F420286

General Info

Members Datasets Scaffolds Average Seq Length
355 255 332 389

Family's Representative Sequence

Representative Sequence 3300048929|Ga0496126_0001706|Ga0496126_0001706_15521_16765
Length 414
Sequence MELGAHDRTPMPIVGKRVATLNPGKGVRMQLALTPEEAAFRDELRTIYTTKIPQEMRDRVRQGSAEVVHDDVVTSHKILHEHGLAVPSWPVEWGGKDWTATQHQIWADEMQLACVPEPLNFNTKMVGPVIAEFGSQEIKERFLPPTASLDIWWCQGFSEPEAGSDLASLRTTAVRDGDSYVVNGQKTWTTLGQYADWIFCLVRTDPQAPKRQAGISFLLFDMKTPGITVRPIKTIDGGHEVNELFFSDVRVPANQLVGQENQGWTYAKFLLGNERTGIAGVGRTKVRLAEVKKFAAETGVLNDPLFAARLAEAENELLALELTQSRVVTDSADGQPNPASSVLKLRGSQLQQIATELLVEVAGPDSLPVNGEGIASPDWAQRSAPRYLNYRKTSIYGGSSEVQRNIIASTILGL

Samples

Sample ID Description Type Environment
1 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
2 2643221561 Nocardioides sp. Root151 Isolate Unclassified
3 2643221641 Nocardioides sp. Root122 Isolate Unclassified
4 2643221696 Nocardioides sp. Root140 Isolate Unclassified
5 2739367898 Nocardioides sp. CF479 Isolate Unclassified
6 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
7 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
8 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
9 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
10 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
11 2857710386 Brevibacterium sp. R-73093 Isolate Unclassified
12 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
13 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
14 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
15 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
16 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
17 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
18 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
19 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
20 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
21 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
22 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
23 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
24 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
25 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
93 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
140 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
141 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
142 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
143 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
144 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
145 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
146 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
147 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
148 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
149 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
150 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
151 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
152 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
153 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
154 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
155 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
157 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
163 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
164 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
165 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
166 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
167 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
168 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
169 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
170 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
171 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
172 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
173 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
174 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
175 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
176 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
177 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
178 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
179 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
180 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
181 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
182 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
183 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
184 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
185 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
186 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
187 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
188 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
189 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
190 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
191 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
192 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
193 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
194 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
195 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
196 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
197 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
198 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
199 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
200 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
201 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
202 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
203 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
206 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
207 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
208 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
209 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
210 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
211 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
212 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
213 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
214 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
215 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
216 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
217 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
218 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
219 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
220 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
221 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
222 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
232 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
233 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
234 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
235 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
238 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
239 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
240 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
241 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
242 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
243 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
244 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
245 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
246 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
247 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
248 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
249 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
250 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
251 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
252 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
253 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
254 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
255 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.52
Metatranscriptomes 0
Isolates 6.48

Biome Distribution

Category Percentage (%)
Aerial Root 0.28
Bulb 0
Endosphere 7.61
Nodule 1.97
Rhizoplane 9.01
Rhizosphere 70.42
Stem 0
Stem Tuber 0
Unclassified 10.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10002915 3300003187 Bacteria 9798
2 Ga0055530_10001068 3300003791 Bacteria 21630
3 Ga0070658_10045921 3300005327 Bacteria 3534
4 Ga0070683_100217647 3300005329 Bacteria 1815
5 Ga0070690_100051716 3300005330 Bacteria 2624
6 Ga0070666_10057901 3300005335 Bacteria 2620
7 Ga0070682_100023876 3300005337 Bacteria 3635
8 Ga0068868_100029354 3300005338 Bacteria 4211
9 Ga0070660_100146580 3300005339 Bacteria 1896
10 Ga0070689_100010347 3300005340 Bacteria 6650
11 Ga0070689_100138904 3300005340 Bacteria 1953
12 Ga0070687_100030876 3300005343 Bacteria 2623
13 Ga0070692_10057499 3300005345 Bacteria 2040
14 Ga0070668_100154773 3300005347 Bacteria 1857
15 Ga0070674_100003758 3300005356 Bacteria 8566
16 Ga0070674_100015183 3300005356 Bacteria 4803
17 Ga0070674_100030965 3300005356 Bacteria 3540
18 Ga0070673_100036576 3300005364 Bacteria 3733
19 Ga0070688_100105458 3300005365 Bacteria 1866
20 Ga0070659_100074825 3300005366 Bacteria 2699
21 Ga0070659_100103134 3300005366 Bacteria 2297
22 Ga0070659_100177686 3300005366 Bacteria 1746
23 Ga0070667_100031359 3300005367 Bacteria 4433
24 Ga0070714_100016306 3300005435 Bacteria 5995
25 Ga0070701_10025178 3300005438 Bacteria 2886
26 Ga0070700_100025319 3300005441 Bacteria 3494
27 Ga0070663_100028198 3300005455 Bacteria 3820
28 Ga0070663_100093652 3300005455 Bacteria 2229
29 Ga0070678_100134710 3300005456 Bacteria 1968
30 Ga0068867_100024676 3300005459 Bacteria 4309
31 Ga0070685_10056857 3300005466 Bacteria 2276
32 Ga0070685_10123223 3300005466 Bacteria 1612
33 Ga0070698_100000120 3300005471 Bacteria 67569
34 Ga0070672_100005714 3300005543 Bacteria 8287
35 Ga0070686_100096019 3300005544 Bacteria 1993
36 Ga0068855_100001472 3300005563 Bacteria 29429
37 Ga0068855_100098711 3300005563 Bacteria 3364
38 Ga0070664_100034542 3300005564 Bacteria 4242
39 Ga0068857_100208414 3300005577 Bacteria 1783
40 Ga0068856_100019426 3300005614 Bacteria 6595
41 Ga0068852_100125940 3300005616 Bacteria 2352
42 Ga0068859_100129083 3300005617 Bacteria 2598
43 Ga0068864_100060181 3300005618 Bacteria 3288
44 Ga0068861_100023575 3300005719 Bacteria 4440
45 Ga0068870_10046188 3300005840 Bacteria 2283
46 Ga0068858_100010227 3300005842 Bacteria 8902
47 Ga0068860_100000739 3300005843 Bacteria 37268
48 Ga0068860_100010321 3300005843 Bacteria 9235
49 Ga0081455_10018570 3300005937 Bacteria 6615
50 Ga0081455_10025484 3300005937 Bacteria 5457
51 Ga0081455_10064414 3300005937 Bacteria 3069
52 Ga0081455_10094374 3300005937 Bacteria 2417
53 Ga0081540_1052766 3300005983 Bacteria 1999
54 Ga0081539_10001753 3300005985 Bacteria 34603
55 Ga0081539_10005221 3300005985 Bacteria 13445
56 Ga0075365_10016931 3300006038 Bacteria 4449
57 Ga0075368_10000662 3300006042 Bacteria 10457
58 Ga0075363_100003274 3300006048 Bacteria 6854
59 Ga0075362_10061473 3300006177 Bacteria 1700
60 Ga0075367_10032066 3300006178 Bacteria 3020
61 Ga0075367_10049484 3300006178 Bacteria 2477
62 Ga0075367_10064211 3300006178 Bacteria 2196
63 Ga0075369_10002338 3300006186 Bacteria 6749
64 Ga0075369_10012329 3300006186 Bacteria 3378
65 Ga0075369_10026921 3300006186 Bacteria 2400
66 Ga0097621_100009246 3300006237 Bacteria 7149
67 Ga0097620_100129084 3300006931 Bacteria 2598
68 Ga0075435_100078093 3300007076 Bacteria 2714
69 Ga0099794_10005616 3300007265 Bacteria 5044
70 Ga0111539_10018264 3300009094 Bacteria 8687
71 Ga0114129_10218795 3300009147 Bacteria 2571
72 Ga0105243_10043026 3300009148 Bacteria 3539
73 Ga0105243_10080469 3300009148 Bacteria 2657
74 Ga0105242_10015547 3300009176 Bacteria 5912
75 Ga0105248_10020991 3300009177 Bacteria 7237
76 Ga0105248_10055699 3300009177 Bacteria 4436
77 Ga0105237_10097467 3300009545 Bacteria 2931
78 Ga0105237_10325934 3300009545 Bacteria 1540
79 Ga0105246_10032931 3300011119 Bacteria 3440
80 Ga0157371_10053744 3300013102 Bacteria 2860
81 Ga0157369_10077031 3300013105 Bacteria 3574
82 Ga0163162_10118533 3300013306 Bacteria 2749
83 Ga0157372_10166158 3300013307 Bacteria 2552
84 Ga0157375_10148253 3300013308 Bacteria 2479
85 Ga0163163_10037533 3300014325 Bacteria 4714
86 Ga0163163_10118823 3300014325 Bacteria 2676
87 Ga0157380_10032860 3300014326 Bacteria 3993
88 Ga0157380_10044765 3300014326 Bacteria 3470
89 Ga0182008_10043170 3300014497 Bacteria 2245
90 Ga0163161_10107688 3300017792 Bacteria 2080
91 Ga0213876_10000607 3300021384 Bacteria 26539
92 Ga0213875_10000366 3300021388 Bacteria 41792
93 Ga0213875_10055670 3300021388 Bacteria 1852
94 Ga0207642_10045724 3300025899 Bacteria 1946
95 Ga0207710_10008303 3300025900 Bacteria 4383
96 Ga0207688_10000681 3300025901 Bacteria 16792
97 Ga0207647_10010041 3300025904 Bacteria 6698
98 Ga0207647_10082122 3300025904 Bacteria 1931
99 Ga0207645_10054845 3300025907 Bacteria 2546
100 Ga0207643_10000351 3300025908 Bacteria 30947
101 Ga0207643_10049347 3300025908 Bacteria 2385
102 Ga0207684_10106069 3300025910 Bacteria 2403
103 Ga0207654_10039036 3300025911 Bacteria 2667
104 Ga0207662_10002081 3300025918 Bacteria 9931
105 Ga0207657_10018327 3300025919 Bacteria 6688
106 Ga0207657_10107378 3300025919 Bacteria 2309
107 Ga0207652_10081860 3300025921 Bacteria 2824
108 Ga0207646_10069492 3300025922 Bacteria 3145
109 Ga0207650_10020847 3300025925 Bacteria 4629
110 Ga0207659_10134290 3300025926 Bacteria 1914
111 Ga0207700_10402702 3300025928 Bacteria 1199
112 Ga0207664_10026518 3300025929 Bacteria 4382
113 Ga0207664_10077726 3300025929 Bacteria 2690
114 Ga0207664_10079270 3300025929 Bacteria 2666
115 Ga0207664_10310231 3300025929 Bacteria 1390
116 Ga0207690_10095133 3300025932 Bacteria 2116
117 Ga0207690_10120701 3300025932 Bacteria 1903
118 Ga0207690_10206581 3300025932 Bacteria 1495
119 Ga0207706_10003906 3300025933 Bacteria 14141
120 Ga0207709_10020076 3300025935 Bacteria 3766
121 Ga0207669_10034585 3300025937 Bacteria 2865
122 Ga0207704_10007095 3300025938 Bacteria 5270
123 Ga0207704_10013100 3300025938 Bacteria 4139
124 Ga0207691_10004197 3300025940 Bacteria 13987
125 Ga0207691_10011204 3300025940 Bacteria 8605
126 Ga0207711_10032281 3300025941 Bacteria 4427
127 Ga0207711_10107751 3300025941 Bacteria 2474
128 Ga0207679_10055219 3300025945 Bacteria 2927
129 Ga0207667_10003577 3300025949 Bacteria 19202
130 Ga0207667_10124302 3300025949 Bacteria 2658
131 Ga0207712_10074854 3300025961 Bacteria 2446
132 Ga0207668_10154390 3300025972 Bacteria 1781
133 Ga0207668_10286266 3300025972 Bacteria 1354
134 Ga0207640_10043373 3300025981 Bacteria 2874
135 Ga0207658_10028779 3300025986 Bacteria 3917
136 Ga0207677_10005299 3300026023 Bacteria 6994
137 Ga0207703_10017189 3300026035 Bacteria 5644
138 Ga0207639_10197356 3300026041 Bacteria 1723
139 Ga0207678_10044355 3300026067 Bacteria 3847
140 Ga0207678_10060347 3300026067 Bacteria 3262
141 Ga0207678_10077286 3300026067 Bacteria 2851
142 Ga0207708_10001739 3300026075 Bacteria 16083
143 Ga0207708_10015979 3300026075 Bacteria 5637
144 Ga0207702_10022801 3300026078 Bacteria 5193
145 Ga0207702_10082595 3300026078 Bacteria 2794
146 Ga0207641_10080692 3300026088 Bacteria 2823
147 Ga0207641_10081149 3300026088 Bacteria 2816
148 Ga0207648_10001287 3300026089 Bacteria 27978
149 Ga0207648_10025999 3300026089 Bacteria 5206
150 Ga0207676_10065252 3300026095 Bacteria 2899
151 Ga0207674_10194555 3300026116 Bacteria 1978
152 Ga0207675_100003425 3300026118 Bacteria 15494
153 Ga0207675_100011976 3300026118 Bacteria 8105
154 Ga0207683_10013800 3300026121 Bacteria 6889
155 Ga0207683_10059122 3300026121 Bacteria 3367
156 Ga0207683_10107997 3300026121 Bacteria 2490
157 Ga0207698_10258428 3300026142 Bacteria 1598
158 Ga0209588_1014497 3300027671 Bacteria 2414
159 Ga0268266_10106844 3300028379 Bacteria 2475
160 Ga0268264_10001442 3300028381 Bacteria 22244
161 Ga0265334_10074540 3300028573 Bacteria 1259
162 Ga0307515_10001016 3300028794 Bacteria 64080
163 Ga0307515_10114019 3300028794 Bacteria 3128
164 Ga0265338_10007422 3300028800 Bacteria 13609
165 Ga0265325_10052906 3300031241 Bacteria 2083
166 Ga0265339_10068055 3300031249 Bacteria 1904
167 Ga0307513_10040252 3300031456 Bacteria 5170
168 Ga0307513_10053581 3300031456 Bacteria 4333
169 Ga0307509_10000036 3300031507 Bacteria 190164
170 Ga0307514_10000920 3300031649 Bacteria 44996
171 Ga0307516_10003681 3300031730 Bacteria 19491
172 Ga0307407_10057964 3300031903 Bacteria 2249
173 Ga0307409_100019399 3300031995 Bacteria 4603
174 Ga0307510_10003148 3300033180 Bacteria 19129
175 Ga0307510_10005532 3300033180 Bacteria 15061
176 Ga0373954_0026598 3300035118 Bacteria 2653
177 Ga0373956_0069831 3300035119 Bacteria 1602
178 Ga0373943_0004818 3300035170 Bacteria 6096
179 Ga0373946_0026267 3300035171 Bacteria 2295
180 Ga0373935_0046451 3300035692 Bacteria 2743
181 Ga0373935_0055186 3300035692 Bacteria 2531
182 Ga0373947_0017282 3300035725 Bacteria 4149
183 Ga0395899_0015346 3300037312 Bacteria 5838
184 Ga0395900_0023884 3300037418 Bacteria 6256
185 Ga0395898_0175628 3300037466 Bacteria 2047
186 Ga0436364_0353909 3300037853 Bacteria 90577
187 Ga0436364_0589852 3300037853 Bacteria 3445
188 Ga0436364_0690724 3300037853 Bacteria 11677
189 Ga0395901_0001144 3300038443 Bacteria 28148
190 Ga0395901_0065901 3300038443 Bacteria 3772
191 Ga0237816_00418 3300039145 Bacteria 3609
192 Ga0436365_0036847 3300039437 Bacteria 55248
193 Ga0436365_0059832 3300039437 Bacteria 145139
194 Ga0436365_1078067 3300039437 Bacteria 5300
195 Ga0436365_1551643 3300039437 Bacteria 9964
196 Ga0436361_1169873 3300039447 Bacteria 2676
197 Ga0451843_0464040 3300041509 Bacteria 1566
198 Ga0439456_014043 3300042013 Bacteria 1669
199 Ga0439462_0007473 3300042015 Bacteria 2736
200 Ga0466969_0001560 3300044656 Bacteria 12303
201 Ga0466969_0061118 3300044656 Bacteria 1831
202 Ga0466972_0051754 3300044658 Bacteria 1981
203 Ga0453683_0005982 3300044673 Bacteria 8384
204 Ga0453683_0006646 3300044673 Bacteria 7912
205 Ga0466966_0045810 3300044684 Bacteria 2795
206 Ga0466966_0219467 3300044684 Bacteria 1148
207 Ga0466961_0025604 3300044693 Bacteria 3793
208 Ga0466963_0003312 3300044694 Bacteria 9190
209 Ga0466963_0046749 3300044694 Bacteria 2855
210 Ga0453684_0026541 3300044712 Bacteria 8356
211 Ga0453684_0322456 3300044712 Bacteria 1749
212 Ga0466971_0039039 3300044719 Bacteria 2131
213 Ga0466968_0008236 3300044735 Bacteria 3987
214 Ga0466970_0018783 3300044765 Bacteria 3582
215 Ga0466970_0036044 3300044765 Bacteria 2619
216 Ga0466957_0037996 3300044842 Bacteria 2899
217 Ga0466960_0007482 3300044901 Bacteria 4438
218 Ga0466959_0022463 3300045049 Bacteria 4665
219 Ga0466959_0148222 3300045049 Bacteria 1655
220 Ga0466958_0042059 3300045836 Bacteria 2751
221 Ga0466958_0065235 3300045836 Bacteria 2222
222 Ga0466967_0005925 3300045976 Bacteria 8572
223 Ga0466967_0180889 3300045976 Bacteria 1989
224 Ga0495603_0023458 3300046455 Bacteria 3732
225 Ga0495641_0004514 3300046461 Bacteria 9792
226 Ga0495664_0010120 3300046477 Bacteria 5292
227 Ga0495584_0030632 3300046491 Bacteria 2724
228 Ga0495585_0104245 3300046492 Bacteria 1514
229 Ga0495594_0060107 3300046499 Bacteria 2102
230 Ga0495618_0132946 3300046514 Bacteria 1592
231 Ga0495630_0068013 3300046517 Bacteria 2678
232 Ga0495631_0073524 3300046518 Bacteria 1476
233 Ga0495598_0003859 3300046537 Bacteria 3211
234 Ga0495633_0073834 3300046558 Bacteria 1590
235 Ga0495656_0061987 3300046615 Bacteria 1635
236 Ga0495625_0126100 3300046660 Bacteria 1738
237 Ga0495613_0086667 3300046689 Bacteria 2270
238 Ga0495674_0152952 3300047319 Bacteria 1934
239 Ga0495674_0202170 3300047319 Bacteria 1648
240 Ga0495672_0000350 3300047320 Bacteria 59051
241 Ga0495676_0080751 3300047321 Bacteria 2468
242 Ga0495684_0072037 3300047471 Bacteria 2626
243 Ga0495593_0121811 3300047673 Bacteria 1327
244 Ga0496100_0035919 3300048903 Bacteria 3121
245 Ga0496101_0023968 3300048904 Bacteria 4220
246 Ga0496102_0003443 3300048905 Bacteria 13413
247 Ga0496102_0019684 3300048905 Bacteria 5947
248 Ga0496102_0074606 3300048905 Bacteria 3118
249 Ga0496103_0003398 3300048906 Bacteria 9733
250 Ga0496103_0006990 3300048906 Bacteria 6734
251 Ga0496104_0003219 3300048907 Bacteria 14051
252 Ga0496104_0035430 3300048907 Bacteria 4659
253 Ga0496105_0001390 3300048908 Bacteria 16994
254 Ga0496105_0045736 3300048908 Bacteria 3612
255 Ga0496105_0109990 3300048908 Bacteria 2274
256 Ga0496106_0062923 3300048909 Bacteria 2818
257 Ga0496106_0160024 3300048909 Bacteria 1780
258 Ga0496107_0008831 3300048910 Bacteria 6983
259 Ga0496107_0137082 3300048910 Bacteria 1808
260 Ga0496108_0001227 3300048911 Bacteria 20117
261 Ga0496108_0017171 3300048911 Bacteria 5919
262 Ga0496109_0001611 3300048912 Bacteria 18840
263 Ga0496110_0191482 3300048913 Bacteria 1857
264 Ga0496111_0010387 3300048914 Bacteria 6245
265 Ga0496111_0032011 3300048914 Bacteria 3748
266 Ga0496112_0001658 3300048915 Bacteria 17309
267 Ga0496112_0228075 3300048915 Bacteria 1817
268 Ga0496113_0000407 3300048916 Bacteria 20786
269 Ga0496113_0247299 3300048916 Bacteria 1423
270 Ga0496114_0024309 3300048917 Bacteria 4945
271 Ga0496114_0135151 3300048917 Bacteria 2132
272 Ga0496114_0171911 3300048917 Bacteria 1889
273 Ga0496115_0007808 3300048918 Bacteria 7887
274 Ga0496115_0022789 3300048918 Bacteria 4856
275 Ga0496115_0155067 3300048918 Bacteria 1892
276 Ga0496117_0024511 3300048920 Bacteria 4769
277 Ga0496117_0032057 3300048920 Bacteria 4001
278 Ga0496118_0000395 3300048921 Bacteria 73903
279 Ga0496118_0020508 3300048921 Bacteria 5856
280 Ga0496125_0003687 3300048928 Bacteria 18296
281 Ga0496125_0007057 3300048928 Bacteria 12003
282 Ga0496126_0001706 3300048929 Bacteria 32635
283 Ga0496126_0093486 3300048929 Bacteria 2640
284 Ga0501032_0008181 3300049569 Bacteria 7624
285 Ga0501034_0000124 3300049571 Bacteria 142890
286 Ga0501034_0157144 3300049571 Bacteria 2247
287 Ga0501036_0064155 3300049572 Bacteria 3109
288 Ga0501037_0001695 3300049573 Bacteria 15989
289 Ga0501037_0004899 3300049573 Bacteria 9741
290 Ga0501039_0000820 3300049575 Bacteria 22383
291 Ga0501040_0092089 3300049576 Bacteria 2108
292 Ga0501040_0143797 3300049576 Bacteria 1681
293 Ga0501043_0001927 3300049579 Bacteria 17763
294 Ga0501043_0007924 3300049579 Bacteria 8395
295 Ga0501046_0000978 3300049580 Bacteria 28003
296 Ga0501046_0106857 3300049580 Bacteria 2141
297 Ga0501046_0229972 3300049580 Bacteria 1371
298 Ga0501047_0000570 3300049581 Bacteria 39370
299 Ga0501047_0015210 3300049581 Bacteria 7328
300 Ga0501067_0032787 3300049583 Bacteria 2883
301 Ga0501069_0003269 3300049585 Bacteria 8317
302 Ga0501070_0000899 3300049586 Bacteria 27097
303 Ga0501073_0227087 3300049589 Bacteria 1289
304 Ga0501035_0000184 3300049822 Bacteria 76560
305 Ga0501035_0007197 3300049822 Bacteria 10414
306 Ga0501035_0085888 3300049822 Bacteria 2773
307 Ga0501044_0000359 3300049823 Bacteria 57013
308 Ga0501044_0017702 3300049823 Bacteria 7643
309 Ga0501045_0080602 3300049824 Bacteria 2400
310 nmdc:mga00v17_940_c1 3300050491 Bacteria 15652
311 nmdc:mga0yw44_5309_c1 3300050492 Bacteria 6058
312 nmdc:mga0k408_36820_c1 3300050493 Bacteria 2808
313 nmdc:mga06z11_50541_c1 3300050494 Bacteria 2125
314 nmdc:mga06z11_58168_c1 3300050494 Bacteria 2005
315 nmdc:mga07m45_18578_c1 3300050496 Bacteria 3756
316 nmdc:mga05p37_342567_c1 3300050507 Bacteria 1762
317 nmdc:mga05p37_72927_c1 3300050507 Bacteria 4225
318 nmdc:mga06r32_116709_c1 3300050510 Bacteria 2630
319 nmdc:mga08y16_55423_c1 3300050511 Bacteria 4142
320 nmdc:mga0n895_74971_c1 3300050512 Bacteria 3362
321 nmdc:mga0sz30_24517_c1 3300050516 Bacteria 2462
322 nmdc:mga0sz30_740_c1 3300050516 Bacteria 11932
323 Ga0495619_0035518 3300053085 Bacteria 3242
324 Ga0500583_0048109 3300053092 Bacteria 1967
325 Ga0500641_0004978 3300053096 Bacteria 4710
326 Ga0500594_0006870 3300053118 Bacteria 2564
327 Ga0500568_0014210 3300053139 Bacteria 3603
328 Ga0500568_0065730 3300053139 Bacteria 1396
329 Ga0500604_0000020 3300053151 Bacteria 77143
330 Ga0500620_005789 3300053155 Bacteria 2896
331 Ga0466962_0012437 3300061719 Bacteria 4091
332 Ga0466962_0019450 3300061719 Bacteria 3264

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041509 Ga0451843_0464040 Ga0451843_0464040_420_1406 308
2 3300005435 Ga0070714_100016306 Ga0070714_1000163064 323
3 3300013308 Ga0157375_10148253 Ga0157375_101482533 323
4 3300025929 Ga0207664_10079270 Ga0207664_100792701 323
5 3300049576 Ga0501040_0143797 Ga0501040_0143797_11_1027 331
6 3300042015 Ga0439462_0007473 Ga0439462_0007473_1644_2699 335
7 3300044684 Ga0466966_0219467 Ga0466966_0219467_78_1127 340
8 3300048918 Ga0496115_0155067 Ga0496115_0155067_565_1692 343
9 3300035725 Ga0373947_0017282 Ga0373947_0017282_1790_2962 349
10 3300046477 Ga0495664_0010120 Ga0495664_0010120_15_1127 349
11 3300035692 Ga0373935_0046451 Ga0373935_0046451_504_1676 350
12 3300005356 Ga0070674_100003758 Ga0070674_1000037584 351
13 3300005466 Ga0070685_10123223 Ga0070685_101232232 351
14 3300035118 Ga0373954_0026598 Ga0373954_0026598_1238_2422 351
15 3300047319 Ga0495674_0152952 Ga0495674_0152952_505_1689 351
16 3300053139 Ga0500568_0065730 Ga0500568_0065730_260_1381 355
17 3300013105 Ga0157369_10077031 Ga0157369_100770313 356
18 3300021388 Ga0213875_10000366 Ga0213875_100003668 356
19 3300037853 Ga0436364_0353909 Ga0436364_0353909_44924_46084 356
20 3300048910 Ga0496107_0137082 Ga0496107_0137082_229_1380 357
21 3300025972 Ga0207668_10286266 Ga0207668_102862662 358
22 3300026121 Ga0207683_10059122 Ga0207683_100591223 358
23 3300028379 Ga0268266_10106844 Ga0268266_101068442 358
24 3300049822 Ga0501035_0085888 Ga0501035_0085888_227_1387 358
25 3300028800 Ga0265338_10007422 Ga0265338_100074229 363
26 3300039437 Ga0436365_0036847 Ga0436365_0036847_39499_40665 363
27 3300031241 Ga0265325_10052906 Ga0265325_100529062 368
28 3300031249 Ga0265339_10068055 Ga0265339_100680551 368
29 3300005455 Ga0070663_100093652 Ga0070663_1000936522 369
30 3300044673 Ga0453683_0005982 Ga0453683_0005982_3677_4837 370
31 3300044712 Ga0453684_0026541 Ga0453684_0026541_3520_4680 370
32 3300007265 Ga0099794_10005616 Ga0099794_100056163 371
33 3300027671 Ga0209588_1014497 Ga0209588_10144972 371
34 iso_pu_bacteria 2784132109 2784471531 371
35 3300006186 Ga0075369_10012329 Ga0075369_100123293 372
36 3300005329 Ga0070683_100217647 Ga0070683_1002176471 373
37 3300005330 Ga0070690_100051716 Ga0070690_1000517163 373
38 3300005335 Ga0070666_10057901 Ga0070666_100579012 373
39 3300005338 Ga0068868_100029354 Ga0068868_1000293542 373
40 3300005340 Ga0070689_100010347 Ga0070689_1000103475 373
41 3300005343 Ga0070687_100030876 Ga0070687_1000308762 373
42 3300005356 Ga0070674_100015183 Ga0070674_1000151834 373
43 3300005364 Ga0070673_100036576 Ga0070673_1000365762 373
44 3300005365 Ga0070688_100105458 Ga0070688_1001054582 373
45 3300005366 Ga0070659_100074825 Ga0070659_1000748251 373
46 3300005367 Ga0070667_100031359 Ga0070667_1000313592 373
47 3300005441 Ga0070700_100025319 Ga0070700_1000253193 373
48 3300005466 Ga0070685_10056857 Ga0070685_100568572 373
49 3300005577 Ga0068857_100208414 Ga0068857_1002084142 373
50 3300005617 Ga0068859_100129083 Ga0068859_1001290832 373
51 3300005618 Ga0068864_100060181 Ga0068864_1000601812 373
52 3300005719 Ga0068861_100023575 Ga0068861_1000235752 373
53 3300005842 Ga0068858_100010227 Ga0068858_1000102276 373
54 3300005937 Ga0081455_10018570 Ga0081455_100185704 373
55 3300005983 Ga0081540_1052766 Ga0081540_10527662 373
56 3300006237 Ga0097621_100009246 Ga0097621_1000092464 373
57 3300006931 Ga0097620_100129084 Ga0097620_1001290842 373
58 3300007076 Ga0075435_100078093 Ga0075435_1000780932 373
59 3300009094 Ga0111539_10018264 Ga0111539_100182642 373
60 3300009147 Ga0114129_10218795 Ga0114129_102187953 373
61 3300009148 Ga0105243_10043026 Ga0105243_100430263 373
62 3300009177 Ga0105248_10055699 Ga0105248_100556993 373
63 3300009545 Ga0105237_10325934 Ga0105237_103259341 373
64 3300011119 Ga0105246_10032931 Ga0105246_100329313 373
65 3300013306 Ga0163162_10118533 Ga0163162_101185332 373
66 3300014325 Ga0163163_10037533 Ga0163163_100375334 373
67 3300014325 Ga0163163_10118823 Ga0163163_101188233 373
68 3300014326 Ga0157380_10032860 Ga0157380_100328602 373
69 3300014497 Ga0182008_10043170 Ga0182008_100431702 373
70 3300017792 Ga0163161_10107688 Ga0163161_101076882 373
71 3300025900 Ga0207710_10008303 Ga0207710_100083034 373
72 3300025901 Ga0207688_10000681 Ga0207688_100006813 373
73 3300025904 Ga0207647_10010041 Ga0207647_100100415 373
74 3300025907 Ga0207645_10054845 Ga0207645_100548452 373
75 3300025908 Ga0207643_10000351 Ga0207643_100003513 373
76 3300025911 Ga0207654_10039036 Ga0207654_100390363 373
77 3300025918 Ga0207662_10002081 Ga0207662_100020813 373
78 3300025921 Ga0207652_10081860 Ga0207652_100818602 373
79 3300025925 Ga0207650_10020847 Ga0207650_100208473 373
80 3300025926 Ga0207659_10134290 Ga0207659_101342902 373
81 3300025932 Ga0207690_10206581 Ga0207690_102065812 373
82 3300025933 Ga0207706_10003906 Ga0207706_100039067 373
83 3300025935 Ga0207709_10020076 Ga0207709_100200764 373
84 3300025938 Ga0207704_10007095 Ga0207704_100070952 373
85 3300025940 Ga0207691_10004197 Ga0207691_100041972 373
86 3300025941 Ga0207711_10107751 Ga0207711_101077512 373
87 3300025961 Ga0207712_10074854 Ga0207712_100748542 373
88 3300025972 Ga0207668_10154390 Ga0207668_101543902 373
89 3300025986 Ga0207658_10028779 Ga0207658_100287792 373
90 3300026023 Ga0207677_10005299 Ga0207677_100052996 373
91 3300026035 Ga0207703_10017189 Ga0207703_100171894 373
92 3300026041 Ga0207639_10197356 Ga0207639_101973562 373
93 3300026067 Ga0207678_10077286 Ga0207678_100772863 373
94 3300026075 Ga0207708_10001739 Ga0207708_100017395 373
95 3300026078 Ga0207702_10082595 Ga0207702_100825952 373
96 3300026088 Ga0207641_10080692 Ga0207641_100806922 373
97 3300026089 Ga0207648_10001287 Ga0207648_100012875 373
98 3300026095 Ga0207676_10065252 Ga0207676_100652521 373
99 3300026118 Ga0207675_100003425 Ga0207675_1000034254 373
100 3300026121 Ga0207683_10013800 Ga0207683_100138005 373
101 3300035170 Ga0373943_0004818 Ga0373943_0004818_3794_4975 373
102 3300035171 Ga0373946_0026267 Ga0373946_0026267_910_2091 373
103 3300035692 Ga0373935_0055186 Ga0373935_0055186_279_1460 373
104 3300042013 Ga0439456_014043 Ga0439456_014043_261_1433 373
105 3300046455 Ga0495603_0023458 Ga0495603_0023458_1609_2790 373
106 3300046461 Ga0495641_0004514 Ga0495641_0004514_7273_8454 373
107 3300046491 Ga0495584_0030632 Ga0495584_0030632_1495_2667 373
108 3300046492 Ga0495585_0104245 Ga0495585_0104245_300_1481 373
109 3300046499 Ga0495594_0060107 Ga0495594_0060107_273_1454 373
110 3300046514 Ga0495618_0132946 Ga0495618_0132946_91_1272 373
111 3300046517 Ga0495630_0068013 Ga0495630_0068013_940_2121 373
112 3300046518 Ga0495631_0073524 Ga0495631_0073524_271_1452 373
113 3300046537 Ga0495598_0003859 Ga0495598_0003859_1417_2598 373
114 3300046558 Ga0495633_0073834 Ga0495633_0073834_390_1571 373
115 3300046615 Ga0495656_0061987 Ga0495656_0061987_86_1267 373
116 3300046689 Ga0495613_0086667 Ga0495613_0086667_349_1530 373
117 3300047319 Ga0495674_0202170 Ga0495674_0202170_297_1478 373
118 3300047321 Ga0495676_0080751 Ga0495676_0080751_666_1847 373
119 3300047471 Ga0495684_0072037 Ga0495684_0072037_1379_2560 373
120 3300047673 Ga0495593_0121811 Ga0495593_0121811_91_1272 373
121 3300048903 Ga0496100_0035919 Ga0496100_0035919_1419_2600 373
122 3300048904 Ga0496101_0023968 Ga0496101_0023968_710_1891 373
123 3300048905 Ga0496102_0003443 Ga0496102_0003443_1076_2257 373
124 3300048905 Ga0496102_0019684 Ga0496102_0019684_3857_5038 373
125 3300048906 Ga0496103_0003398 Ga0496103_0003398_2460_3641 373
126 3300048906 Ga0496103_0006990 Ga0496103_0006990_4488_5669 373
127 3300048907 Ga0496104_0003219 Ga0496104_0003219_11374_12546 373
128 3300048907 Ga0496104_0035430 Ga0496104_0035430_2509_3690 373
129 3300048908 Ga0496105_0001390 Ga0496105_0001390_1038_2219 373
130 3300048908 Ga0496105_0045736 Ga0496105_0045736_964_2136 373
131 3300048908 Ga0496105_0109990 Ga0496105_0109990_631_1812 373
132 3300048909 Ga0496106_0062923 Ga0496106_0062923_1198_2379 373
133 3300048909 Ga0496106_0160024 Ga0496106_0160024_443_1624 373
134 3300048910 Ga0496107_0008831 Ga0496107_0008831_2294_3475 373
135 3300048911 Ga0496108_0001227 Ga0496108_0001227_3848_5029 373
136 3300048911 Ga0496108_0017171 Ga0496108_0017171_3397_4578 373
137 3300048912 Ga0496109_0001611 Ga0496109_0001611_2572_3753 373
138 3300048914 Ga0496111_0010387 Ga0496111_0010387_785_1966 373
139 3300048914 Ga0496111_0032011 Ga0496111_0032011_1332_2513 373
140 3300048915 Ga0496112_0001658 Ga0496112_0001658_1788_2969 373
141 3300048915 Ga0496112_0228075 Ga0496112_0228075_582_1754 373
142 3300048916 Ga0496113_0000407 Ga0496113_0000407_2492_3673 373
143 3300048916 Ga0496113_0247299 Ga0496113_0247299_180_1352 373
144 3300048917 Ga0496114_0024309 Ga0496114_0024309_880_2061 373
145 3300048917 Ga0496114_0135151 Ga0496114_0135151_584_1756 373
146 3300048918 Ga0496115_0007808 Ga0496115_0007808_1515_2696 373
147 3300048918 Ga0496115_0022789 Ga0496115_0022789_1703_2875 373
148 3300050492 nmdc:mga0yw44_5309_c1 nmdc:mga0yw44_5309_c1_4622_5806 373
149 3300050507 nmdc:mga05p37_342567_c1 nmdc:mga05p37_342567_c1_504_1721 373
150 3300050507 nmdc:mga05p37_72927_c1 nmdc:mga05p37_72927_c1_1278_2459 373
151 3300050510 nmdc:mga06r32_116709_c1 nmdc:mga06r32_116709_c1_996_2213 373
152 3300050512 nmdc:mga0n895_74971_c1 nmdc:mga0n895_74971_c1_761_1942 373
153 3300053085 Ga0495619_0035518 Ga0495619_0035518_550_1731 373
154 iso_pu_bacteria 2643221561 2643827603 373
155 iso_pu_bacteria 2643221641 2644229200 373
156 iso_pu_bacteria 2643221696 2644534845 373
157 iso_pu_bacteria 2739367898 2740167141 373
158 iso_pu_bacteria 2984592036 2984593394 373
159 3300026118 Ga0207675_100011976 Ga0207675_1000119765 374
160 3300050511 nmdc:mga08y16_55423_c1 nmdc:mga08y16_55423_c1_1404_2576 374
161 3300005455 Ga0070663_100028198 Ga0070663_1000281982 375
162 3300005564 Ga0070664_100034542 Ga0070664_1000345423 375
163 3300025945 Ga0207679_10055219 Ga0207679_100552192 375
164 3300026067 Ga0207678_10060347 Ga0207678_100603473 375
165 3300028573 Ga0265334_10074540 Ga0265334_100745401 375
166 3300031730 Ga0307516_10003681 Ga0307516_1000368115 375
167 3300037466 Ga0395898_0175628 Ga0395898_0175628_597_1793 375
168 3300038443 Ga0395901_0065901 Ga0395901_0065901_712_1908 375
169 3300048917 Ga0496114_0171911 Ga0496114_0171911_449_1621 375
170 3300053139 Ga0500568_0014210 Ga0500568_0014210_564_1730 375
171 iso_pu_bacteria 2855386786 2855388409 375
172 iso_pu_bacteria 2874604998 2874606282 375
173 3300005327 Ga0070658_10045921 Ga0070658_100459212 376
174 3300005339 Ga0070660_100146580 Ga0070660_1001465802 376
175 3300005366 Ga0070659_100103134 Ga0070659_1001031342 376
176 3300005563 Ga0068855_100098711 Ga0068855_1000987112 376
177 3300025904 Ga0207647_10082122 Ga0207647_100821222 376
178 3300025919 Ga0207657_10018327 Ga0207657_100183275 376
179 3300025919 Ga0207657_10107378 Ga0207657_101073782 376
180 3300025932 Ga0207690_10120701 Ga0207690_101207012 376
181 3300025949 Ga0207667_10124302 Ga0207667_101243022 376
182 3300028794 Ga0307515_10001016 Ga0307515_100010167 376
183 3300031456 Ga0307513_10040252 Ga0307513_100402522 376
184 3300031649 Ga0307514_10000920 Ga0307514_1000092042 376
185 3300044656 Ga0466969_0001560 Ga0466969_0001560_4282_5565 376
186 3300044658 Ga0466972_0051754 Ga0466972_0051754_247_1398 376
187 3300044693 Ga0466961_0025604 Ga0466961_0025604_976_2127 376
188 3300044719 Ga0466971_0039039 Ga0466971_0039039_807_1958 376
189 3300044765 Ga0466970_0036044 Ga0466970_0036044_1005_2156 376
190 3300044842 Ga0466957_0037996 Ga0466957_0037996_1582_2733 376
191 3300046660 Ga0495625_0126100 Ga0495625_0126100_392_1576 376
192 3300050493 nmdc:mga0k408_36820_c1 nmdc:mga0k408_36820_c1_1276_2436 376
193 3300053118 Ga0500594_0006870 Ga0500594_0006870_571_1755 376
194 3300053151 Ga0500604_0000020 Ga0500604_0000020_51494_52678 376
195 3300061719 Ga0466962_0012437 Ga0466962_0012437_2399_3550 376
196 3300005843 Ga0068860_100000739 Ga0068860_1000007395 377
197 3300006038 Ga0075365_10016931 Ga0075365_100169313 377
198 3300006042 Ga0075368_10000662 Ga0075368_100006629 377
199 3300031995 Ga0307409_100019399 Ga0307409_1000193997 377
200 3300049576 Ga0501040_0092089 Ga0501040_0092089_180_1331 377
201 3300049580 Ga0501046_0229972 Ga0501046_0229972_58_1212 377
202 3300049583 Ga0501067_0032787 Ga0501067_0032787_1280_2431 377
203 3300050496 nmdc:mga07m45_18578_c1 nmdc:mga07m45_18578_c1_1041_2216 377
204 3300005337 Ga0070682_100023876 Ga0070682_1000238762 378
205 3300005366 Ga0070659_100177686 Ga0070659_1001776861 378
206 3300009148 Ga0105243_10080469 Ga0105243_100804691 378
207 3300013307 Ga0157372_10166158 Ga0157372_101661582 378
208 3300014326 Ga0157380_10044765 Ga0157380_100447653 378
209 3300025908 Ga0207643_10049347 Ga0207643_100493472 378
210 3300025932 Ga0207690_10095133 Ga0207690_100951332 378
211 3300039145 Ga0237816_00418 Ga0237816_00418_678_1871 378
212 3300044765 Ga0466970_0018783 Ga0466970_0018783_2309_3466 378
213 iso_pu_bacteria 2551306166 2552110268 378
214 3300005347 Ga0070668_100154773 Ga0070668_1001547731 379
215 3300005616 Ga0068852_100125940 Ga0068852_1001259402 379
216 3300005843 Ga0068860_100010321 Ga0068860_1000103212 379
217 3300005937 Ga0081455_10064414 Ga0081455_100644145 379
218 3300006048 Ga0075363_100003274 Ga0075363_1000032746 379
219 3300006178 Ga0075367_10032066 Ga0075367_100320663 379
220 3300006178 Ga0075367_10064211 Ga0075367_100642113 379
221 3300006186 Ga0075369_10002338 Ga0075369_100023381 379
222 3300021384 Ga0213876_10000607 Ga0213876_1000060717 379
223 3300021388 Ga0213875_10055670 Ga0213875_100556702 379
224 3300025928 Ga0207700_10402702 Ga0207700_104027021 379
225 3300025929 Ga0207664_10077726 Ga0207664_100777261 379
226 3300026088 Ga0207641_10081149 Ga0207641_100811493 379
227 3300026142 Ga0207698_10258428 Ga0207698_102584281 379
228 3300028381 Ga0268264_10001442 Ga0268264_100014428 379
229 3300037853 Ga0436364_0589852 Ga0436364_0589852_458_1618 379
230 3300037853 Ga0436364_0690724 Ga0436364_0690724_9134_10342 379
231 3300039437 Ga0436365_0059832 Ga0436365_0059832_74696_75904 379
232 3300039437 Ga0436365_1078067 Ga0436365_1078067_3494_4654 379
233 3300039437 Ga0436365_1551643 Ga0436365_1551643_2400_3626 379
234 3300044656 Ga0466969_0061118 Ga0466969_0061118_330_1490 379
235 3300044684 Ga0466966_0045810 Ga0466966_0045810_1531_2691 379
236 3300044694 Ga0466963_0003312 Ga0466963_0003312_4182_5342 379
237 3300044694 Ga0466963_0046749 Ga0466963_0046749_839_1999 379
238 3300044735 Ga0466968_0008236 Ga0466968_0008236_2180_3340 379
239 3300044901 Ga0466960_0007482 Ga0466960_0007482_2350_3510 379
240 3300045049 Ga0466959_0022463 Ga0466959_0022463_1805_2965 379
241 3300045049 Ga0466959_0148222 Ga0466959_0148222_294_1469 379
242 3300045836 Ga0466958_0042059 Ga0466958_0042059_1577_2734 379
243 3300045836 Ga0466958_0065235 Ga0466958_0065235_470_1630 379
244 3300045976 Ga0466967_0005925 Ga0466967_0005925_6322_7482 379
245 3300045976 Ga0466967_0180889 Ga0466967_0180889_187_1347 379
246 3300048920 Ga0496117_0032057 Ga0496117_0032057_2285_3445 379
247 3300048921 Ga0496118_0000395 Ga0496118_0000395_52200_53360 379
248 3300048929 Ga0496126_0001706 Ga0496126_0001706_15521_16765 379
249 3300049569 Ga0501032_0008181 Ga0501032_0008181_5504_6664 379
250 3300049571 Ga0501034_0157144 Ga0501034_0157144_551_1711 379
251 3300049572 Ga0501036_0064155 Ga0501036_0064155_1735_2901 379
252 3300049573 Ga0501037_0001695 Ga0501037_0001695_2046_3212 379
253 3300049573 Ga0501037_0004899 Ga0501037_0004899_1134_2294 379
254 3300049575 Ga0501039_0000820 Ga0501039_0000820_5574_6740 379
255 3300049579 Ga0501043_0001927 Ga0501043_0001927_7935_9101 379
256 3300049579 Ga0501043_0007924 Ga0501043_0007924_2623_3783 379
257 3300049580 Ga0501046_0000978 Ga0501046_0000978_20316_21476 379
258 3300049580 Ga0501046_0106857 Ga0501046_0106857_189_1349 379
259 3300049581 Ga0501047_0000570 Ga0501047_0000570_33356_34516 379
260 3300049581 Ga0501047_0015210 Ga0501047_0015210_1924_3084 379
261 3300049585 Ga0501069_0003269 Ga0501069_0003269_2867_4027 379
262 3300049586 Ga0501070_0000899 Ga0501070_0000899_12917_14077 379
263 3300049589 Ga0501073_0227087 Ga0501073_0227087_47_1213 379
264 3300049822 Ga0501035_0000184 Ga0501035_0000184_53107_54267 379
265 3300049822 Ga0501035_0007197 Ga0501035_0007197_1831_2991 379
266 3300049823 Ga0501044_0000359 Ga0501044_0000359_9912_11072 379
267 3300049823 Ga0501044_0017702 Ga0501044_0017702_5957_7117 379
268 3300050491 nmdc:mga00v17_940_c1 nmdc:mga00v17_940_c1_837_1994 379
269 3300050494 nmdc:mga06z11_50541_c1 nmdc:mga06z11_50541_c1_279_1439 379
270 3300050516 nmdc:mga0sz30_24517_c1 nmdc:mga0sz30_24517_c1_499_1656 379
271 3300061719 Ga0466962_0019450 Ga0466962_0019450_299_1456 379
272 3300025929 Ga0207664_10310231 Ga0207664_103102311 380
273 3300028794 Ga0307515_10114019 Ga0307515_101140193 380
274 3300031456 Ga0307513_10053581 Ga0307513_100535813 380
275 iso_pu_bacteria 2824732956 2824734624 380
276 iso_pu_bacteria 2842038055 2842045502 380
277 iso_pu_bacteria 2842045827 2842053411 380
278 iso_pu_bacteria 2904765812 2904767235 380
279 iso_pu_bacteria 2904770941 2904775881 380
280 iso_pu_bacteria 2908811453 2908812614 380
281 iso_pu_bacteria 2919420072 2919424902 380
282 iso_pu_bacteria 2919432681 2919437468 380
283 3300047320 Ga0495672_0000350 Ga0495672_0000350_14344_15543 381
284 3300005340 Ga0070689_100138904 Ga0070689_1001389043 382
285 3300005345 Ga0070692_10057499 Ga0070692_100574991 382
286 3300005356 Ga0070674_100030965 Ga0070674_1000309652 382
287 3300005438 Ga0070701_10025178 Ga0070701_100251782 382
288 3300005456 Ga0070678_100134710 Ga0070678_1001347102 382
289 3300005459 Ga0068867_100024676 Ga0068867_1000246765 382
290 3300005543 Ga0070672_100005714 Ga0070672_1000057145 382
291 3300005544 Ga0070686_100096019 Ga0070686_1000960192 382
292 3300005840 Ga0068870_10046188 Ga0068870_100461882 382
293 3300009176 Ga0105242_10015547 Ga0105242_100155473 382
294 3300009177 Ga0105248_10020991 Ga0105248_100209914 382
295 3300013102 Ga0157371_10053744 Ga0157371_100537442 382
296 3300025899 Ga0207642_10045724 Ga0207642_100457242 382
297 3300025937 Ga0207669_10034585 Ga0207669_100345852 382
298 3300025938 Ga0207704_10013100 Ga0207704_100131002 382
299 3300025940 Ga0207691_10011204 Ga0207691_100112044 382
300 3300025941 Ga0207711_10032281 Ga0207711_100322812 382
301 3300025981 Ga0207640_10043373 Ga0207640_100433732 382
302 3300026067 Ga0207678_10044355 Ga0207678_100443552 382
303 3300026075 Ga0207708_10015979 Ga0207708_100159792 382
304 3300026089 Ga0207648_10025999 Ga0207648_100259992 382
305 3300026121 Ga0207683_10107997 Ga0207683_101079972 382
306 3300031507 Ga0307509_10000036 Ga0307509_1000003670 382
307 3300048913 Ga0496110_0191482 Ga0496110_0191482_39_1211 382
308 iso_pu_bacteria 2935630451 2935638135 382
309 iso_pu_bacteria 2941507105 2941514792 382
310 iso_pu_bacteria 2941515067 2941522750 382
311 iso_pu_bacteria 2941523033 2941530685 382
312 3300031903 Ga0307407_10057964 Ga0307407_100579642 383
313 3300049824 Ga0501045_0080602 Ga0501045_0080602_1134_2315 383
314 iso_pu_bacteria 2928115317 2928116951 383
315 3300025929 Ga0207664_10026518 Ga0207664_100265184 384
316 3300053155 Ga0500620_005789 Ga0500620_005789_311_1486 384
317 3300044712 Ga0453684_0322456 Ga0453684_0322456_333_1523 385
318 iso_pu_bacteria 2857710386 2857710989 385
319 3300005471 Ga0070698_100000120 Ga0070698_10000012023 386
320 3300005937 Ga0081455_10025484 Ga0081455_100254842 386
321 3300005937 Ga0081455_10094374 Ga0081455_100943742 386
322 3300005985 Ga0081539_10001753 Ga0081539_100017536 386
323 3300005985 Ga0081539_10005221 Ga0081539_100052212 386
324 3300006177 Ga0075362_10061473 Ga0075362_100614732 386
325 3300006178 Ga0075367_10049484 Ga0075367_100494842 386
326 3300006186 Ga0075369_10026921 Ga0075369_100269212 386
327 3300025910 Ga0207684_10106069 Ga0207684_101060692 386
328 3300025922 Ga0207646_10069492 Ga0207646_100694922 386
329 3300026116 Ga0207674_10194555 Ga0207674_101945552 386
330 3300037312 Ga0395899_0015346 Ga0395899_0015346_249_1445 386
331 3300037418 Ga0395900_0023884 Ga0395900_0023884_983_2179 386
332 3300038443 Ga0395901_0001144 Ga0395901_0001144_6719_7915 386
333 3300039447 Ga0436361_1169873 Ga0436361_1169873_936_2132 386
334 3300044673 Ga0453683_0006646 Ga0453683_0006646_6200_7360 386
335 3300048928 Ga0496125_0003687 Ga0496125_0003687_13584_14786 386
336 3300048929 Ga0496126_0093486 Ga0496126_0093486_33_1229 386
337 3300050494 nmdc:mga06z11_58168_c1 nmdc:mga06z11_58168_c1_748_1944 386
338 3300050516 nmdc:mga0sz30_740_c1 nmdc:mga0sz30_740_c1_185_1381 386
339 3300053096 Ga0500641_0004978 Ga0500641_0004978_2292_3500 386
340 3300048920 Ga0496117_0024511 Ga0496117_0024511_2782_3966 387
341 3300048921 Ga0496118_0020508 Ga0496118_0020508_2696_3880 387
342 3300003791 Ga0055530_10001068 Ga0055530_1000106814 388
343 3300033180 Ga0307510_10003148 Ga0307510_100031484 388
344 3300033180 Ga0307510_10005532 Ga0307510_100055324 388
345 3300053092 Ga0500583_0048109 Ga0500583_0048109_73_1275 388
346 3300005563 Ga0068855_100001472 Ga0068855_10000147215 389
347 3300005614 Ga0068856_100019426 Ga0068856_1000194264 389
348 3300009545 Ga0105237_10097467 Ga0105237_100974673 389
349 3300025949 Ga0207667_10003577 Ga0207667_1000357716 389
350 3300026078 Ga0207702_10022801 Ga0207702_100228012 389
351 3300049571 Ga0501034_0000124 Ga0501034_0000124_102871_104040 389
352 3300035119 Ga0373956_0069831 Ga0373956_0069831_85_1290 390
353 3300048905 Ga0496102_0074606 Ga0496102_0074606_1351_2562 390
354 3300048928 Ga0496125_0007057 Ga0496125_0007057_4056_5228 390
355 3300003187 JGI25151J46595_10002915 JGI25151J46595_100029157 394

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00441

Acyl-CoA_dh_1

Acyl-CoA dehydrogenase, C-terminal domain

261

412

0.93

PF02770

Acyl-CoA_dh_M

Acyl-CoA dehydrogenase, middle domain

154

249

0.89

PF02771

Acyl-CoA_dh_N

Acyl-CoA dehydrogenase, N-terminal domain

34

150

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hk0-assembly1.cif.gz_A crystal structure of fic32-33 complex from streptomyces ficellus nrrl 8067 0.8701 1 390
4x28-assembly1.cif.gz_B crystal structure of the chse4-chse5 complex from mycobacterium tuberculosis 0.8644 1 394
8hk0-assembly1.cif.gz_A crystal structure of fic32-33 complex from streptomyces ficellus nrrl 8067 0.8636 1 390
4x28-assembly1.cif.gz_A crystal structure of the chse4-chse5 complex from mycobacterium tuberculosis 0.8569 1 394
6wy8-assembly1.cif.gz_D tcur3481-tcur3483 steroid acad 0.8546 1 394
ID Description Score Start End Superfamily
af_P96855_462_572_2.40.110.10 Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 0.9774 125 238 2.40.110.10
af_P96855_462_572_2.40.110.10 Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 0.9603 125 238 2.40.110.10
4x28B02 Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 0.9419 121 233 2.40.110.10
4x28B02 Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 0.9332 121 233 2.40.110.10
5iduB02 Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 0.911 125 243 2.40.110.10
ID Description Score Start End GO Terms
AF-F8UHV1-F1-model_v4 Acyl-CoA dehydrogenase domain-containing protein 0.9868 1 125 GO:0005886
GO:0016627
GO:0050660
AF-F8UHV1-F1-model_v4 Acyl-CoA dehydrogenase domain-containing protein 0.9794 1 125 GO:0005886
GO:0016627
GO:0050660
AF-A0A6G3VNV3-F1-model_v4 deleted 0.9735 154 229
AF-A0A534QKV1-F1-model_v4 Acyl-CoA dehydrogenase 0.9689 97 251 GO:0005886
GO:0016627
GO:0050660
AF-A0A5Q0M5F7-F1-model_v4 Acyl-CoA dehydrogenase 0.9682 1 394 GO:0005886
GO:0016627
GO:0050660

Feature Viewer

pLDDT pTM Quality
90.09 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map