F420546

General Info

Members Datasets Scaffolds Average Seq Length
356 233 352 117

Family's Representative Sequence

Representative Sequence 3300031616|Ga0307508_10533754|Ga0307508_105337542
Length 141
Sequence MGSLIWFVAIVAMIPVALWLLKRTPMGGGGAGQGVLRSVAALPLSTNQRIVTVEVGQGDARRWLVLGVTAQSITTLHTMEPQDDSTSVRADASTGSAQGTPGGVSKPLARPFDASGRTGFAGSAFAQLLGKLRQDRGHDGR

Samples

Sample ID Description Type Environment
1 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
2 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
3 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
4 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
74 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
106 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
107 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
111 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
112 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
113 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
114 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
115 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
116 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
117 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
118 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
119 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
120 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
121 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
122 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
123 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
129 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
130 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
131 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
132 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
135 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
136 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
137 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
138 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
139 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
140 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
141 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
142 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
143 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
144 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
145 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
146 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
147 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
148 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
149 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
150 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
151 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
152 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
153 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
154 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
157 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
158 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
159 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
160 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
161 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
162 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
163 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
164 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
165 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
166 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
167 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
168 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
169 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
170 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
171 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
172 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
173 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
174 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
175 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
176 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
177 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
178 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
179 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
180 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
181 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
182 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
185 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
186 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
187 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
188 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
189 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
190 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
195 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
196 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
198 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
199 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
200 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
201 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
202 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
203 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
204 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
205 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
206 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
207 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
208 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
209 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
210 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
211 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
212 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
213 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
214 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
215 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
216 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
217 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
218 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
219 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
220 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
221 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
222 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
223 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
224 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
225 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
226 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
227 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
228 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
229 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
230 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
231 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
232 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
233 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.88
Metatranscriptomes 0
Isolates 1.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27.81
Nodule 0.56
Rhizoplane 3.09
Rhizosphere 54.78
Stem 0
Stem Tuber 0
Unclassified 13.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10000374 3300003316 Bacteria 1366
2 Ga0055524_1000207 3300003775 Bacteria 63213
3 Ga0055530_10020044 3300003791 Bacteria 2009
4 Ga0055540_1000011 3300003792 Bacteria 282927
5 Ga0055531_10011526 3300003794 Bacteria 4250
6 Ga0065712_10392942 3300005290 Bacteria 739
7 Ga0070658_11959667 3300005327 Bacteria 506
8 Ga0070676_10238881 3300005328 Bacteria 1207
9 Ga0070676_10261244 3300005328 Bacteria 1159
10 Ga0070676_10700502 3300005328 Bacteria 740
11 Ga0070676_10960017 3300005328 Bacteria 640
12 Ga0070677_10136034 3300005333 Bacteria 1127
13 Ga0068869_100140779 3300005334 Bacteria 1862
14 Ga0068869_101307396 3300005334 Bacteria 640
15 Ga0068869_101337360 3300005334 Bacteria 633
16 Ga0070666_10638105 3300005335 Bacteria 779
17 Ga0070666_11036339 3300005335 Bacteria 609
18 Ga0068868_100142665 3300005338 Bacteria 1968
19 Ga0068868_101819277 3300005338 Bacteria 576
20 Ga0070661_100352634 3300005344 Bacteria 1155
21 Ga0070674_100038484 3300005356 Bacteria 3223
22 Ga0070659_102125722 3300005366 Bacteria 505
23 Ga0070667_100067360 3300005367 Bacteria 3043
24 Ga0070667_100381458 3300005367 Bacteria 1280
25 Ga0070708_100063831 3300005445 Bacteria 3298
26 Ga0070663_100581300 3300005455 Bacteria 940
27 Ga0070678_100108557 3300005456 Bacteria 2166
28 Ga0070662_100008348 3300005457 Bacteria 6748
29 Ga0068867_100625785 3300005459 Bacteria 942
30 Ga0068867_100774260 3300005459 Bacteria 853
31 Ga0068867_100810824 3300005459 Bacteria 835
32 Ga0070706_100004486 3300005467 Bacteria 13456
33 Ga0070707_100168314 3300005468 Bacteria 2135
34 Ga0070698_100138790 3300005471 Bacteria 2384
35 Ga0070699_101828208 3300005518 Bacteria 556
36 Ga0068853_100533441 3300005539 Bacteria 1110
37 Ga0070672_101132964 3300005543 Bacteria 696
38 Ga0070665_100188616 3300005548 Bacteria 2063
39 Ga0070665_101779213 3300005548 Bacteria 623
40 Ga0070664_101357360 3300005564 Bacteria 672
41 Ga0068857_100900109 3300005577 Bacteria 848
42 Ga0068854_100371822 3300005578 Bacteria 1176
43 Ga0068854_101262813 3300005578 Bacteria 664
44 Ga0068852_100069007 3300005616 Bacteria 3096
45 Ga0068852_100191432 3300005616 Bacteria 1930
46 Ga0068859_102255787 3300005617 Bacteria 600
47 Ga0068870_11069222 3300005840 Bacteria 579
48 Ga0068863_100372012 3300005841 Bacteria 1394
49 Ga0068858_101188144 3300005842 Bacteria 750
50 Ga0068858_102376110 3300005842 Bacteria 524
51 Ga0068860_100317511 3300005843 Bacteria 1529
52 Ga0068860_102442338 3300005843 Bacteria 542
53 Ga0075368_10278558 3300006042 Bacteria 718
54 Ga0075368_10463216 3300006042 Bacteria 562
55 Ga0075363_100073012 3300006048 Bacteria 1866
56 Ga0075362_10232912 3300006177 Bacteria 902
57 Ga0075362_10277533 3300006177 Bacteria 828
58 Ga0075362_10368107 3300006177 Bacteria 721
59 Ga0075362_10542039 3300006177 Bacteria 598
60 Ga0075367_10015588 3300006178 Bacteria 4137
61 Ga0075367_10051425 3300006178 Bacteria 2435
62 Ga0075367_10820546 3300006178 Bacteria 592
63 Ga0075369_10013367 3300006186 Bacteria 3258
64 Ga0075366_10018643 3300006195 Bacteria 4008
65 Ga0075366_10111259 3300006195 Bacteria 1647
66 Ga0075366_10114569 3300006195 Bacteria 1623
67 Ga0075366_10137338 3300006195 Bacteria 1477
68 Ga0075366_10180168 3300006195 Bacteria 1283
69 Ga0075366_10384257 3300006195 Bacteria 863
70 Ga0075366_10407905 3300006195 Bacteria 836
71 Ga0075366_10503980 3300006195 Bacteria 748
72 Ga0075366_10743065 3300006195 Bacteria 610
73 Ga0097621_102156581 3300006237 Bacteria 533
74 Ga0075370_10000524 3300006353 Bacteria 14643
75 Ga0075370_10015599 3300006353 Bacteria 4070
76 Ga0075370_10080520 3300006353 Bacteria 1871
77 Ga0075370_10154210 3300006353 Bacteria 1346
78 Ga0075370_10319799 3300006353 Bacteria 924
79 Ga0075370_10327937 3300006353 Bacteria 912
80 Ga0075370_10400365 3300006353 Bacteria 823
81 Ga0075370_10440720 3300006353 Bacteria 783
82 Ga0068871_100191582 3300006358 Bacteria 1761
83 Ga0068865_100091831 3300006881 Bacteria 2204
84 Ga0068865_100458277 3300006881 Bacteria 1056
85 Ga0097620_102255767 3300006931 Bacteria 600
86 Ga0079104_1000040 3300006946 Bacteria 187962
87 Ga0105240_10039246 3300009093 Bacteria 6065
88 Ga0105245_10626782 3300009098 Bacteria 1104
89 Ga0105245_11668027 3300009098 Bacteria 689
90 Ga0105247_11034521 3300009101 Bacteria 644
91 Ga0114129_10023973 3300009147 Bacteria 8647
92 Ga0105243_11654611 3300009148 Bacteria 668
93 Ga0105241_10491989 3300009174 Bacteria 1092
94 Ga0105248_11013886 3300009177 Bacteria 938
95 Ga0105237_10014977 3300009545 Bacteria 8082
96 Ga0105237_10073055 3300009545 Bacteria 3423
97 Ga0105238_11603040 3300009551 Bacteria 681
98 Ga0105249_10325198 3300009553 Bacteria 1550
99 Ga0105239_10114097 3300010375 Bacteria 2997
100 Ga0105246_11902535 3300011119 Bacteria 571
101 Ga0157374_10074924 3300013296 Bacteria 3197
102 Ga0157378_10924468 3300013297 Bacteria 904
103 Ga0163162_11334731 3300013306 Bacteria 815
104 Ga0157372_10591818 3300013307 Bacteria 1293
105 Ga0157375_10611225 3300013308 Bacteria 1249
106 Ga0182008_10545230 3300014497 Bacteria 644
107 Ga0182008_10988875 3300014497 Bacteria 501
108 Ga0157379_10297734 3300014968 Bacteria 1470
109 Ga0182007_10301788 3300015262 Bacteria 588
110 Ga0209050_1000416 3300025298 Bacteria 78976
111 Ga0209256_1000092 3300025299 Bacteria 210547
112 Ga0209051_1000020 3300025303 Bacteria 508628
113 Ga0209257_1000085 3300025304 Bacteria 291117
114 Ga0209257_1053011 3300025304 Bacteria 1137
115 Ga0207682_10128642 3300025893 Bacteria 1129
116 Ga0207642_10097420 3300025899 Bacteria 1468
117 Ga0207642_10622329 3300025899 Bacteria 674
118 Ga0207705_11040526 3300025909 Bacteria 632
119 Ga0207684_10005949 3300025910 Bacteria 11169
120 Ga0207695_10061905 3300025913 Bacteria 3866
121 Ga0207671_10125132 3300025914 Bacteria 1968
122 Ga0207646_10067554 3300025922 Bacteria 3191
123 Ga0207687_10743257 3300025927 Bacteria 834
124 Ga0207644_11019641 3300025931 Bacteria 695
125 Ga0207706_10007829 3300025933 Bacteria 9862
126 Ga0207669_10041654 3300025937 Bacteria 2675
127 Ga0207669_10880055 3300025937 Bacteria 747
128 Ga0207669_11415968 3300025937 Bacteria 592
129 Ga0207704_11071787 3300025938 Bacteria 684
130 Ga0207691_10665293 3300025940 Bacteria 879
131 Ga0207689_10050658 3300025942 Bacteria 3423
132 Ga0207689_10778189 3300025942 Bacteria 808
133 Ga0207689_10790022 3300025942 Bacteria 801
134 Ga0207640_10300170 3300025981 Bacteria 1270
135 Ga0207658_10005654 3300025986 Bacteria 8561
136 Ga0207658_10485408 3300025986 Bacteria 1098
137 Ga0207658_10671110 3300025986 Bacteria 935
138 Ga0207677_10790497 3300026023 Bacteria 849
139 Ga0207703_11287620 3300026035 Bacteria 703
140 Ga0207639_10702118 3300026041 Bacteria 939
141 Ga0207639_12054524 3300026041 Bacteria 533
142 Ga0207678_10356093 3300026067 Bacteria 1263
143 Ga0207702_10069860 3300026078 Bacteria 3020
144 Ga0207641_10969676 3300026088 Bacteria 846
145 Ga0207648_10185662 3300026089 Bacteria 1842
146 Ga0207648_10751260 3300026089 Bacteria 906
147 Ga0207648_11816714 3300026089 Bacteria 571
148 Ga0207674_10403467 3300026116 Bacteria 1321
149 Ga0207674_10464750 3300026116 Bacteria 1223
150 Ga0207675_100100746 3300026118 Bacteria 2721
151 Ga0207683_11333176 3300026121 Bacteria 664
152 Ga0207698_10185317 3300026142 Bacteria 1848
153 Ga0209281_1000074 3300027111 Bacteria 267848
154 Ga0209813_10355468 3300027866 Bacteria 581
155 Ga0209974_10006661 3300027876 Bacteria 4017
156 Ga0268266_10264699 3300028379 Bacteria 1594
157 Ga0268264_12090107 3300028381 Bacteria 575
158 Ga0307517_10005592 3300028786 Bacteria 18878
159 Ga0307517_10287715 3300028786 Bacteria 931
160 Ga0307517_10412502 3300028786 Bacteria 711
161 Ga0307515_10000232 3300028794 Bacteria 137778
162 Ga0307515_10100821 3300028794 Bacteria 3492
163 Ga0307515_10127844 3300028794 Bacteria 2823
164 Ga0307515_10229842 3300028794 Bacteria 1650
165 Ga0307515_10277265 3300028794 Bacteria 1389
166 Ga0307512_10047346 3300030522 Bacteria 3495
167 Ga0307512_10095765 3300030522 Bacteria 2040
168 Ga0265327_10117408 3300031251 Bacteria 1265
169 Ga0307513_10051949 3300031456 Bacteria 4416
170 Ga0307513_10065125 3300031456 Bacteria 3835
171 Ga0307513_10070103 3300031456 Bacteria 3666
172 Ga0307513_10285307 3300031456 Bacteria 1426
173 Ga0307509_10003083 3300031507 Bacteria 25889
174 Ga0307509_10162846 3300031507 Bacteria 2124
175 Ga0307509_10165756 3300031507 Bacteria 2099
176 Ga0307509_10166102 3300031507 Bacteria 2095
177 Ga0307509_10186744 3300031507 Bacteria 1930
178 Ga0307509_10224368 3300031507 Bacteria 1688
179 Ga0307508_10000016 3300031616 Bacteria 206976
180 Ga0307508_10001467 3300031616 Bacteria 26444
181 Ga0307508_10273276 3300031616 Bacteria 1283
182 Ga0307508_10381315 3300031616 Bacteria 1000
183 Ga0307508_10533754 3300031616 Bacteria 770
184 Ga0307514_10106657 3300031649 Bacteria 1997
185 Ga0307514_10119814 3300031649 Bacteria 1839
186 Ga0307514_10337928 3300031649 Bacteria 813
187 Ga0307516_10128425 3300031730 Bacteria 2317
188 Ga0307516_10400815 3300031730 Bacteria 1031
189 Ga0307516_10479810 3300031730 Bacteria 898
190 Ga0307516_10579170 3300031730 Bacteria 776
191 Ga0307405_11882234 3300031731 Bacteria 533
192 Ga0307413_10510139 3300031824 Bacteria 967
193 Ga0307410_10550279 3300031852 Bacteria 956
194 Ga0307406_10208539 3300031901 Bacteria 1444
195 Ga0307406_10309571 3300031901 Bacteria 1217
196 Ga0307407_10502082 3300031903 Bacteria 889
197 Ga0307412_10106523 3300031911 Bacteria 1993
198 Ga0307416_100087114 3300032002 Bacteria 2665
199 Ga0307416_100968430 3300032002 Bacteria 953
200 Ga0307414_10911434 3300032004 Bacteria 806
201 Ga0307411_10108135 3300032005 Bacteria 1983
202 Ga0307411_10684478 3300032005 Bacteria 891
203 Ga0307507_10177933 3300033179 Bacteria 1527
204 Ga0307507_10344242 3300033179 Bacteria 881
205 Ga0307507_10450076 3300033179 Bacteria 711
206 Ga0307510_10000568 3300033180 Bacteria 37247
207 Ga0307510_10016370 3300033180 Bacteria 8751
208 Ga0307510_10301937 3300033180 Bacteria 1063
209 Ga0307510_10402173 3300033180 Bacteria 812
210 Ga0373945_0287196 3300035116 Bacteria 702
211 Ga0373946_0495666 3300035171 Bacteria 626
212 Ga0373947_0397724 3300035725 Bacteria 929
213 Ga0373937_0437509 3300036401 Bacteria 1241
214 Ga0373925_0112972 3300037068 Bacteria 2100
215 Ga0451787_055325 3300041441 Bacteria 1443
216 Ga0451791_0409111 3300041451 Bacteria 642
217 Ga0451793_1056955 3300041452 Bacteria 1796
218 Ga0451797_1591649 3300041453 Bacteria 847
219 Ga0451807_0187731 3300041486 Bacteria 1533
220 Ga0451839_0443244 3300041496 Bacteria 1170
221 Ga0451845_0299363 3300041501 Bacteria 671
222 Ga0451849_0824555 3300041505 Bacteria 1294
223 Ga0451843_1523235 3300041509 Bacteria 767
224 Ga0451855_0736938 3300041511 Bacteria 699
225 Ga0451853_3367089 3300041512 Bacteria 1657
226 Ga0439450_196380 3300042008 Bacteria 539
227 Ga0450919_001683 3300042121 Bacteria 2890
228 Ga0450890_015510 3300042127 Bacteria 1003
229 Ga0450898_015580 3300042134 Bacteria 1289
230 Ga0450889_040710 3300042144 Bacteria 560
231 Ga0439464_0244109 3300042439 Bacteria 579
232 Ga0450918_000344 3300042531 Bacteria 10277
233 Ga0451577_0577238 3300042876 Bacteria 1021
234 Ga0453684_0007748 3300044712 Bacteria 19588
235 Ga0453684_1120683 3300044712 Bacteria 830
236 Ga0451576_0407935 3300045051 Bacteria 1425
237 Ga0451576_1473871 3300045051 Bacteria 707
238 Ga0495617_100773 3300046452 Bacteria 939
239 Ga0495592_0000213 3300046454 Bacteria 49631
240 Ga0495590_0084021 3300046457 Bacteria 1122
241 Ga0495605_0124265 3300046474 Bacteria 1168
242 Ga0495585_0251027 3300046492 Bacteria 883
243 Ga0495583_0378407 3300046506 Bacteria 557
244 Ga0495583_0452096 3300046506 Bacteria 503
245 Ga0495606_0273610 3300046507 Bacteria 927
246 Ga0495608_0813612 3300046511 Bacteria 551
247 Ga0495610_0165272 3300046512 Bacteria 932
248 Ga0495616_0177058 3300046513 Bacteria 950
249 Ga0495620_0287524 3300046515 Bacteria 625
250 Ga0495630_0227592 3300046517 Bacteria 1424
251 Ga0495632_0010962 3300046519 Bacteria 5318
252 Ga0495632_0067015 3300046519 Bacteria 1731
253 Ga0495643_0074440 3300046522 Bacteria 1778
254 Ga0495648_0090462 3300046524 Bacteria 1715
255 Ga0495648_0227511 3300046524 Bacteria 915
256 Ga0495654_0135324 3300046530 Bacteria 1103
257 Ga0495597_0010476 3300046542 Bacteria 4530
258 Ga0495668_0060772 3300046616 Bacteria 2084
259 Ga0495668_0648245 3300046616 Bacteria 584
260 Ga0495625_0021963 3300046660 Bacteria 4900
261 Ga0495625_0060694 3300046660 Bacteria 2678
262 Ga0495661_0174011 3300046665 Bacteria 1146
263 Ga0495658_0206479 3300046683 Bacteria 1226
264 Ga0495671_0154002 3300046692 Bacteria 1119
265 Ga0495671_0412442 3300046692 Bacteria 646
266 Ga0495649_0001371 3300046694 Bacteria 18487
267 Ga0495687_002064 3300047443 Bacteria 16886
268 Ga0495687_005696 3300047443 Bacteria 7855
269 Ga0495679_045104 3300047446 Bacteria 1348
270 Ga0495686_0032063 3300047472 Bacteria 3403
271 Ga0495686_0260376 3300047472 Bacteria 971
272 Ga0495626_0048720 3300048091 Bacteria 1965
273 Ga0496102_0001355 3300048905 Bacteria 21922
274 Ga0496102_0025441 3300048905 Bacteria 5269
275 Ga0496106_0012991 3300048909 Bacteria 6144
276 Ga0496113_0191649 3300048916 Bacteria 1623
277 Ga0496114_0022464 3300048917 Bacteria 5143
278 Ga0496114_0993185 3300048917 Bacteria 722
279 Ga0496125_0365993 3300048928 Bacteria 855
280 Ga0501292_032326 3300049515 Bacteria 883
281 Ga0501299_070011 3300049522 Bacteria 760
282 Ga0501043_0000545 3300049579 Bacteria 33864
283 Ga0501046_0004297 3300049580 Bacteria 12968
284 Ga0501047_0000757 3300049581 Bacteria 33717
285 Ga0501048_0013766 3300049582 Bacteria 6000
286 Ga0501207_006287 3300049654 Bacteria 1664
287 Ga0501265_002252 3300049762 Bacteria 2185
288 Ga0501035_1102018 3300049822 Bacteria 620
289 Ga0501045_0002486 3300049824 Bacteria 12544
290 nmdc:mga03683_12587_c1 3300050489 Bacteria 3095
291 nmdc:mga03683_22920_c1 3300050489 Bacteria 2426
292 nmdc:mga00v17_824567_c1 3300050491 Bacteria 590
293 nmdc:mga0yw44_217429_c1 3300050492 Bacteria 1265
294 nmdc:mga0k408_264197_c1 3300050493 Bacteria 1028
295 nmdc:mga0k408_26610_c1 3300050493 Bacteria 3281
296 nmdc:mga0k408_271462_c1 3300050493 Bacteria 1013
297 nmdc:mga0k408_40302_c1 3300050493 Bacteria 2687
298 nmdc:mga0k408_435859_c1 3300050493 Bacteria 779
299 nmdc:mga0k408_46145_c1 3300050493 Bacteria 2516
300 nmdc:mga0k408_6644_c1 3300050493 Bacteria 6167
301 nmdc:mga0k408_72889_c1 3300050493 Bacteria 2006
302 nmdc:mga06z11_14427_c1 3300050494 Bacteria 3500
303 nmdc:mga06z11_37405_c1 3300050494 Bacteria 2403
304 nmdc:mga04h51_394041_c1 3300050495 Bacteria 579
305 nmdc:mga07m45_138448_c1 3300050496 Bacteria 1410
306 nmdc:mga07m45_25851_c1 3300050496 Bacteria 3224
307 nmdc:mga07m45_418334_c1 3300050496 Bacteria 778
308 nmdc:mga07m45_4213_c1 3300050496 Bacteria 7032
309 nmdc:mga07m45_58486_c1 3300050496 Bacteria 2181
310 nmdc:mga07m45_58967_c1 3300050496 Bacteria 2172
311 nmdc:mga07m45_76504_c1 3300050496 Bacteria 1908
312 nmdc:mga07m45_9233_c1 3300050496 Bacteria 5106
313 nmdc:mga05p37_189737_c1 3300050507 Bacteria 2496
314 nmdc:mga0sz30_5056_c1 3300050516 Bacteria 4821
315 Ga0500578_0646898 3300053086 Bacteria 575
316 Ga0500644_0002443 3300053088 Bacteria 4643
317 Ga0500644_0083467 3300053088 Bacteria 1180
318 Ga0500583_0057088 3300053092 Bacteria 1832
319 Ga0500583_0247630 3300053092 Bacteria 880
320 Ga0500651_0127767 3300053093 Bacteria 1539
321 Ga0500651_0131823 3300053093 Bacteria 1511
322 Ga0500651_0210790 3300053093 Bacteria 1143
323 Ga0500566_0279632 3300053094 Bacteria 796
324 Ga0500650_0328884 3300053098 Bacteria 672
325 Ga0500562_171705 3300053108 Bacteria 589
326 Ga0500593_000043 3300053117 Bacteria 45165
327 Ga0500594_0010303 3300053118 Bacteria 2168
328 Ga0500597_184912 3300053120 Bacteria 882
329 Ga0500597_368626 3300053120 Bacteria 554
330 Ga0500628_129004 3300053129 Bacteria 693
331 Ga0500642_0221367 3300053130 Bacteria 876
332 Ga0500652_058586 3300053131 Bacteria 1582
333 Ga0500655_014495 3300053133 Bacteria 1443
334 Ga0500658_0006983 3300053134 Bacteria 4179
335 Ga0500658_0196353 3300053134 Bacteria 922
336 Ga0500559_0000236 3300053136 Bacteria 43881
337 Ga0500561_0206678 3300053137 Bacteria 622
338 Ga0500564_096406 3300053138 Bacteria 1312
339 Ga0500568_0210471 3300053139 Bacteria 711
340 Ga0500590_004936 3300053148 Bacteria 6373
341 Ga0500619_000073 3300053154 Bacteria 28363
342 Ga0500619_117901 3300053154 Bacteria 904
343 Ga0500619_207799 3300053154 Bacteria 655
344 Ga0500622_0013320 3300053156 Bacteria 4436
345 Ga0500636_0186915 3300053177 Bacteria 1107
346 Ga0500636_0378214 3300053177 Bacteria 665
347 Ga0500636_0434425 3300053177 Bacteria 599
348 Ga0500596_094455 3300053735 Bacteria 532
349 Ga0500599_024017 3300053736 Bacteria 878
350 Ga0500587_004175 3300053739 Bacteria 1995
351 Ga0500587_004608 3300053739 Bacteria 1885
352 Ga0501082_0442975 3300060353 Bacteria 1135

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050496 nmdc:mga07m45_76504_c1 nmdc:mga07m45_76504_c1_1263_1613 101
2 3300047472 Ga0495686_0260376 Ga0495686_0260376_144_497 104
3 iso_pu_bacteria 2588253510 2588295155 104
4 3300006195 Ga0075366_10137338 Ga0075366_101373382 106
5 3300045051 Ga0451576_1473871 Ga0451576_1473871_164_520 107
6 3300005445 Ga0070708_100063831 Ga0070708_1000638313 108
7 3300009147 Ga0114129_10023973 Ga0114129_100239733 108
8 3300050507 nmdc:mga05p37_189737_c1 nmdc:mga05p37_189737_c1_1578_1904 108
9 3300053129 Ga0500628_129004 Ga0500628_129004_338_670 108
10 3300044712 Ga0453684_0007748 Ga0453684_0007748_7849_8184 109
11 3300035116 Ga0373945_0287196 Ga0373945_0287196_312_665 110
12 3300035171 Ga0373946_0495666 Ga0373946_0495666_40_393 110
13 3300035725 Ga0373947_0397724 Ga0373947_0397724_370_723 110
14 3300037068 Ga0373925_0112972 Ga0373925_0112972_625_978 110
15 3300042876 Ga0451577_0577238 Ga0451577_0577238_304_636 110
16 3300053120 Ga0500597_184912 Ga0500597_184912_364_699 110
17 3300009101 Ga0105247_11034521 Ga0105247_110345212 111
18 3300009553 Ga0105249_10325198 Ga0105249_103251983 111
19 3300011119 Ga0105246_11902535 Ga0105246_119025351 111
20 3300031251 Ga0265327_10117408 Ga0265327_101174082 111
21 3300031731 Ga0307405_11882234 Ga0307405_118822341 111
22 3300031901 Ga0307406_10309571 Ga0307406_103095712 111
23 3300031903 Ga0307407_10502082 Ga0307407_105020822 111
24 3300031911 Ga0307412_10106523 Ga0307412_101065233 111
25 3300032002 Ga0307416_100087114 Ga0307416_1000871144 111
26 3300032005 Ga0307411_10108135 Ga0307411_101081353 111
27 3300048905 Ga0496102_0001355 Ga0496102_0001355_10507_10851 111
28 3300053117 Ga0500593_000043 Ga0500593_000043_37905_38249 111
29 iso_pu_bacteria 2585428062 2587756189 111
30 iso_pu_bacteria 2643221644 2644248387 111
31 3300006042 Ga0075368_10278558 Ga0075368_102785582 112
32 3300006177 Ga0075362_10368107 Ga0075362_103681072 112
33 3300006178 Ga0075367_10051425 Ga0075367_100514252 112
34 3300006186 Ga0075369_10013367 Ga0075369_100133675 112
35 3300006195 Ga0075366_10018643 Ga0075366_100186432 112
36 3300006195 Ga0075366_10407905 Ga0075366_104079052 112
37 3300006353 Ga0075370_10327937 Ga0075370_103279372 112
38 3300031456 Ga0307513_10285307 Ga0307513_102853073 112
39 3300046616 Ga0495668_0060772 Ga0495668_0060772_314_655 112
40 3300050489 nmdc:mga03683_22920_c1 nmdc:mga03683_22920_c1_1718_2059 112
41 3300050492 nmdc:mga0yw44_217429_c1 nmdc:mga0yw44_217429_c1_26_367 112
42 3300050493 nmdc:mga0k408_271462_c1 nmdc:mga0k408_271462_c1_626_964 112
43 3300050493 nmdc:mga0k408_6644_c1 nmdc:mga0k408_6644_c1_3420_3761 112
44 3300050494 nmdc:mga06z11_14427_c1 nmdc:mga06z11_14427_c1_566_907 112
45 3300050496 nmdc:mga07m45_25851_c1 nmdc:mga07m45_25851_c1_594_935 112
46 3300050516 nmdc:mga0sz30_5056_c1 nmdc:mga0sz30_5056_c1_2298_2639 112
47 3300005328 Ga0070676_10960017 Ga0070676_109600172 113
48 3300005367 Ga0070667_100067360 Ga0070667_1000673602 113
49 3300005842 Ga0068858_102376110 Ga0068858_1023761102 113
50 3300006237 Ga0097621_102156581 Ga0097621_1021565812 113
51 3300006358 Ga0068871_100191582 Ga0068871_1001915822 113
52 3300009177 Ga0105248_11013886 Ga0105248_110138862 113
53 3300009545 Ga0105237_10073055 Ga0105237_100730553 113
54 3300009551 Ga0105238_11603040 Ga0105238_116030402 113
55 3300013307 Ga0157372_10591818 Ga0157372_105918182 113
56 3300014497 Ga0182008_10545230 Ga0182008_105452301 113
57 3300025914 Ga0207671_10125132 Ga0207671_101251323 113
58 3300025986 Ga0207658_10485408 Ga0207658_104854082 113
59 3300026078 Ga0207702_10069860 Ga0207702_100698604 113
60 3300026088 Ga0207641_10969676 Ga0207641_109696762 113
61 3300028794 Ga0307515_10100821 Ga0307515_101008213 113
62 3300031456 Ga0307513_10051949 Ga0307513_100519497 113
63 3300031507 Ga0307509_10165756 Ga0307509_101657562 113
64 3300031616 Ga0307508_10273276 Ga0307508_102732762 113
65 3300031649 Ga0307514_10106657 Ga0307514_101066572 113
66 3300031649 Ga0307514_10337928 Ga0307514_103379282 113
67 3300033179 Ga0307507_10344242 Ga0307507_103442422 113
68 3300042008 Ga0439450_196380 Ga0439450_196380_160_507 113
69 3300042127 Ga0450890_015510 Ga0450890_015510_266_613 113
70 3300042439 Ga0439464_0244109 Ga0439464_0244109_40_387 113
71 3300046511 Ga0495608_0813612 Ga0495608_0813612_121_468 113
72 3300048917 Ga0496114_0993185 Ga0496114_0993185_318_665 113
73 3300048928 Ga0496125_0365993 Ga0496125_0365993_273_620 113
74 3300053735 Ga0500596_094455 Ga0500596_094455_129_476 113
75 3300005334 Ga0068869_101307396 Ga0068869_1013073962 114
76 3300005543 Ga0070672_101132964 Ga0070672_1011329641 114
77 3300006177 Ga0075362_10542039 Ga0075362_105420392 114
78 3300013297 Ga0157378_10924468 Ga0157378_109244682 114
79 3300025940 Ga0207691_10665293 Ga0207691_106652931 114
80 3300028786 Ga0307517_10005592 Ga0307517_1000559218 114
81 3300028786 Ga0307517_10287715 Ga0307517_102877152 114
82 3300030522 Ga0307512_10047346 Ga0307512_100473464 114
83 3300030522 Ga0307512_10095765 Ga0307512_100957652 114
84 3300031507 Ga0307509_10003083 Ga0307509_100030833 114
85 3300031730 Ga0307516_10479810 Ga0307516_104798102 114
86 3300033180 Ga0307510_10016370 Ga0307510_100163703 114
87 3300041511 Ga0451855_0736938 Ga0451855_0736938_152_511 114
88 3300046454 Ga0495592_0000213 Ga0495592_0000213_33042_33392 114
89 3300046512 Ga0495610_0165272 Ga0495610_0165272_561_911 114
90 3300046515 Ga0495620_0287524 Ga0495620_0287524_144_494 114
91 3300046524 Ga0495648_0090462 Ga0495648_0090462_1180_1530 114
92 3300046660 Ga0495625_0060694 Ga0495625_0060694_2171_2521 114
93 3300050491 nmdc:mga00v17_824567_c1 nmdc:mga00v17_824567_c1_20_382 114
94 3300053088 Ga0500644_0002443 Ga0500644_0002443_752_1102 114
95 3300053093 Ga0500651_0127767 Ga0500651_0127767_851_1201 114
96 3300053093 Ga0500651_0131823 Ga0500651_0131823_65_415 114
97 3300053118 Ga0500594_0010303 Ga0500594_0010303_1288_1638 114
98 3300053133 Ga0500655_014495 Ga0500655_014495_289_639 114
99 3300053136 Ga0500559_0000236 Ga0500559_0000236_21084_21434 114
100 3300053138 Ga0500564_096406 Ga0500564_096406_881_1231 114
101 3300053154 Ga0500619_000073 Ga0500619_000073_2884_3228 114
102 3300053154 Ga0500619_117901 Ga0500619_117901_116_466 114
103 3300053156 Ga0500622_0013320 Ga0500622_0013320_2183_2533 114
104 3300053177 Ga0500636_0186915 Ga0500636_0186915_134_484 114
105 3300053736 Ga0500599_024017 Ga0500599_024017_82_432 114
106 3300053739 Ga0500587_004175 Ga0500587_004175_958_1308 114
107 3300003775 Ga0055524_1000207 Ga0055524_10002077 115
108 3300003791 Ga0055530_10020044 Ga0055530_100200444 115
109 3300003792 Ga0055540_1000011 Ga0055540_1000011225 115
110 3300003794 Ga0055531_10011526 Ga0055531_100115265 115
111 3300005328 Ga0070676_10700502 Ga0070676_107005021 115
112 3300005334 Ga0068869_100140779 Ga0068869_1001407793 115
113 3300005335 Ga0070666_10638105 Ga0070666_106381052 115
114 3300005338 Ga0068868_100142665 Ga0068868_1001426652 115
115 3300005455 Ga0070663_100581300 Ga0070663_1005813002 115
116 3300005457 Ga0070662_100008348 Ga0070662_1000083481 115
117 3300005459 Ga0068867_100625785 Ga0068867_1006257851 115
118 3300005539 Ga0068853_100533441 Ga0068853_1005334412 115
119 3300005564 Ga0070664_101357360 Ga0070664_1013573602 115
120 3300005577 Ga0068857_100900109 Ga0068857_1009001092 115
121 3300005578 Ga0068854_100371822 Ga0068854_1003718223 115
122 3300005616 Ga0068852_100069007 Ga0068852_1000690074 115
123 3300005840 Ga0068870_11069222 Ga0068870_110692222 115
124 3300005842 Ga0068858_101188144 Ga0068858_1011881442 115
125 3300005843 Ga0068860_102442338 Ga0068860_1024423381 115
126 3300006042 Ga0075368_10463216 Ga0075368_104632162 115
127 3300006177 Ga0075362_10232912 Ga0075362_102329122 115
128 3300006177 Ga0075362_10277533 Ga0075362_102775332 115
129 3300006195 Ga0075366_10503980 Ga0075366_105039801 115
130 3300006353 Ga0075370_10319799 Ga0075370_103197992 115
131 3300006353 Ga0075370_10440720 Ga0075370_104407202 115
132 3300006881 Ga0068865_100091831 Ga0068865_1000918312 115
133 3300006946 Ga0079104_1000040 Ga0079104_100004052 115
134 3300025298 Ga0209050_1000416 Ga0209050_100041675 115
135 3300025299 Ga0209256_1000092 Ga0209256_1000092108 115
136 3300025303 Ga0209051_1000020 Ga0209051_1000020224 115
137 3300025304 Ga0209257_1000085 Ga0209257_1000085224 115
138 3300025899 Ga0207642_10097420 Ga0207642_100974203 115
139 3300025913 Ga0207695_10061905 Ga0207695_100619055 115
140 3300025933 Ga0207706_10007829 Ga0207706_1000782911 115
141 3300025942 Ga0207689_10050658 Ga0207689_100506584 115
142 3300025981 Ga0207640_10300170 Ga0207640_103001702 115
143 3300025986 Ga0207658_10671110 Ga0207658_106711102 115
144 3300026023 Ga0207677_10790497 Ga0207677_107904972 115
145 3300026035 Ga0207703_11287620 Ga0207703_112876202 115
146 3300026041 Ga0207639_10702118 Ga0207639_107021182 115
147 3300026067 Ga0207678_10356093 Ga0207678_103560932 115
148 3300026116 Ga0207674_10403467 Ga0207674_104034672 115
149 3300026116 Ga0207674_10464750 Ga0207674_104647502 115
150 3300026142 Ga0207698_10185317 Ga0207698_101853172 115
151 3300027111 Ga0209281_1000074 Ga0209281_1000074132 115
152 3300027866 Ga0209813_10355468 Ga0209813_103554682 115
153 3300028794 Ga0307515_10000232 Ga0307515_1000023253 115
154 3300028794 Ga0307515_10229842 Ga0307515_102298422 115
155 3300031456 Ga0307513_10065125 Ga0307513_100651253 115
156 3300031507 Ga0307509_10166102 Ga0307509_101661024 115
157 3300031507 Ga0307509_10224368 Ga0307509_102243683 115
158 3300031616 Ga0307508_10000016 Ga0307508_1000001639 115
159 3300031616 Ga0307508_10001467 Ga0307508_1000146728 115
160 3300031616 Ga0307508_10381315 Ga0307508_103813152 115
161 3300031649 Ga0307514_10119814 Ga0307514_101198142 115
162 3300031730 Ga0307516_10128425 Ga0307516_101284252 115
163 3300033179 Ga0307507_10177933 Ga0307507_101779333 115
164 3300033179 Ga0307507_10450076 Ga0307507_104500761 115
165 3300033180 Ga0307510_10000568 Ga0307510_1000056834 115
166 3300041441 Ga0451787_055325 Ga0451787_055325_596_958 115
167 3300041452 Ga0451793_1056955 Ga0451793_1056955_761_1123 115
168 3300041453 Ga0451797_1591649 Ga0451797_1591649_370_732 115
169 3300041486 Ga0451807_0187731 Ga0451807_0187731_574_936 115
170 3300041496 Ga0451839_0443244 Ga0451839_0443244_759_1121 115
171 3300041501 Ga0451845_0299363 Ga0451845_0299363_105_467 115
172 3300041505 Ga0451849_0824555 Ga0451849_0824555_85_447 115
173 3300041509 Ga0451843_1523235 Ga0451843_1523235_188_550 115
174 3300041512 Ga0451853_3367089 Ga0451853_3367089_617_979 115
175 3300042121 Ga0450919_001683 Ga0450919_001683_122_469 115
176 3300042134 Ga0450898_015580 Ga0450898_015580_922_1275 115
177 3300042144 Ga0450889_040710 Ga0450889_040710_27_380 115
178 3300042531 Ga0450918_000344 Ga0450918_000344_6565_6912 115
179 3300044712 Ga0453684_1120683 Ga0453684_1120683_157_507 115
180 3300045051 Ga0451576_0407935 Ga0451576_0407935_1038_1394 115
181 3300046492 Ga0495585_0251027 Ga0495585_0251027_231_581 115
182 3300046517 Ga0495630_0227592 Ga0495630_0227592_941_1291 115
183 3300046519 Ga0495632_0067015 Ga0495632_0067015_33_395 115
184 3300046522 Ga0495643_0074440 Ga0495643_0074440_1001_1363 115
185 3300046616 Ga0495668_0648245 Ga0495668_0648245_58_420 115
186 3300046683 Ga0495658_0206479 Ga0495658_0206479_36_398 115
187 3300046692 Ga0495671_0412442 Ga0495671_0412442_186_548 115
188 3300047472 Ga0495686_0032063 Ga0495686_0032063_391_753 115
189 3300048917 Ga0496114_0022464 Ga0496114_0022464_2594_2941 115
190 3300050493 nmdc:mga0k408_46145_c1 nmdc:mga0k408_46145_c1_621_983 115
191 3300053088 Ga0500644_0083467 Ga0500644_0083467_75_437 115
192 3300053092 Ga0500583_0247630 Ga0500583_0247630_15_377 115
193 3300053094 Ga0500566_0279632 Ga0500566_0279632_294_647 115
194 3300053131 Ga0500652_058586 Ga0500652_058586_408_761 115
195 3300053134 Ga0500658_0196353 Ga0500658_0196353_451_813 115
196 3300053154 Ga0500619_207799 Ga0500619_207799_119_472 115
197 3300053177 Ga0500636_0434425 Ga0500636_0434425_164_517 115
198 3300053739 Ga0500587_004608 Ga0500587_004608_729_1091 115
199 3300005290 Ga0065712_10392942 Ga0065712_103929422 116
200 3300005328 Ga0070676_10261244 Ga0070676_102612442 116
201 3300005333 Ga0070677_10136034 Ga0070677_101360342 116
202 3300005334 Ga0068869_101337360 Ga0068869_1013373601 116
203 3300005335 Ga0070666_11036339 Ga0070666_110363392 116
204 3300005338 Ga0068868_101819277 Ga0068868_1018192771 116
205 3300005344 Ga0070661_100352634 Ga0070661_1003526342 116
206 3300005356 Ga0070674_100038484 Ga0070674_1000384843 116
207 3300005366 Ga0070659_102125722 Ga0070659_1021257221 116
208 3300005367 Ga0070667_100381458 Ga0070667_1003814582 116
209 3300005456 Ga0070678_100108557 Ga0070678_1001085573 116
210 3300005459 Ga0068867_100810824 Ga0068867_1008108242 116
211 3300005548 Ga0070665_100188616 Ga0070665_1001886162 116
212 3300005616 Ga0068852_100191432 Ga0068852_1001914323 116
213 3300005843 Ga0068860_100317511 Ga0068860_1003175113 116
214 3300006881 Ga0068865_100458277 Ga0068865_1004582772 116
215 3300009098 Ga0105245_10626782 Ga0105245_106267822 116
216 3300013306 Ga0163162_11334731 Ga0163162_113347312 116
217 3300013308 Ga0157375_10611225 Ga0157375_106112252 116
218 3300014968 Ga0157379_10297734 Ga0157379_102977343 116
219 3300015262 Ga0182007_10301788 Ga0182007_103017881 116
220 3300025304 Ga0209257_1053011 Ga0209257_10530112 116
221 3300025893 Ga0207682_10128642 Ga0207682_101286422 116
222 3300025899 Ga0207642_10622329 Ga0207642_106223292 116
223 3300025909 Ga0207705_11040526 Ga0207705_110405262 116
224 3300025927 Ga0207687_10743257 Ga0207687_107432572 116
225 3300025937 Ga0207669_10041654 Ga0207669_100416543 116
226 3300025938 Ga0207704_11071787 Ga0207704_110717872 116
227 3300025942 Ga0207689_10790022 Ga0207689_107900222 116
228 3300025986 Ga0207658_10005654 Ga0207658_100056542 116
229 3300026041 Ga0207639_12054524 Ga0207639_120545242 116
230 3300026089 Ga0207648_10185662 Ga0207648_101856622 116
231 3300026118 Ga0207675_100100746 Ga0207675_1001007462 116
232 3300026121 Ga0207683_11333176 Ga0207683_113331762 116
233 3300028379 Ga0268266_10264699 Ga0268266_102646993 116
234 3300028381 Ga0268264_12090107 Ga0268264_120901072 116
235 3300028794 Ga0307515_10127844 Ga0307515_101278442 116
236 3300031456 Ga0307513_10070103 Ga0307513_100701033 116
237 3300031507 Ga0307509_10162846 Ga0307509_101628463 116
238 3300031507 Ga0307509_10186744 Ga0307509_101867441 116
239 3300031730 Ga0307516_10579170 Ga0307516_105791702 116
240 3300033180 Ga0307510_10402173 Ga0307510_104021732 116
241 3300036401 Ga0373937_0437509 Ga0373937_0437509_696_1067 116
242 3300041451 Ga0451791_0409111 Ga0451791_0409111_193_549 116
243 3300046452 Ga0495617_100773 Ga0495617_100773_348_701 116
244 3300046507 Ga0495606_0273610 Ga0495606_0273610_284_637 116
245 3300049579 Ga0501043_0000545 Ga0501043_0000545_2158_2508 116
246 3300049580 Ga0501046_0004297 Ga0501046_0004297_10461_10811 116
247 3300049581 Ga0501047_0000757 Ga0501047_0000757_31210_31560 116
248 3300049582 Ga0501048_0013766 Ga0501048_0013766_2505_2855 116
249 3300049824 Ga0501045_0002486 Ga0501045_0002486_2048_2398 116
250 3300053092 Ga0500583_0057088 Ga0500583_0057088_1337_1690 116
251 3300053108 Ga0500562_171705 Ga0500562_171705_114_470 116
252 3300053120 Ga0500597_368626 Ga0500597_368626_185_538 116
253 3300053130 Ga0500642_0221367 Ga0500642_0221367_432_788 116
254 3300053137 Ga0500561_0206678 Ga0500561_0206678_67_423 116
255 3300053139 Ga0500568_0210471 Ga0500568_0210471_261_617 116
256 3300053177 Ga0500636_0378214 Ga0500636_0378214_125_481 116
257 3300060353 Ga0501082_0442975 Ga0501082_0442975_403_753 116
258 iso_pu_bacteria 2643221654 2644301597 116
259 3300005841 Ga0068863_100372012 Ga0068863_1003720122 117
260 3300006048 Ga0075363_100073012 Ga0075363_1000730123 117
261 3300013296 Ga0157374_10074924 Ga0157374_100749242 117
262 3300025931 Ga0207644_11019641 Ga0207644_110196412 117
263 3300025937 Ga0207669_11415968 Ga0207669_114159682 117
264 3300026089 Ga0207648_11816714 Ga0207648_118167142 117
265 3300027876 Ga0209974_10006661 Ga0209974_100066614 117
266 3300031730 Ga0307516_10400815 Ga0307516_104008151 117
267 3300031824 Ga0307413_10510139 Ga0307413_105101392 117
268 3300031852 Ga0307410_10550279 Ga0307410_105502792 117
269 3300031901 Ga0307406_10208539 Ga0307406_102085393 117
270 3300032002 Ga0307416_100968430 Ga0307416_1009684302 117
271 3300032004 Ga0307414_10911434 Ga0307414_109114342 117
272 3300032005 Ga0307411_10684478 Ga0307411_106844782 117
273 3300033180 Ga0307510_10301937 Ga0307510_103019373 117
274 3300048909 Ga0496106_0012991 Ga0496106_0012991_5550_5906 117
275 3300049822 Ga0501035_1102018 Ga0501035_1102018_151_510 117
276 3300053148 Ga0500590_004936 Ga0500590_004936_5924_6280 117
277 3300006178 Ga0075367_10820546 Ga0075367_108205462 118
278 3300009093 Ga0105240_10039246 Ga0105240_100392465 118
279 3300009098 Ga0105245_11668027 Ga0105245_116680272 118
280 3300009148 Ga0105243_11654611 Ga0105243_116546112 118
281 3300009545 Ga0105237_10014977 Ga0105237_100149775 118
282 3300010375 Ga0105239_10114097 Ga0105239_101140974 118
283 3300014497 Ga0182008_10988875 Ga0182008_109888752 118
284 3300025942 Ga0207689_10778189 Ga0207689_107781892 118
285 3300028794 Ga0307515_10277265 Ga0307515_102772652 118
286 3300046457 Ga0495590_0084021 Ga0495590_0084021_638_997 118
287 3300046474 Ga0495605_0124265 Ga0495605_0124265_185_544 118
288 3300046513 Ga0495616_0177058 Ga0495616_0177058_411_770 118
289 3300046519 Ga0495632_0010962 Ga0495632_0010962_3790_4149 118
290 3300046524 Ga0495648_0227511 Ga0495648_0227511_94_453 118
291 3300046530 Ga0495654_0135324 Ga0495654_0135324_659_1018 118
292 3300046692 Ga0495671_0154002 Ga0495671_0154002_279_638 118
293 3300046694 Ga0495649_0001371 Ga0495649_0001371_569_928 118
294 3300047443 Ga0495687_005696 Ga0495687_005696_3520_3879 118
295 3300048091 Ga0495626_0048720 Ga0495626_0048720_1331_1690 118
296 3300048905 Ga0496102_0025441 Ga0496102_0025441_2081_2440 118
297 3300049515 Ga0501292_032326 Ga0501292_032326_429_788 118
298 3300049522 Ga0501299_070011 Ga0501299_070011_187_546 118
299 3300049654 Ga0501207_006287 Ga0501207_006287_102_461 118
300 3300049762 Ga0501265_002252 Ga0501265_002252_1136_1495 118
301 3300050489 nmdc:mga03683_12587_c1 nmdc:mga03683_12587_c1_2451_2807 118
302 3300050493 nmdc:mga0k408_26610_c1 nmdc:mga0k408_26610_c1_1432_1794 118
303 3300050493 nmdc:mga0k408_40302_c1 nmdc:mga0k408_40302_c1_1790_2146 118
304 3300050495 nmdc:mga04h51_394041_c1 nmdc:mga04h51_394041_c1_55_411 118
305 3300050496 nmdc:mga07m45_138448_c1 nmdc:mga07m45_138448_c1_899_1261 118
306 3300050496 nmdc:mga07m45_9233_c1 nmdc:mga07m45_9233_c1_4554_4910 118
307 3300053093 Ga0500651_0210790 Ga0500651_0210790_368_727 118
308 3300053098 Ga0500650_0328884 Ga0500650_0328884_76_432 118
309 3300053134 Ga0500658_0006983 Ga0500658_0006983_1422_1781 118
310 3300005327 Ga0070658_11959667 Ga0070658_119596671 119
311 3300005548 Ga0070665_101779213 Ga0070665_1017792131 119
312 3300046542 Ga0495597_0010476 Ga0495597_0010476_3985_4347 119
313 3300047443 Ga0495687_002064 Ga0495687_002064_9683_10045 119
314 3300048916 Ga0496113_0191649 Ga0496113_0191649_1053_1418 119
315 3300005467 Ga0070706_100004486 Ga0070706_1000044867 120
316 3300005468 Ga0070707_100168314 Ga0070707_1001683143 120
317 3300005471 Ga0070698_100138790 Ga0070698_1001387903 120
318 3300005518 Ga0070699_101828208 Ga0070699_1018282081 120
319 3300005617 Ga0068859_102255787 Ga0068859_1022557872 120
320 3300006178 Ga0075367_10015588 Ga0075367_100155883 120
321 3300006195 Ga0075366_10114569 Ga0075366_101145693 120
322 3300006195 Ga0075366_10180168 Ga0075366_101801682 120
323 3300006353 Ga0075370_10015599 Ga0075370_100155992 120
324 3300006931 Ga0097620_102255767 Ga0097620_1022557672 120
325 3300025910 Ga0207684_10005949 Ga0207684_100059494 120
326 3300025922 Ga0207646_10067554 Ga0207646_100675542 120
327 3300050494 nmdc:mga06z11_37405_c1 nmdc:mga06z11_37405_c1_1008_1370 120
328 3300050496 nmdc:mga07m45_58967_c1 nmdc:mga07m45_58967_c1_1737_2099 120
329 3300006195 Ga0075366_10384257 Ga0075366_103842572 121
330 3300046660 Ga0495625_0021963 Ga0495625_0021963_2400_2768 121
331 3300050493 nmdc:mga0k408_72889_c1 nmdc:mga0k408_72889_c1_34_402 121
332 3300050496 nmdc:mga07m45_58486_c1 nmdc:mga07m45_58486_c1_1385_1753 121
333 3300053086 Ga0500578_0646898 Ga0500578_0646898_134_502 121
334 3300005328 Ga0070676_10238881 Ga0070676_102388812 123
335 3300005459 Ga0068867_100774260 Ga0068867_1007742602 123
336 3300005578 Ga0068854_101262813 Ga0068854_1012628132 123
337 3300006353 Ga0075370_10400365 Ga0075370_104003652 123
338 3300025937 Ga0207669_10880055 Ga0207669_108800552 123
339 3300026089 Ga0207648_10751260 Ga0207648_107512602 123
340 3300028786 Ga0307517_10412502 Ga0307517_104125021 123
341 3300046506 Ga0495583_0452096 Ga0495583_0452096_30_419 123
342 3300006195 Ga0075366_10743065 Ga0075366_107430651 124
343 3300006353 Ga0075370_10000524 Ga0075370_100005243 124
344 3300006353 Ga0075370_10080520 Ga0075370_100805201 124
345 3300009174 Ga0105241_10491989 Ga0105241_104919892 124
346 3300031616 Ga0307508_10533754 Ga0307508_105337542 124
347 3300046506 Ga0495583_0378407 Ga0495583_0378407_145_522 124
348 3300046665 Ga0495661_0174011 Ga0495661_0174011_467_892 124
349 3300047446 Ga0495679_045104 Ga0495679_045104_668_1093 124
350 3300050493 nmdc:mga0k408_435859_c1 nmdc:mga0k408_435859_c1_136_510 124
351 3300050496 nmdc:mga07m45_4213_c1 nmdc:mga07m45_4213_c1_2942_3316 124
352 3300006353 Ga0075370_10154210 Ga0075370_101542102 126
353 3300050496 nmdc:mga07m45_418334_c1 nmdc:mga07m45_418334_c1_256_654 126
354 3300006195 Ga0075366_10111259 Ga0075366_101112592 127
355 3300050493 nmdc:mga0k408_264197_c1 nmdc:mga0k408_264197_c1_215_616 128
356 3300003316 rootH1_10000374 rootH1_100003743 131

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04347

FliO

Flagellar biosynthesis protein, FliO

19

134

0.84

Feature Viewer

pLDDT pTM Quality
58.09 0.25 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map