
424 Ga0105241_10212351
425 Ga0105242_10627766
426 Ga0105242_11896018
427 Ga0105248_10768284
428 Ga0105237_10042835
429 Ga0105238_10022486
430 Ga0105238_10837939
431 Ga0105249_11968476
432 Ga0105239_10237048
433 Ga0105246_10018369
434 Ga0157347_1000106
435 Ga0157373_10053282
436 Ga0157371_10573915
437 Ga0157370_10254862
438 Ga0157378_11397007
439 Ga0163162_10155841
440 Ga0182008_10008359
441 Ga0182008_10066822
442 Ga0157376_10539017
443 Ga0157376_11570849
444 Ga0182006_1002881
445 Ga0182006_1025466
446 Ga0182007_10001242
447 Ga0182007_10001836
448 Ga0182005_1105959
449 Ga0183362_10002
450 Ga0163161_10084413
451 Ga0209565_1015126
452 Ga0209673_1012540
453 Ga0209675_1002411
454 Ga0209675_1003753
455 Ga0209675_1011387
456 Ga0209676_1000420
457 Ga0209676_1001131
458 Ga0209676_1005349
459 Ga0209025_1000694
460 Ga0209025_1015444
461 Ga0209564_1081157
462 Ga0209050_1000447
463 Ga0209050_1004659
464 Ga0209050_1005003
465 Ga0209050_1013101
466 Ga0209050_1026263
467 Ga0209050_1038161
468 Ga0209256_1000051
469 Ga0209051_1000079
470 Ga0209051_1000285
471 Ga0209051_1001282
472 Ga0209051_1011655
473 Ga0209051_1076790
474 Ga0209257_1000021
475 Ga0209257_1000183
476 Ga0209257_1000417
477 Ga0209257_1004570
478 Ga0209257_1037105
479 Ga0209257_1048898
480 Ga0207655_1004540
481 Ga0207680_10234959
482 Ga0207647_10125135
483 Ga0207671_10072333
484 Ga0207694_10055019
485 Ga0207694_10084977
486 Ga0207687_11166729
487 Ga0207644_11457519
488 Ga0207690_10092012
489 Ga0207706_10010058
490 Ga0207709_10001611
491 Ga0207709_10002063
492 Ga0207669_10025596
493 Ga0207691_10498018
494 Ga0207691_10915922
495 Ga0207689_10794612
496 Ga0207679_10009449
497 Ga0207651_10425884
498 Ga0207640_10018827
499 Ga0207658_10016169
500 Ga0207639_10076889
501 Ga0207678_10229806
502 Ga0207702_10131418
503 Ga0207648_10471751
504 Ga0207683_11005656
505 Ga0207683_12144110
506 Ga0207698_10188090
507 Ga0209281_1000160
508 Ga0209983_1089049
509 Ga0209974_10004821
510 Ga0268266_10113906
511 Ga0268266_10381177
512 Ga0268264_11004655
513 Ga0307515_10000757
514 Ga0307515_10116054
515 Ga0265332_10001890
516 Ga0307513_10006906
517 Ga0307513_10056339
518 Ga0307408_100000554
519 Ga0307408_102347548
520 Ga0307514_10001530
521 Ga0307405_10003092
522 Ga0307405_10138913
523 Ga0307405_10554250
524 Ga0307405_11678020
525 Ga0307406_10001437
526 Ga0307412_10943443
527 Ga0307412_11208551
528 Ga0307409_100168878
529 Ga0307416_101127119
530 Ga0307414_10002946
531 Ga0307411_10001757
532 Ga0307411_10240663
533 Ga0307510_10253706
534 Ga0373948_0046067
535 Ga0373959_0025486
536 Ga0373940_0009067
537 Ga0373939_0000008
538 Ga0373960_0004335
539 Ga0373961_0188803
540 Ga0373962_0033033
541 Ga0373931_0000530
542 Ga0395905_0002115
543 Ga0395905_0029372
544 Ga0436361_0624890
545 Ga0451791_1293207
546 Ga0451793_1892597
547 Ga0451797_0199688
548 Ga0451797_0676736
549 Ga0451795_1117004
550 Ga0451807_0732298
551 Ga0451807_0895353
552 Ga0451841_0218182
553 Ga0451847_0136608
554 Ga0451853_0633760
555 Ga0439431_0116288
556 Ga0439445_0058177
557 Ga0439445_0098487
558 Ga0439449_0278773
559 Ga0439455_0009298
560 Ga0439463_174154
561 Ga0450911_000187
562 Ga0450917_004808
563 Ga0450919_001957
564 Ga0450888_019304
565 Ga0450890_001477
566 Ga0450891_000116
567 Ga0450892_001314
568 Ga0450895_010072
569 Ga0450898_001671
570 Ga0450900_006447
571 Ga0450902_051955
572 Ga0450903_009820
573 Ga0450889_002716
574 Ga0439446_0133018
575 Ga0439458_0073100
576 Ga0450908_043697
577 Ga0439460_0181515
578 Ga0450916_029840
579 Ga0450918_000184
580 Ga0450893_0005395
581 Ga0450893_0031467
582 Ga0450893_0072685
583 Ga0451576_0472347
584 Ga0451576_1121544
585 Ga0495592_0818687
586 Ga0495629_0450162
587 Ga0495639_0108674
588 Ga0495610_0079114
589 Ga0495628_0468327
590 Ga0495637_0008465
591 Ga0495642_0090467
592 Ga0495654_0032789
593 Ga0495640_0275461
594 Ga0495587_0386923
595 Ga0495633_0469601
596 Ga0495667_0431717
597 Ga0495634_0190945
598 Ga0495635_0709595
599 Ga0495659_0297824
600 Ga0495588_0059318
601 Ga0495657_0673613
602 Ga0495599_0174661
603 Ga0495624_0463059
604 Ga0495670_0712206
605 Ga0495600_0271344
606 Ga0495680_0167401
607 Ga0495681_0164247
608 Ga0496100_0046910
609 Ga0496101_0292115
610 Ga0496101_0505820
611 Ga0496102_0747915
612 Ga0496102_0785875
613 Ga0496103_0198723
614 Ga0496103_0388038
615 Ga0496104_0091541
616 Ga0496105_0019808
617 Ga0496106_0193388
618 Ga0496107_0378815
619 Ga0496108_0885091
620 Ga0496109_0486175
621 Ga0496109_0851082
622 Ga0496110_0057836
623 Ga0496110_0103961
624 Ga0496111_0031246
625 Ga0496112_0481362
626 Ga0496113_1082829
627 Ga0496114_0265742
628 Ga0496114_0494936
629 Ga0496116_0015864
630 Ga0496116_0026974
631 Ga0496117_0038743
632 Ga0496117_0163564
633 Ga0496118_0006216
634 Ga0496121_0050978
635 Ga0496121_0102159
636 Ga0496121_0218453
637 Ga0496122_0475585
638 Ga0496123_0148007
639 Ga0496123_0161878
640 Ga0496124_0088207
641 Ga0496124_0248670
642 Ga0496125_0086075
643 Ga0496125_0281659
644 Ga0496126_0664077
645 Ga0501310_010119
646 Ga0501291_062217
647 Ga0501293_014572
648 Ga0501294_013441
649 Ga0501299_145136
650 Ga0501300_020049
651 Ga0501301_032434
652 Ga0501316_073969
653 Ga0501207_004305
654 Ga0501211_007769
655 Ga0501222_008546
656 Ga0501235_031917
657 Ga0501235_186111
658 Ga0501242_024386
659 Ga0501249_003562
660 Ga0501249_123076
661 Ga0501252_001309
662 Ga0501253_024831
663 Ga0501255_006094
664 Ga0501259_210631
665 Ga0501221_029757
666 Ga0501225_0099645
667 Ga0501229_003162
668 Ga0501232_077676
669 Ga0501262_007865
670 Ga0501266_000372
671 Ga0501267_000272
672 Ga0501268_056944
673 Ga0501269_029880
674 Ga0501272_008491
675 Ga0501275_029120
676 Ga0501204_037886
677 nmdc:mga00v17_383776_c1
678 nmdc:mga0k408_418445_c1
679 nmdc:mga0k408_627188_c1
680 nmdc:mga0k408_820940_c1
681 nmdc:mga06z11_593519_c1
682 nmdc:mga07m45_2133_c1
683 nmdc:mga07m45_2799_c1
684 nmdc:mga07m45_5683_c1
685 Ga0495619_0632339
686 Ga0500607_145922
687 Ga0500608_046769
688 Ga0500618_097477
689 Ga0500625_174616
690 Ga0500596_081012
691 2513226481
692 2548501139
693 2644057217
694 2644071961
695 2644245734
696 2644326754
697 2644399990
698 2644466610
699 2644645767
700 2738721580
701 2738885463
702 2739246022
703 2739249679
704 2739281249
705 2816471738
706 2904547268
707 2928119614
708 2929165781
709 2945912732
710 2945985004

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13806

Rieske_2

Rieske-like [2Fe-2S] domain

13

116

0.99

PF00355

Rieske

Rieske [2Fe-2S] domain

13

105

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4aiv-assembly1.cif.gz_A crystal structure of putative nadh-dependent nitrite reductase small subunit from mycobacterium tuberculosis 0.9367 6 113
2jo6-assembly1.cif.gz_A nmr structure of the e.coli protein nird, northeast structural genomics target et100 0.924 7 110
3c0d-assembly3.cif.gz_C crystal structure of the putative nitrite reductase nadph (small subunit) oxidoreductase protein q87hb1. northeast structural genomics consortium target vpr162 0.9072 6 113
3c0d-assembly3.cif.gz_C crystal structure of the putative nitrite reductase nadph (small subunit) oxidoreductase protein q87hb1. northeast structural genomics consortium target vpr162 0.8992 6 113
3gce-assembly1.cif.gz_A ferredoxin of carbazole 1,9a-dioxygenase from nocardioides aromaticivorans ic177 0.8871 8 113
ID Description Score Start End Superfamily
af_P0A9I8_1_108_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9697 6 111 2.102.10.10
af_P0A9I8_1_108_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9436 6 111 2.102.10.10
4aivA00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9367 6 113 2.102.10.10
af_Q2FVL9_1_103_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.923 7 111 2.102.10.10
3c0dC00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.903 6 113 2.102.10.10
ID Description Score Start End GO Terms
AF-A0A4Q3YMD2-F1-model_v4 Nitrite reductase small subunit NirD 0.9964 9 113 GO:0042128
GO:0046872
GO:0051537
AF-A0A0Q6UF97-F1-model_v4 Nitrite reductase small subunit 0.9943 6 113 GO:0042128
GO:0046872
GO:0051537
AF-A0A254N7U4-F1-model_v4 Nitrite reductase (NAD(P)H) small subunit 0.9933 5 113 GO:0042128
GO:0046872
GO:0051537
AF-A0A397QW15-F1-model_v4 deleted 0.9933 6 113
AF-A0A1F4MTD5-F1-model_v4 Nitrite reductase small subunit 0.9904 8 113 GO:0042128
GO:0046872
GO:0051537

Map