F420195

General Info

Members Datasets Scaffolds Average Seq Length
355 239 710 298

Family's Representative Sequence

Representative Sequence 3300031903|Ga0307407_10081013|Ga0307407_100810132
Length 352
Sequence MRVFQRCHKQQGFGSCLCNCDGRADGGYAPLRLRLRSLAPYRHGGRLWRPSTLKSVALNRIVLFYGFTPIPDPDAVMLWQRALCEKLGLTGRILISKDGINATVGGEIKAVKQYVKTTREYQGFRGIDVKWSDGGADDFPRLSVKVRDEIVSFGAPGELKVDENGVVGGGKHLQPEELHELVDAKKESGQEVVFFDGRNAFEAQIGKFKDAVVPDVDTTHDFIQELESGKYDALKDKPVVTYCTGGIRCEVLSSLMVNRGFKEVYQLDGGIVRYGEKYKDQGLWEGSLYVFDKRMHLEFSEDAKTIGECVRCESPTSKFENCSNPSCRTLTLYCAQCAASPETLRCPEGCAA

Samples

Sample ID Description Type Environment
1 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
20 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
21 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
22 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
23 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
24 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
25 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
31 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
32 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
33 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
34 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
35 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
41 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
42 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
63 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
64 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
65 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
66 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
67 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
68 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
69 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
70 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
71 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
72 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
73 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
74 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
75 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
76 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
77 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
78 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
79 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
80 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
81 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
82 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
83 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
84 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
85 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
86 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
87 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
88 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
89 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
90 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
91 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
92 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
93 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
94 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
95 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
96 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
97 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
98 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
99 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
100 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
101 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
102 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
103 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
104 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
105 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
106 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
107 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
108 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
109 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
110 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
111 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
112 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
113 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
114 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
115 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
116 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
117 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
118 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
119 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
120 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
121 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
122 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
123 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
124 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
125 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
126 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
127 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
128 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
129 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
130 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
131 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
132 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
133 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
134 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
135 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
136 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
137 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
138 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
139 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
140 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
141 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
142 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
143 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
144 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
145 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
146 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
147 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
148 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
149 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
150 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
158 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
159 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
160 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
161 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
162 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
163 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
164 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
165 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
166 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
167 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
168 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
169 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
170 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
171 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
172 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
173 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
174 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
175 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
176 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
177 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
178 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
179 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
180 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
181 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
182 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
183 2643221649 Leifsonia sp. Root4 Isolate Unclassified
184 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
185 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
186 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
187 2739367653 Kocuria sp. OV113 Isolate Unclassified
188 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
189 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
190 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
191 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
192 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
193 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
194 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
195 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
196 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
197 2857479173 Micrococcus sp. R-74225 Isolate Unclassified
198 2857632687 Micrococcus sp. R-73081 Isolate Unclassified
199 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
200 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
201 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
202 2870801768 Micrococcus endophyticus DSM 17945 Isolate Unclassified
203 2870804320 Micrococcus yunnanensis DSM 21948 Isolate Unclassified
204 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
205 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
206 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
207 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
208 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
209 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
210 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
211 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
212 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
213 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
214 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
215 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
216 2920879853 Kocuria salina CV6 Isolate Unclassified
217 2922554459 Rhodococcus sp. 66b Isolate Unclassified
218 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
219 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
220 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
221 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
222 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
223 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
224 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
225 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
226 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
227 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
228 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
229 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
230 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
231 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
232 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
233 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
234 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
235 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
236 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
237 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
238 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
239 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.54
Metatranscriptomes 0.28
Isolates 17.18

Biome Distribution

Category Percentage (%)
Aerial Root 0.28
Bulb 0
Endosphere 9.3
Nodule 0
Rhizoplane 5.35
Rhizosphere 73.24
Stem 0
Stem Tuber 0
Unclassified 0.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307407_10081013 3300031903 Bacteria 1963
2 LJQas_1001236 3300000549 Bacteria 3853
3 LJQas_1003500 3300000549 Bacteria 2097
4 JGI24741J21665_1001531 3300001915 Bacteria 6557
5 JGI25152J39213_1000404 3300002773 Bacteria 26230
6 rootH2_10111265 3300003320 Bacteria 3406
7 rootL2_10162643 3300003322 Bacteria 9516
8 Ga0065714_10075979 3300005288 Bacteria 2841
9 Ga0065714_10090312 3300005288 Bacteria 1935
10 Ga0070658_10000745 3300005327 Bacteria 27934
11 Ga0070660_100211226 3300005339 Bacteria 1576
12 Ga0070669_100026581 3300005353 Bacteria 4164
13 Ga0070675_100018355 3300005354 Bacteria 5566
14 Ga0070671_100017448 3300005355 Bacteria 5815
15 Ga0070659_100047551 3300005366 Bacteria 3366
16 Ga0070667_100072484 3300005367 Bacteria 2935
17 Ga0070667_100119403 3300005367 Bacteria 2292
18 Ga0070663_100364276 3300005455 Bacteria 1173
19 Ga0070678_100016266 3300005456 Bacteria 4753
20 Ga0070678_100204268 3300005456 Bacteria 1633
21 Ga0068855_100039605 3300005563 Bacteria 5595
22 Ga0068858_100085559 3300005842 Bacteria 2933
23 Ga0075364_10014689 3300006051 Bacteria 4843
24 Ga0075364_10063295 3300006051 Bacteria 2428
25 Ga0075432_10000444 3300006058 Bacteria 12181
26 Ga0075362_10000462 3300006177 Bacteria 11796
27 Ga0075367_10038288 3300006178 Bacteria 2791
28 Ga0075369_10000010 3300006186 Bacteria 77564
29 Ga0075366_10000067 3300006195 Bacteria 39443
30 Ga0075370_10095168 3300006353 Bacteria 1720
31 Ga0075430_100128741 3300006846 Bacteria 2110
32 Ga0105244_10011107 3300009036 Bacteria 5424
33 Ga0105244_10015392 3300009036 Bacteria 4388
34 Ga0105244_10017396 3300009036 Bacteria 4063
35 Ga0105244_10024102 3300009036 Bacteria 3326
36 Ga0105245_10063027 3300009098 Bacteria 3347
37 Ga0105243_10006553 3300009148 Bacteria 8993
38 Ga0105243_10007923 3300009148 Bacteria 8157
39 Ga0105243_10051728 3300009148 Bacteria 3250
40 Ga0105242_10032051 3300009176 Bacteria 4201
41 Ga0105248_10133248 3300009177 Bacteria 2804
42 Ga0105033_103771 3300009986 Bacteria 1284
43 Ga0105246_10002177 3300011119 Bacteria 11818
44 Ga0105246_10010009 3300011119 Bacteria 5849
45 Ga0105246_10050695 3300011119 Bacteria 2848
46 Ga0105246_10104598 3300011119 Bacteria 2068
47 Ga0157373_10226274 3300013100 Bacteria 1320
48 Ga0157371_10000105 3300013102 Bacteria 126728
49 Ga0157371_10000447 3300013102 Bacteria 50553
50 Ga0157371_10006787 3300013102 Bacteria 9356
51 Ga0157371_10068245 3300013102 Bacteria 2516
52 Ga0157370_10002957 3300013104 Bacteria 20223
53 Ga0157370_10454185 3300013104 Bacteria 1178
54 Ga0157369_10080252 3300013105 Bacteria 3494
55 Ga0157369_10234833 3300013105 Bacteria 1916
56 Ga0157369_10380176 3300013105 Bacteria 1466
57 Ga0157372_10363778 3300013307 Bacteria 1686
58 Ga0163163_10059189 3300014325 Bacteria 3788
59 Ga0163163_10328017 3300014325 Bacteria 1585
60 Ga0209129_1000060 3300025258 Bacteria 248262
61 Ga0209025_1000805 3300025294 Bacteria 50620
62 Ga0209051_1003307 3300025303 Bacteria 10678
63 Ga0209051_1017745 3300025303 Bacteria 3171
64 Ga0207697_10002587 3300025315 Bacteria 9311
65 Ga0207655_1011263 3300025728 Bacteria 5338
66 Ga0207713_1020404 3300025735 Bacteria 3212
67 Ga0207680_10008742 3300025903 Bacteria 4988
68 Ga0207647_10022243 3300025904 Bacteria 4215
69 Ga0207645_10000753 3300025907 Bacteria 26943
70 Ga0207705_10000001 3300025909 Bacteria 2061880
71 Ga0207657_10117831 3300025919 Bacteria 2187
72 Ga0207681_10132879 3300025923 Bacteria 1842
73 Ga0207659_10060996 3300025926 Bacteria 2716
74 Ga0207687_10082468 3300025927 Bacteria 2326
75 Ga0207690_10026129 3300025932 Bacteria 3675
76 Ga0207709_10019370 3300025935 Bacteria 3825
77 Ga0207709_10147732 3300025935 Bacteria 1624
78 Ga0207669_10093601 3300025937 Bacteria 1964
79 Ga0207691_10012193 3300025940 Bacteria 8240
80 Ga0207658_10013282 3300025986 Bacteria 5624
81 Ga0207703_10067202 3300026035 Bacteria 2950
82 Ga0207678_10195292 3300026067 Bacteria 1730
83 Ga0207683_10017845 3300026121 Bacteria 6052
84 Ga0207683_10195935 3300026121 Bacteria 1836
85 Ga0207683_10245677 3300026121 Bacteria 1633
86 Ga0207428_10007192 3300027907 Bacteria 10180
87 Ga0265760_10009880 3300031090 Bacteria 2723
88 Ga0307408_100036314 3300031548 Bacteria 3463
89 Ga0307408_100045518 3300031548 Bacteria 3134
90 Ga0307408_100091663 3300031548 Bacteria 2295
91 Ga0307408_100218980 3300031548 Bacteria 1552
92 Ga0307514_10004259 3300031649 Bacteria 13222
93 Ga0307405_10008506 3300031731 Bacteria 5208
94 Ga0307405_10022819 3300031731 Bacteria 3545
95 Ga0307405_10030153 3300031731 Bacteria 3178
96 Ga0307405_10036542 3300031731 Bacteria 2944
97 Ga0307413_10045079 3300031824 Bacteria 2611
98 Ga0307413_10231788 3300031824 Bacteria 1357
99 Ga0307413_10439401 3300031824 Bacteria 1032
100 Ga0307410_10018000 3300031852 Bacteria 4257
101 Ga0307410_10023510 3300031852 Bacteria 3833
102 Ga0307410_10026971 3300031852 Bacteria 3624
103 Ga0307410_10045050 3300031852 Bacteria 2934
104 Ga0307410_10108108 3300031852 Bacteria 2007
105 Ga0307406_10036312 3300031901 Bacteria 3035
106 Ga0307406_10281308 3300031901 Bacteria 1269
107 Ga0307407_10008420 3300031903 Bacteria 4733
108 Ga0307407_10008486 3300031903 Bacteria 4720
109 Ga0307407_10031778 3300031903 Bacteria 2863
110 Ga0307412_10002774 3300031911 Bacteria 9735
111 Ga0307412_10035559 3300031911 Bacteria 3184
112 Ga0307412_10038901 3300031911 Bacteria 3067
113 Ga0307412_10044632 3300031911 Bacteria 2892
114 Ga0307412_10047531 3300031911 Bacteria 2819
115 Ga0307412_10054728 3300031911 Bacteria 2650
116 Ga0307412_10097268 3300031911 Bacteria 2074
117 Ga0307412_10135741 3300031911 Bacteria 1794
118 Ga0307412_10198494 3300031911 Bacteria 1522
119 Ga0307409_100066246 3300031995 Bacteria 2847
120 Ga0307409_100105593 3300031995 Bacteria 2348
121 Ga0307409_100608012 3300031995 Bacteria 1081
122 Ga0307416_100022971 3300032002 Bacteria 4516
123 Ga0307416_100038111 3300032002 Bacteria 3705
124 Ga0307416_100042703 3300032002 Bacteria 3542
125 Ga0307416_100169561 3300032002 Bacteria 2030
126 Ga0307416_100252849 3300032002 Bacteria 1716
127 Ga0307416_100256252 3300032002 Bacteria 1706
128 Ga0307416_100298746 3300032002 Bacteria 1599
129 Ga0307414_10050615 3300032004 Bacteria 2879
130 Ga0307414_10087873 3300032004 Bacteria 2299
131 Ga0307411_10020407 3300032005 Bacteria 3853
132 Ga0307415_100098751 3300032126 Bacteria 2135
133 Ga0307415_100128710 3300032126 Bacteria 1912
134 Ga0307415_100201122 3300032126 Bacteria 1581
135 Ga0395899_0027796 3300037312 Bacteria 4261
136 Ga0395899_0248796 3300037312 Bacteria 1220
137 Ga0395900_0016012 3300037418 Bacteria 7638
138 Ga0395900_0027899 3300037418 Bacteria 5783
139 Ga0395900_0029121 3300037418 Bacteria 5664
140 Ga0395900_0038742 3300037418 Bacteria 4913
141 Ga0395900_0131778 3300037418 Bacteria 2561
142 Ga0395898_0042022 3300037466 Bacteria 4512
143 Ga0395898_0045236 3300037466 Bacteria 4327
144 Ga0395898_0049160 3300037466 Bacteria 4133
145 Ga0395898_0055163 3300037466 Bacteria 3876
146 Ga0395898_0226755 3300037466 Bacteria 1782
147 Ga0395905_0027064 3300037471 Bacteria 5407
148 Ga0395905_0188230 3300037471 Bacteria 1937
149 Ga0395905_0308137 3300037471 Bacteria 1472
150 Ga0395901_0006729 3300038443 Bacteria 11611
151 Ga0395901_0090995 3300038443 Bacteria 3193
152 Ga0395901_0273289 3300038443 Bacteria 1757
153 Ga0439436_0004288 3300041404 Bacteria 4369
154 Ga0439436_0007899 3300041404 Bacteria 3268
155 Ga0439436_0024250 3300041404 Bacteria 1791
156 Ga0439438_011668 3300041405 Bacteria 2726
157 Ga0439438_039758 3300041405 Bacteria 1224
158 Ga0439439_0000786 3300041406 Bacteria 5753
159 Ga0439439_0006765 3300041406 Bacteria 2659
160 Ga0439447_016048 3300041407 Bacteria 2063
161 Ga0439466_0037045 3300041411 Bacteria 1644
162 Ga0451797_0821308 3300041453 Bacteria 1314
163 Ga0451837_0629096 3300041494 Bacteria 2013
164 Ga0439433_0000115 3300041999 Bacteria 11473
165 Ga0439433_0001103 3300041999 Bacteria 5506
166 Ga0439433_0001495 3300041999 Bacteria 4826
167 Ga0439433_0005019 3300041999 Bacteria 2840
168 Ga0439442_000002 3300042002 Bacteria 85659
169 Ga0439442_000398 3300042002 Bacteria 10197
170 Ga0439442_001093 3300042002 Bacteria 5453
171 Ga0439449_0000633 3300042007 Bacteria 13199
172 Ga0439449_0001888 3300042007 Bacteria 8256
173 Ga0439449_0018915 3300042007 Bacteria 2583
174 Ga0439449_0018922 3300042007 Bacteria 2582
175 Ga0439452_000760 3300042010 Bacteria 15442
176 Ga0439457_001165 3300042014 Bacteria 7893
177 Ga0439457_002941 3300042014 Bacteria 4733
178 Ga0439457_012860 3300042014 Bacteria 1884
179 Ga0439462_0003716 3300042015 Bacteria 3682
180 Ga0450919_003990 3300042121 Bacteria 1813
181 Ga0450920_000318 3300042122 Bacteria 7325
182 Ga0450920_003369 3300042122 Bacteria 2764
183 Ga0450920_005475 3300042122 Bacteria 2257
184 Ga0450907_000013 3300042146 Bacteria 88569
185 Ga0439434_0000493 3300042435 Bacteria 11232
186 Ga0439434_0023449 3300042435 Bacteria 1858
187 Ga0450918_000084 3300042531 Bacteria 19714
188 Ga0450918_004203 3300042531 Bacteria 2638
189 Ga0466966_0172697 3300044684 Bacteria 1313
190 Ga0495629_0063585 3300046459 Bacteria 2577
191 Ga0495629_0089792 3300046459 Unclassified 2144
192 Ga0495653_0005623 3300046463 Bacteria 10231
193 Ga0495580_0114818 3300046472 Bacteria 1870
194 Ga0495582_0068119 3300046473 Bacteria 1967
195 Ga0495639_0195210 3300046475 Bacteria 989
196 Ga0495662_0003032 3300046476 Bacteria 8473
197 Ga0495664_0004805 3300046477 Bacteria 7391
198 Ga0495594_0085280 3300046499 Bacteria 1767
199 Ga0495594_0137284 3300046499 Bacteria 1386
200 Ga0495643_0083817 3300046522 Bacteria 1655
201 Ga0495665_0003117 3300046531 Bacteria 8965
202 Ga0495586_0017823 3300046535 Bacteria 3778
203 Ga0495586_0049356 3300046535 Bacteria 2275
204 Ga0495645_0002321 3300046543 Bacteria 12912
205 Ga0495622_0000191 3300046557 Bacteria 49391
206 Ga0495667_0037556 3300046559 Bacteria 3227
207 Ga0495656_0001170 3300046615 Bacteria 8534
208 Ga0495656_0053071 3300046615 Bacteria 1741
209 Ga0495668_0000171 3300046616 Bacteria 96971
210 Ga0495588_0000236 3300046674 Bacteria 48183
211 Ga0495588_0006171 3300046674 Bacteria 5382
212 Ga0495588_0028667 3300046674 Bacteria 2788
213 Ga0495588_0159391 3300046674 Bacteria 1193
214 Ga0495658_0000810 3300046683 Bacteria 16770
215 Ga0495670_0003635 3300046691 Bacteria 7578
216 Ga0495600_0002053 3300046809 Bacteria 11355
217 Ga0495600_0035401 3300046809 Bacteria 3242
218 Ga0495600_0095689 3300046809 Bacteria 1936
219 Ga0495581_0057509 3300047315 Bacteria 2244
220 Ga0495581_0113907 3300047315 Bacteria 1572
221 Ga0495581_0141863 3300047315 Bacteria 1401
222 Ga0495604_0102906 3300047317 Bacteria 2096
223 Ga0495636_0070152 3300047318 Bacteria 1494
224 Ga0495680_0051551 3300047322 Bacteria 3212
225 Ga0495685_064411 3300047447 Bacteria 1233
226 Ga0495593_0065979 3300047673 Bacteria 1887
227 Ga0495602_0091116 3300048088 Unclassified 2530
228 Ga0496100_0008128 3300048903 Bacteria 5838
229 Ga0496100_0125990 3300048903 Bacteria 1797
230 Ga0496101_0000734 3300048904 Bacteria 19501
231 Ga0496102_0004059 3300048905 Bacteria 12410
232 Ga0496102_0090286 3300048905 Bacteria 2835
233 Ga0496103_0029306 3300048906 Bacteria 3345
234 Ga0496103_0048851 3300048906 Bacteria 2615
235 Ga0496106_0001088 3300048909 Bacteria 20077
236 Ga0496107_0001298 3300048910 Bacteria 15302
237 Ga0496107_0055513 3300048910 Bacteria 2860
238 Ga0496108_0058003 3300048911 Bacteria 3253
239 Ga0496109_0000744 3300048912 Bacteria 27096
240 Ga0496109_0095457 3300048912 Bacteria 2753
241 Ga0496109_0185053 3300048912 Bacteria 1957
242 Ga0496110_0141049 3300048913 Bacteria 2178
243 Ga0496111_0139433 3300048914 Bacteria 1796
244 Ga0496112_0111949 3300048915 Bacteria 2699
245 Ga0496115_0178276 3300048918 Bacteria 1757
246 Ga0496116_0121833 3300048919 Bacteria 1507
247 Ga0496117_0027639 3300048920 Bacteria 4413
248 Ga0496118_0001579 3300048921 Bacteria 33796
249 Ga0496119_0002351 3300048922 Bacteria 20830
250 Ga0496120_0002969 3300048923 Bacteria 16141
251 Ga0496121_0164648 3300048924 Bacteria 1618
252 Ga0496122_0000031 3300048925 Bacteria 329726
253 Ga0496123_0000013 3300048926 Bacteria 439694
254 Ga0496124_0132937 3300048927 Bacteria 1974
255 Ga0496125_0007006 3300048928 Bacteria 12062
256 Ga0496125_0074960 3300048928 Bacteria 2620
257 Ga0496126_0096436 3300048929 Bacteria 2592
258 Ga0501032_0000821 3300049569 Bacteria 25247
259 Ga0501034_0000549 3300049571 Bacteria 59568
260 Ga0501036_0081785 3300049572 Bacteria 2730
261 Ga0501037_0008449 3300049573 Bacteria 7550
262 Ga0501037_0010359 3300049573 Bacteria 6840
263 Ga0501037_0037855 3300049573 Bacteria 3556
264 Ga0501037_0222857 3300049573 Bacteria 1326
265 Ga0501038_0062296 3300049574 Bacteria 3187
266 Ga0501039_0269410 3300049575 Bacteria 1338
267 Ga0501043_0025355 3300049579 Bacteria 4652
268 Ga0501043_0054412 3300049579 Bacteria 3142
269 Ga0501070_0158842 3300049586 Bacteria 1864
270 Ga0501279_007275 3300049775 Bacteria 1469
271 Ga0501044_0042945 3300049823 Bacteria 4699
272 nmdc:mga03n38_204051_c1 3300050490 Bacteria 1024
273 nmdc:mga0k408_1_c1 3300050493 Bacteria 1089059
274 nmdc:mga07m45_68190_c1 3300050496 Bacteria 2022
275 nmdc:mga0qj67_184991_c1 3300050509 Bacteria 1692
276 nmdc:mga0sz30_3_c9 3300050516 Bacteria 81468
277 Ga0495655_0008835 3300053083 Bacteria 1930
278 Ga0500643_000022 3300053087 Bacteria 277519
279 Ga0500644_0000776 3300053088 Bacteria 10893
280 Ga0500566_0000001 3300053094 Bacteria 1101031
281 Ga0500650_0006134 3300053098 Bacteria 4556
282 Ga0500594_0000098 3300053118 Bacteria 25544
283 Ga0500614_000001 3300053123 Bacteria 1274484
284 Ga0500614_000929 3300053123 Bacteria 7310
285 Ga0500628_000048 3300053129 Bacteria 42050
286 Ga0500559_0000220 3300053136 Bacteria 45779
287 Ga0500559_0009424 3300053136 Bacteria 4226
288 Ga0500568_0008510 3300053139 Unclassified 4936
289 Ga0500573_0000005 3300053140 Bacteria 315762
290 Ga0500573_0018636 3300053140 Bacteria 3959
291 Ga0500573_0048379 3300053140 Bacteria 2448
292 Ga0500577_0027416 3300053142 Bacteria 1950
293 Ga0500616_0000005 3300053153 Bacteria 961725
294 Ga0500649_000011 3300053722 Bacteria 87970
295 2537899192 2537561592 Bacteria 4348607
296 2555228966 2554235227 Bacteria 3637389
297 2566993417 2565956761 Bacteria 6601618
298 2588108236 2585428157 Bacteria 3018951
299 2644280073 2643221649 Bacteria 3867359
300 2655033448 2654587600 Bacteria 3911798
301 2691515278 2690315906 Bacteria 4517044
302 2738890347 2738541308 Bacteria 7020677
303 2739602820 2739367653 Bacteria 2780952
304 2775655726 2775506735 Bacteria 4556596
305 2808849704 2808606360 Bacteria 4404006
306 2808877705 2808606366 Bacteria 4415912
307 2808892683 2808606370 Bacteria 4942454
308 2808899151 2808606371 Bacteria 4251511
309 2810366015 2808606700 Bacteria 3482157
310 2812319830 2811994871 Bacteria 4497550
311 2844850071 2844849076 Bacteria 4091819
312 2844853698 2844852863 Bacteria 3849151
313 2857481362 2857479173 Bacteria 2469263
314 2857634804 2857632687 Bacteria 2448521
315 2857742260 2857740372 Bacteria 4782044
316 2870625254 2870622029 Bacteria 3643329
317 2870629424 2870628048 Bacteria 3696012
318 2870801823 2870801768 Bacteria 2710986
319 2870806215 2870804320 Bacteria 2552467
320 2893685313 2893684298 Bacteria 2897960
321 2904500519 2904497146 Bacteria 4731781
322 2904539565 2904535858 Bacteria 6308016
323 2904777234 2904776348 Bacteria 4658726
324 2905929460 2905926851 Bacteria 4423176
325 2906801783 2906799679 Bacteria 4031749
326 2910814708 2910809715 Bacteria 4982797
327 2919038300 2919034639 Bacteria 4763403
328 2919053448 2919051321 Bacteria 4210889
329 2919059154 2919059106 Bacteria 4991624
330 2919393470 2919391150 Bacteria 4884741
331 2919541239 2919538618 Bacteria 4677069
332 2920882947 2920879853 Bacteria 4216831
333 2922555355 2922554459 Bacteria 6683962
334 2932427390 2932426870 Bacteria 4547726
335 2933420853 2933418574 Bacteria 4476724
336 2939602462 2939598168 Bacteria 4687164
337 2939650393 2939647034 Bacteria 4681660
338 2939660026 2939657138 Bacteria 3740283
339 2939676754 2939674588 Bacteria 4844420
340 2945922143 2945920336 Bacteria 4501603
341 2945941700 2945941187 Bacteria 4682474
342 2945960584 2945956166 Bacteria 5110334
343 2946005847 2946003308 Bacteria 3857229
344 2946026950 2946024296 Bacteria 3508095
345 2946037605 2946037020 Bacteria 4900426
346 2946061400 2946059875 Bacteria 4386623
347 2953998881 2953998280 Bacteria 4812144
348 2974305634 2974302888 Bacteria 4369871
349 2974316283 2974315732 Bacteria 4602776
350 2984524442 2984523437 Bacteria 4508481
351 8004023324 8004021418 Bacteria 4313954
352 8004025697 8004025490 Bacteria 4327753
353 8046354792 8046352972 Bacteria 3613806
354 8054109646 8054107350 Bacteria 5022511
355 8056040492 8056037122 Bacteria 3854319
356 Ga0307407_10081013
357 LJQas_1001236
358 LJQas_1003500
359 JGI24741J21665_1001531
360 JGI25152J39213_1000404
361 rootH2_10111265
362 rootL2_10162643
363 Ga0065714_10075979
364 Ga0065714_10090312
365 Ga0070658_10000745
366 Ga0070660_100211226
367 Ga0070669_100026581
368 Ga0070675_100018355
369 Ga0070671_100017448
370 Ga0070659_100047551
371 Ga0070667_100072484
372 Ga0070667_100119403
373 Ga0070663_100364276
374 Ga0070678_100016266
375 Ga0070678_100204268
376 Ga0068855_100039605
377 Ga0068858_100085559
378 Ga0075364_10014689
379 Ga0075364_10063295
380 Ga0075432_10000444
381 Ga0075362_10000462
382 Ga0075367_10038288
383 Ga0075369_10000010
384 Ga0075366_10000067
385 Ga0075370_10095168
386 Ga0075430_100128741
387 Ga0105244_10011107
388 Ga0105244_10015392
389 Ga0105244_10017396
390 Ga0105244_10024102
391 Ga0105245_10063027
392 Ga0105243_10006553
393 Ga0105243_10007923
394 Ga0105243_10051728
395 Ga0105242_10032051
396 Ga0105248_10133248
397 Ga0105033_103771
398 Ga0105246_10002177
399 Ga0105246_10010009
400 Ga0105246_10050695
401 Ga0105246_10104598
402 Ga0157373_10226274
403 Ga0157371_10000105
404 Ga0157371_10000447
405 Ga0157371_10006787
406 Ga0157371_10068245
407 Ga0157370_10002957
408 Ga0157370_10454185
409 Ga0157369_10080252
410 Ga0157369_10234833
411 Ga0157369_10380176
412 Ga0157372_10363778
413 Ga0163163_10059189
414 Ga0163163_10328017
415 Ga0209129_1000060
416 Ga0209025_1000805
417 Ga0209051_1003307
418 Ga0209051_1017745
419 Ga0207697_10002587
420 Ga0207655_1011263
421 Ga0207713_1020404
422 Ga0207680_10008742
423 Ga0207647_10022243
424 Ga0207645_10000753
425 Ga0207705_10000001
426 Ga0207657_10117831
427 Ga0207681_10132879
428 Ga0207659_10060996
429 Ga0207687_10082468
430 Ga0207690_10026129
431 Ga0207709_10019370
432 Ga0207709_10147732
433 Ga0207669_10093601
434 Ga0207691_10012193
435 Ga0207658_10013282
436 Ga0207703_10067202
437 Ga0207678_10195292
438 Ga0207683_10017845
439 Ga0207683_10195935
440 Ga0207683_10245677
441 Ga0207428_10007192
442 Ga0265760_10009880
443 Ga0307408_100036314
444 Ga0307408_100045518
445 Ga0307408_100091663
446 Ga0307408_100218980
447 Ga0307514_10004259
448 Ga0307405_10008506
449 Ga0307405_10022819
450 Ga0307405_10030153
451 Ga0307405_10036542
452 Ga0307413_10045079
453 Ga0307413_10231788
454 Ga0307413_10439401
455 Ga0307410_10018000
456 Ga0307410_10023510
457 Ga0307410_10026971
458 Ga0307410_10045050
459 Ga0307410_10108108
460 Ga0307406_10036312
461 Ga0307406_10281308
462 Ga0307407_10008420
463 Ga0307407_10008486
464 Ga0307407_10031778
465 Ga0307412_10002774
466 Ga0307412_10035559
467 Ga0307412_10038901
468 Ga0307412_10044632
469 Ga0307412_10047531
470 Ga0307412_10054728
471 Ga0307412_10097268
472 Ga0307412_10135741
473 Ga0307412_10198494
474 Ga0307409_100066246
475 Ga0307409_100105593
476 Ga0307409_100608012
477 Ga0307416_100022971
478 Ga0307416_100038111
479 Ga0307416_100042703
480 Ga0307416_100169561
481 Ga0307416_100252849
482 Ga0307416_100256252
483 Ga0307416_100298746
484 Ga0307414_10050615
485 Ga0307414_10087873
486 Ga0307411_10020407
487 Ga0307415_100098751
488 Ga0307415_100128710
489 Ga0307415_100201122
490 Ga0395899_0027796
491 Ga0395899_0248796
492 Ga0395900_0016012
493 Ga0395900_0027899
494 Ga0395900_0029121
495 Ga0395900_0038742
496 Ga0395900_0131778
497 Ga0395898_0042022
498 Ga0395898_0045236
499 Ga0395898_0049160
500 Ga0395898_0055163
501 Ga0395898_0226755
502 Ga0395905_0027064
503 Ga0395905_0188230
504 Ga0395905_0308137
505 Ga0395901_0006729
506 Ga0395901_0090995
507 Ga0395901_0273289
508 Ga0439436_0004288
509 Ga0439436_0007899
510 Ga0439436_0024250
511 Ga0439438_011668
512 Ga0439438_039758
513 Ga0439439_0000786
514 Ga0439439_0006765
515 Ga0439447_016048
516 Ga0439466_0037045
517 Ga0451797_0821308
518 Ga0451837_0629096
519 Ga0439433_0000115
520 Ga0439433_0001103
521 Ga0439433_0001495
522 Ga0439433_0005019
523 Ga0439442_000002
524 Ga0439442_000398
525 Ga0439442_001093
526 Ga0439449_0000633
527 Ga0439449_0001888
528 Ga0439449_0018915
529 Ga0439449_0018922
530 Ga0439452_000760
531 Ga0439457_001165
532 Ga0439457_002941
533 Ga0439457_012860
534 Ga0439462_0003716
535 Ga0450919_003990
536 Ga0450920_000318
537 Ga0450920_003369
538 Ga0450920_005475
539 Ga0450907_000013
540 Ga0439434_0000493
541 Ga0439434_0023449
542 Ga0450918_000084
543 Ga0450918_004203
544 Ga0466966_0172697
545 Ga0495629_0063585
546 Ga0495629_0089792
547 Ga0495653_0005623
548 Ga0495580_0114818
549 Ga0495582_0068119
550 Ga0495639_0195210
551 Ga0495662_0003032
552 Ga0495664_0004805
553 Ga0495594_0085280
554 Ga0495594_0137284
555 Ga0495643_0083817
556 Ga0495665_0003117
557 Ga0495586_0017823
558 Ga0495586_0049356
559 Ga0495645_0002321
560 Ga0495622_0000191
561 Ga0495667_0037556
562 Ga0495656_0001170
563 Ga0495656_0053071
564 Ga0495668_0000171
565 Ga0495588_0000236
566 Ga0495588_0006171
567 Ga0495588_0028667
568 Ga0495588_0159391
569 Ga0495658_0000810
570 Ga0495670_0003635
571 Ga0495600_0002053
572 Ga0495600_0035401
573 Ga0495600_0095689
574 Ga0495581_0057509
575 Ga0495581_0113907
576 Ga0495581_0141863
577 Ga0495604_0102906
578 Ga0495636_0070152
579 Ga0495680_0051551
580 Ga0495685_064411
581 Ga0495593_0065979
582 Ga0495602_0091116
583 Ga0496100_0008128
584 Ga0496100_0125990
585 Ga0496101_0000734
586 Ga0496102_0004059
587 Ga0496102_0090286
588 Ga0496103_0029306
589 Ga0496103_0048851
590 Ga0496106_0001088
591 Ga0496107_0001298
592 Ga0496107_0055513
593 Ga0496108_0058003
594 Ga0496109_0000744
595 Ga0496109_0095457
596 Ga0496109_0185053
597 Ga0496110_0141049
598 Ga0496111_0139433
599 Ga0496112_0111949
600 Ga0496115_0178276
601 Ga0496116_0121833
602 Ga0496117_0027639
603 Ga0496118_0001579
604 Ga0496119_0002351
605 Ga0496120_0002969
606 Ga0496121_0164648
607 Ga0496122_0000031
608 Ga0496123_0000013
609 Ga0496124_0132937
610 Ga0496125_0007006
611 Ga0496125_0074960
612 Ga0496126_0096436
613 Ga0501032_0000821
614 Ga0501034_0000549
615 Ga0501036_0081785
616 Ga0501037_0008449
617 Ga0501037_0010359
618 Ga0501037_0037855
619 Ga0501037_0222857
620 Ga0501038_0062296
621 Ga0501039_0269410
622 Ga0501043_0025355
623 Ga0501043_0054412
624 Ga0501070_0158842
625 Ga0501279_007275
626 Ga0501044_0042945
627 nmdc:mga03n38_204051_c1
628 nmdc:mga0k408_1_c1
629 nmdc:mga07m45_68190_c1
630 nmdc:mga0qj67_184991_c1
631 nmdc:mga0sz30_3_c9
632 Ga0495655_0008835
633 Ga0500643_000022
634 Ga0500644_0000776
635 Ga0500566_0000001
636 Ga0500650_0006134
637 Ga0500594_0000098
638 Ga0500614_000001
639 Ga0500614_000929
640 Ga0500628_000048
641 Ga0500559_0000220
642 Ga0500559_0009424
643 Ga0500568_0008510
644 Ga0500573_0000005
645 Ga0500573_0018636
646 Ga0500573_0048379
647 Ga0500577_0027416
648 Ga0500616_0000005
649 Ga0500649_000011
650 2537899192
651 2555228966
652 2566993417
653 2588108236
654 2644280073
655 2655033448
656 2691515278
657 2738890347
658 2739602820
659 2775655726
660 2808849704
661 2808877705
662 2808892683
663 2808899151
664 2810366015
665 2812319830
666 2844850071
667 2844853698
668 2857481362
669 2857634804
670 2857742260
671 2870625254
672 2870629424
673 2870801823
674 2870806215
675 2893685313
676 2904500519
677 2904539565
678 2904777234
679 2905929460
680 2906801783
681 2910814708
682 2919038300
683 2919053448
684 2919059154
685 2919393470
686 2919541239
687 2920882947
688 2922555355
689 2932427390
690 2933420853
691 2939602462
692 2939650393
693 2939660026
694 2939676754
695 2945922143
696 2945941700
697 2945960584
698 2946005847
699 2946026950
700 2946037605
701 2946061400
702 2953998881
703 2974305634
704 2974316283
705 2984524442
706 8004023324
707 8004025697
708 8046354792
709 8054109646
710 8056040492

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17773

UPF0176_N

UPF0176 acylphosphatase like domain

59

150

0.99

PF12368

Rhodanese_C

Rhodanase C-terminal

285

351

0.95

PF00581

Rhodanese

Rhodanese-like domain

174

277

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
4f67-assembly1.cif.gz_A three dimensional structure of the double mutant of upf0176 protein lpg2838 from legionella pneumophila at the resolution 1.8a, northeast structural genomics consortium (nesg) target lgr82 0.9004 2 238
3hix-assembly3.cif.gz_C crystal structure of the rhodanese_3 like domain from anabaena sp alr3790 protein. northeast structural genomics consortium target nsr437i 0.8414 131 224
3tp9-assembly1.cif.gz_B crystal structure of alicyclobacillus acidocaldarius protein with beta-lactamase and rhodanese domains 0.8372 109 216
3hix-assembly1.cif.gz_A crystal structure of the rhodanese_3 like domain from anabaena sp alr3790 protein. northeast structural genomics consortium target nsr437i 0.8364 131 224
8a56-assembly1.cif.gz_A coenzyme a-persulfide reductase (coapr) from enterococcus faecalis 0.8265 109 213
ID Description Score Start End Superfamily
af_Q5T7W7_160_264_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9367 2 90 3.30.70.100
af_F4I933_72_176_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9044 2 90 3.30.70.100
af_Q94AC1_131_286_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.8894 107 251 3.40.250.10
4f67A01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8888 2 90 3.30.70.100
af_Q2FUS7_100_247_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.8759 107 247 3.40.250.10
ID Description Score Start End GO Terms
AF-A0A6L6EDG9-F1-model_v4 tRNA uridine(34) hydroxylase N-terminal domain-containing protein 0.9959 1 68
AF-A0K0C0-F1-model_v4 tRNA uridine(34) hydroxylase (EC 1.14.-.-) (tRNA hydroxylation protein O) 0.9877 2 291 GO:0006400
GO:0016705
AF-A0A022L1C2-F1-model_v4 tRNA uridine(34) hydroxylase N-terminal domain-containing protein 0.9873 2 85
AF-A0A3B9W400-F1-model_v4 Rhodanese domain-containing protein 0.9832 84 291
AF-A0A7K1DD43-F1-model_v4 deleted 0.9821 2 239

Map