F420548

General Info

Members Datasets Scaffolds Average Seq Length
356 223 298 160

Family's Representative Sequence

Representative Sequence 3300031731|Ga0307405_10630390|Ga0307405_106303902
Length 176
Sequence MTDTKSDPKTKAAKPADAPKAPKGGTTADVAAGVAQFLTPVVQELVALAVNGKQAHWHVRGVNFIAVHELLDVVVDHAQEWADLAAERVVALGLPVDGRLKSVADKSGAVNPKLGFQSYDEAIADVVTQIDLAAEKVADAIEGLEELDPVSQDVVIEIRRGLDKDRWFLFSHVAVK

Samples

Sample ID Description Type Environment
1 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
2 2643221546 Microbacterium sp. Root53 Isolate Unclassified
3 2643221549 Agromyces sp. Root1464 Isolate Unclassified
4 2643221553 Microbacterium sp. Root553 Isolate Unclassified
5 2643221616 Leifsonia sp. Root227 Isolate Unclassified
6 2643221619 Agromyces sp. Root81 Isolate Unclassified
7 2643221630 Microbacterium sp. Root322 Isolate Unclassified
8 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
9 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
10 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
11 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
12 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
13 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
14 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
15 2808606372 Agromyces sp. 23-23 Isolate Unclassified
16 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
17 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
18 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
19 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
20 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
21 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
22 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
23 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
24 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
25 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
26 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
27 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
28 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
29 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
30 2919069694 Microbacterium sp. 1154 Isolate Unclassified
31 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
32 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
33 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
34 2928153084 Leifsonia sp. 563 Isolate Unclassified
35 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
36 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
37 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
38 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
39 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
40 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
41 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
42 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
43 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
44 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
45 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
46 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
47 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
48 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
49 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
50 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
51 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
52 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
53 3300003157 Avena fatua rhizosphere microbial communities - H3_Bulk_Litter_17 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
54 3300003160 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_22 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
55 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
56 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
57 3300003288 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_44 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
58 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
59 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
60 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
61 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
62 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
63 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
64 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
65 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
66 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
67 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
68 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
69 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
70 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
71 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
72 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
73 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
79 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
80 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
81 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
82 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
96 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
102 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
103 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
104 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
120 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
125 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
135 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
136 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
137 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
138 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
139 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
140 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
141 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
142 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
143 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
144 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
145 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
146 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
147 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
148 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
149 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
150 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
158 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
161 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
162 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
163 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
164 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
165 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
166 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
167 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
168 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
169 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
170 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
171 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
184 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
185 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
186 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
187 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
192 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
193 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
194 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
195 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
196 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
197 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
198 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
199 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
200 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
201 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
202 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
203 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
204 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
205 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
206 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
207 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
208 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
209 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
210 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
211 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
215 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
216 8002811521 Leucobacter chinensis NC76-1 Isolate Rhizosphere
217 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
218 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
219 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
220 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
221 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere
222 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
223 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 78.65
Metatranscriptomes 5.06
Isolates 16.29

Biome Distribution

Category Percentage (%)
Aerial Root 0.28
Bulb 0
Endosphere 16.01
Nodule 0
Rhizoplane 5.9
Rhizosphere 53.65
Stem 0
Stem Tuber 0.28
Unclassified 23.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10110629 3300001990 Bacteria 813
2 JGI24735J21928_10004014 3300002067 Bacteria 4977
3 JGI25164J39214_1002096 3300002772 Bacteria 3411
4 Ga0006774J45829_10616 3300003157 Bacteria 539
5 Ga0006779J45831_101077 3300003160 Bacteria 545
6 Ga0006778J45830_1020423 3300003162 Bacteria 528
7 JGI25165J46597_1000002 3300003214 Bacteria 765387
8 Ga0007428J48920_105076 3300003288 Bacteria 528
9 Ga0006770J48903_1025561 3300003305 Bacteria 528
10 Ga0006777J48905_1036491 3300003308 Bacteria 526
11 rootL2_10184436 3300003322 Bacteria 2017
12 Ga0007427J51700_100554 3300003559 Bacteria 893
13 Ga0006781J51513_1003087 3300003568 Bacteria 537
14 Ga0006562J51391_1016324 3300003578 Bacteria 2400
15 Ga0006780_1010065 3300003735 Bacteria 528
16 Ga0055539_1000058 3300003752 Bacteria 149354
17 Ga0055533_1000001 3300003756 Bacteria 1863437
18 Ga0055525_1000881 3300003759 Bacteria 8631
19 Ga0055541_1009701 3300003841 Bacteria 1477
20 Ga0070658_10183133 3300005327 Bacteria 1763
21 Ga0070682_100189077 3300005337 Bacteria 1444
22 Ga0070668_100316261 3300005347 Bacteria 1313
23 Ga0070659_100278871 3300005366 Bacteria 1390
24 Ga0070662_100902405 3300005457 Bacteria 754
25 Ga0070665_101477808 3300005548 Bacteria 688
26 Ga0068857_101675476 3300005577 Bacteria 621
27 Ga0068864_100995945 3300005618 Bacteria 831
28 Ga0068861_100017123 3300005719 Bacteria 5138
29 Ga0068870_10091117 3300005840 Bacteria 1705
30 Ga0075365_10003344 3300006038 Bacteria 8244
31 Ga0075365_10017173 3300006038 Bacteria 4420
32 Ga0075364_10014688 3300006051 Bacteria 4844
33 Ga0075364_10185887 3300006051 Bacteria 1407
34 Ga0075364_10884971 3300006051 Bacteria 608
35 Ga0075367_10401237 3300006178 Bacteria 867
36 Ga0075369_10034458 3300006186 Bacteria 2149
37 Ga0075369_10092507 3300006186 Bacteria 1351
38 Ga0075369_10221954 3300006186 Bacteria 875
39 Ga0075370_10173412 3300006353 Bacteria 1268
40 Ga0075430_100722658 3300006846 Bacteria 821
41 Ga0105243_10181331 3300009148 Bacteria 1831
42 Ga0105246_10975830 3300011119 Bacteria 765
43 Ga0157370_10329889 3300013104 Bacteria 1407
44 Ga0157369_10035473 3300013105 Bacteria 5468
45 Ga0157369_10089593 3300013105 Bacteria 3284
46 Ga0157369_10293212 3300013105 Bacteria 1693
47 Ga0157369_10370734 3300013105 Bacteria 1486
48 Ga0157375_10442194 3300013308 Bacteria 1466
49 Ga0163163_11228208 3300014325 Bacteria 812
50 Ga0157377_10136499 3300014745 Bacteria 1503
51 Ga0157376_10872579 3300014969 Bacteria 916
52 Ga0163161_10979708 3300017792 Bacteria 721
53 Ga0197907_10201759 3300020069 Bacteria 790
54 Ga0197907_11161920 3300020069 Bacteria 1490
55 Ga0206355_1533748 3300020076 Bacteria 905
56 Ga0206354_10552443 3300020081 Bacteria 4971
57 Ga0206353_11205468 3300020082 Bacteria 8245
58 Ga0209566_100026 3300025225 Bacteria 367457
59 Ga0209674_100001 3300025226 Bacteria 4013750
60 Ga0209563_100001 3300025230 Bacteria 4013775
61 Ga0209563_100650 3300025230 Bacteria 11176
62 Ga0207427_100089 3300025231 Bacteria 135504
63 Ga0209437_100447 3300025233 Bacteria 34224
64 Ga0209646_1000099 3300025246 Bacteria 180436
65 Ga0209677_100001 3300025253 Bacteria 4013787
66 Ga0209677_101332 3300025253 Bacteria 10856
67 Ga0209233_1000001 3300025261 Bacteria 2992747
68 Ga0207642_10678804 3300025899 Bacteria 647
69 Ga0207647_10058364 3300025904 Bacteria 2363
70 Ga0207643_10052014 3300025908 Bacteria 2326
71 Ga0207705_10083731 3300025909 Bacteria 2327
72 Ga0207664_10095156 3300025929 Bacteria 2450
73 Ga0207690_10624229 3300025932 Bacteria 881
74 Ga0207709_10204723 3300025935 Bacteria 1412
75 Ga0207712_10041699 3300025961 Bacteria 3155
76 Ga0207674_10187183 3300026116 Bacteria 2020
77 Ga0207674_11596457 3300026116 Bacteria 621
78 Ga0207698_11014987 3300026142 Bacteria 841
79 Ga0268266_10391434 3300028379 Bacteria 1313
80 Ga0268265_11026690 3300028380 Bacteria 816
81 Ga0268264_11219539 3300028381 Bacteria 762
82 Ga0307515_10285834 3300028794 Bacteria 1351
83 Ga0307514_10016953 3300031649 Bacteria 5998
84 Ga0307514_10138941 3300031649 Bacteria 1656
85 Ga0307405_10630390 3300031731 Bacteria 879
86 Ga0307413_10422062 3300031824 Bacteria 1051
87 Ga0307413_10424975 3300031824 Bacteria 1048
88 Ga0307413_10824033 3300031824 Bacteria 782
89 Ga0307410_10577611 3300031852 Bacteria 935
90 Ga0307406_10045649 3300031901 Bacteria 2752
91 Ga0307406_10127023 3300031901 Bacteria 1784
92 Ga0307406_10738242 3300031901 Bacteria 825
93 Ga0307406_11136595 3300031901 Bacteria 676
94 Ga0307406_11554243 3300031901 Bacteria 583
95 Ga0307407_11331653 3300031903 Bacteria 564
96 Ga0307412_11076591 3300031911 Bacteria 714
97 Ga0307412_11912507 3300031911 Bacteria 548
98 Ga0307409_100056963 3300031995 Bacteria 3025
99 Ga0307409_100233851 3300031995 Bacteria 1668
100 Ga0307409_101552168 3300031995 Bacteria 690
101 Ga0307416_100208782 3300032002 Bacteria 1861
102 Ga0307414_10015561 3300032004 Bacteria 4593
103 Ga0307414_10271118 3300032004 Bacteria 1421
104 Ga0307414_10348795 3300032004 Bacteria 1270
105 Ga0307414_10417523 3300032004 Bacteria 1169
106 Ga0307414_10971738 3300032004 Bacteria 781
107 Ga0307414_11174460 3300032004 Bacteria 710
108 Ga0307414_11421747 3300032004 Bacteria 645
109 Ga0307415_100513871 3300032126 Bacteria 1050
110 Ga0307415_100887151 3300032126 Bacteria 821
111 Ga0307415_101456799 3300032126 Bacteria 654
112 Ga0395900_0000887 3300037418 Bacteria 39283
113 Ga0395900_0023876 3300037418 Bacteria 6257
114 Ga0395900_0358980 3300037418 Bacteria 1429
115 Ga0395898_0000622 3300037466 Bacteria 65033
116 Ga0395901_0347697 3300038443 Bacteria 1531
117 Ga0439465_0055518 3300041413 Bacteria 1304
118 Ga0451787_559768 3300041441 Bacteria 707
119 Ga0451787_731929 3300041441 Bacteria 765
120 Ga0451791_0935739 3300041451 Bacteria 1068
121 Ga0451791_0977117 3300041451 Bacteria 913
122 Ga0451791_1792879 3300041451 Bacteria 1983
123 Ga0451793_1327505 3300041452 Bacteria 843
124 Ga0451807_1636346 3300041486 Bacteria 926
125 Ga0466969_0232454 3300044656 Bacteria 837
126 Ga0466972_0065064 3300044658 Bacteria 1744
127 Ga0466972_0073604 3300044658 Bacteria 1628
128 Ga0466972_0119668 3300044658 Bacteria 1242
129 Ga0466972_0150125 3300044658 Bacteria 1096
130 Ga0466965_0000011 3300044683 Bacteria 107319
131 Ga0466965_0067080 3300044683 Bacteria 1800
132 Ga0466965_0373213 3300044683 Bacteria 784
133 Ga0466965_0598297 3300044683 Bacteria 626
134 Ga0466966_0084448 3300044684 Bacteria 1975
135 Ga0466966_0156438 3300044684 Bacteria 1388
136 Ga0466961_0080875 3300044693 Bacteria 2056
137 Ga0466968_0121550 3300044735 Bacteria 1182
138 Ga0466970_0006959 3300044765 Bacteria 5663
139 Ga0466970_0041288 3300044765 Bacteria 2450
140 Ga0466970_0176243 3300044765 Bacteria 1186
141 Ga0466959_0133628 3300045049 Bacteria 1757
142 Ga0466959_0234752 3300045049 Bacteria 1268
143 Ga0466959_0473160 3300045049 Bacteria 848
144 Ga0466958_0094036 3300045836 Bacteria 1857
145 Ga0495627_001282 3300046453 Bacteria 15451
146 Ga0495650_0002487 3300046471 Bacteria 14827
147 Ga0495650_0163834 3300046471 Bacteria 791
148 Ga0495673_0315222 3300047469 Bacteria 558
149 Ga0496101_0109775 3300048904 Bacteria 2075
150 Ga0496101_0137486 3300048904 Bacteria 1860
151 Ga0496102_0536308 3300048905 Bacteria 1093
152 Ga0496103_0179161 3300048906 Bacteria 1362
153 Ga0496104_0315858 3300048907 Bacteria 1475
154 Ga0496104_0412140 3300048907 Bacteria 1263
155 Ga0496105_0074964 3300048908 Bacteria 2795
156 Ga0496105_0295461 3300048908 Bacteria 1303
157 Ga0496107_0485478 3300048910 Bacteria 917
158 Ga0496111_0312740 3300048914 Bacteria 1164
159 Ga0496113_0186643 3300048916 Bacteria 1645
160 Ga0496114_0179481 3300048917 Bacteria 1848
161 Ga0496114_0297181 3300048917 Bacteria 1425
162 Ga0496115_0160346 3300048918 Bacteria 1858
163 Ga0496117_0000053 3300048920 Bacteria 279396
164 Ga0496117_0000346 3300048920 Bacteria 81937
165 Ga0496117_0003360 3300048920 Bacteria 18658
166 Ga0496117_0013857 3300048920 Bacteria 6992
167 Ga0496117_0014678 3300048920 Bacteria 6731
168 Ga0496117_0119258 3300048920 Bacteria 1625
169 Ga0496117_0331337 3300048920 Bacteria 793
170 Ga0496118_0003448 3300048921 Bacteria 19906
171 Ga0496118_0012176 3300048921 Bacteria 8293
172 Ga0496118_0043484 3300048921 Bacteria 3530
173 Ga0496118_0131565 3300048921 Bacteria 1606
174 Ga0496118_0200590 3300048921 Bacteria 1182
175 Ga0496119_0005445 3300048922 Bacteria 12196
176 Ga0496119_0005920 3300048922 Bacteria 11524
177 Ga0496119_0020360 3300048922 Bacteria 4843
178 Ga0496119_0041888 3300048922 Bacteria 2910
179 Ga0496120_0000866 3300048923 Bacteria 42809
180 Ga0496120_0008386 3300048923 Bacteria 7506
181 Ga0496120_0037397 3300048923 Bacteria 2881
182 Ga0496120_0091064 3300048923 Bacteria 1629
183 Ga0496121_0000528 3300048924 Bacteria 72606
184 Ga0496121_0088486 3300048924 Bacteria 2428
185 Ga0496121_0136872 3300048924 Bacteria 1823
186 Ga0496122_0000120 3300048925 Bacteria 182539
187 Ga0496122_0003193 3300048925 Bacteria 21866
188 Ga0496122_0004987 3300048925 Bacteria 16062
189 Ga0496122_0016596 3300048925 Bacteria 6952
190 Ga0496122_0104622 3300048925 Bacteria 1880
191 Ga0496122_0131066 3300048925 Bacteria 1593
192 Ga0496122_0229806 3300048925 Bacteria 1056
193 Ga0496123_0000051 3300048926 Bacteria 237095
194 Ga0496123_0000681 3300048926 Bacteria 56018
195 Ga0496123_0011030 3300048926 Bacteria 7894
196 Ga0496123_0011928 3300048926 Bacteria 7463
197 Ga0496123_0232982 3300048926 Bacteria 920
198 Ga0496124_0004150 3300048927 Bacteria 17101
199 Ga0496124_0014810 3300048927 Bacteria 7520
200 Ga0496125_0007116 3300048928 Bacteria 11940
201 Ga0496125_0022020 3300048928 Bacteria 5926
202 Ga0496125_0049645 3300048928 Bacteria 3484
203 Ga0496125_0123614 3300048928 Bacteria 1839
204 Ga0496125_0124773 3300048928 Bacteria 1827
205 Ga0496125_0326736 3300048928 Bacteria 927
206 Ga0496126_0004408 3300048929 Bacteria 16861
207 Ga0496126_0007418 3300048929 Bacteria 12031
208 Ga0496126_0008000 3300048929 Bacteria 11480
209 Ga0496126_0011321 3300048929 Bacteria 9251
210 Ga0496126_0049574 3300048929 Bacteria 3832
211 Ga0496126_0087623 3300048929 Bacteria 2743
212 Ga0496126_0183455 3300048929 Bacteria 1776
213 Ga0496126_0829974 3300048929 Bacteria 707
214 Ga0501031_0096883 3300049568 Bacteria 1925
215 Ga0501032_0044066 3300049569 Bacteria 3020
216 Ga0501032_0067039 3300049569 Bacteria 2398
217 Ga0501032_0897307 3300049569 Bacteria 558
218 Ga0501033_0011128 3300049570 Bacteria 6892
219 Ga0501033_0080046 3300049570 Bacteria 2397
220 Ga0501033_0160758 3300049570 Bacteria 1617
221 Ga0501033_0618926 3300049570 Bacteria 741
222 Ga0501034_0002011 3300049571 Bacteria 25659
223 Ga0501034_0032791 3300049571 Bacteria 5274
224 Ga0501034_0038659 3300049571 Bacteria 4832
225 Ga0501034_0039944 3300049571 Bacteria 4752
226 Ga0501034_0057769 3300049571 Bacteria 3900
227 Ga0501034_0124940 3300049571 Bacteria 2558
228 Ga0501034_0372413 3300049571 Bacteria 1354
229 Ga0501034_1181119 3300049571 Bacteria 644
230 Ga0501036_0098365 3300049572 Bacteria 2473
231 Ga0501036_0429298 3300049572 Bacteria 1101
232 Ga0501037_0043454 3300049573 Bacteria 3302
233 Ga0501037_0276659 3300049573 Bacteria 1170
234 Ga0501037_0882275 3300049573 Bacteria 587
235 Ga0501038_0001899 3300049574 Bacteria 19324
236 Ga0501038_0010881 3300049574 Bacteria 8308
237 Ga0501038_0037145 3300049574 Bacteria 4273
238 Ga0501038_0167786 3300049574 Bacteria 1779
239 Ga0501038_0225956 3300049574 Bacteria 1492
240 Ga0501039_0014208 3300049575 Bacteria 6096
241 Ga0501043_0004260 3300049579 Bacteria 11648
242 Ga0501043_0093045 3300049579 Bacteria 2370
243 Ga0501043_0246330 3300049579 Bacteria 1377
244 Ga0501046_0008499 3300049580 Bacteria 8940
245 Ga0501046_0211272 3300049580 Bacteria 1440
246 Ga0501047_0132128 3300049581 Bacteria 2376
247 Ga0501048_0032082 3300049582 Bacteria 3798
248 Ga0501068_0210333 3300049584 Bacteria 1235
249 Ga0501068_0856718 3300049584 Bacteria 597
250 Ga0501070_0001115 3300049586 Bacteria 24127
251 Ga0501070_0030053 3300049586 Bacteria 4553
252 Ga0501070_0036716 3300049586 Bacteria 4092
253 Ga0501071_0431300 3300049587 Bacteria 1008
254 Ga0501073_0000734 3300049589 Bacteria 23212
255 Ga0501076_0200625 3300049592 Bacteria 1629
256 Ga0501080_0207029 3300049742 Bacteria 1799
257 Ga0501035_0127139 3300049822 Bacteria 2224
258 Ga0501035_0358359 3300049822 Bacteria 1219
259 Ga0501044_0088047 3300049823 Bacteria 3135
260 Ga0501044_0548235 3300049823 Bacteria 1054
261 Ga0501045_0256606 3300049824 Bacteria 1301
262 nmdc:mga03n38_399765_c1 3300050490 Bacteria 756
263 nmdc:mga00v17_19103_c1 3300050491 Bacteria 3906
264 nmdc:mga00v17_197468_c1 3300050491 Bacteria 1300
265 nmdc:mga0yw44_18611_c1 3300050492 Bacteria 3809
266 nmdc:mga06z11_587550_c1 3300050494 Bacteria 677
267 nmdc:mga07m45_178073_c1 3300050496 Bacteria 1236
268 nmdc:mga0sz30_1533_c2 3300050516 Bacteria 2065
269 nmdc:mga0sz30_195276_c1 3300050516 Bacteria 898
270 Ga0500635_0000010 3300053080 Bacteria 147500
271 Ga0500650_0153675 3300053098 Bacteria 1063
272 Ga0500556_0000001 3300053104 Bacteria 1135060
273 Ga0500562_001594 3300053108 Bacteria 5641
274 Ga0500593_002174 3300053117 Bacteria 7138
275 Ga0500655_066013 3300053133 Bacteria 733
276 Ga0500559_0000753 3300053136 Bacteria 21265
277 Ga0500559_0001017 3300053136 Bacteria 17219
278 Ga0500559_0009040 3300053136 Bacteria 4329
279 Ga0500559_0014900 3300053136 Bacteria 3285
280 Ga0500559_0292241 3300053136 Bacteria 766
281 Ga0500559_0487596 3300053136 Bacteria 567
282 Ga0500568_0000006 3300053139 Bacteria 522235
283 Ga0500568_0000049 3300053139 Bacteria 116515
284 Ga0500568_0000486 3300053139 Bacteria 29334
285 Ga0500568_0005808 3300053139 Bacteria 6299
286 Ga0500573_0026740 3300053140 Bacteria 3317
287 Ga0500573_0123008 3300053140 Bacteria 1443
288 Ga0500577_0008302 3300053142 Bacteria 2955
289 Ga0500577_0082848 3300053142 Bacteria 1282
290 Ga0500577_0099738 3300053142 Bacteria 1185
291 Ga0500616_0000078 3300053153 Bacteria 202009
292 Ga0500620_306441 3300053155 Bacteria 513
293 Ga0500645_002454 3300053730 Bacteria 8235
294 Ga0587084_024681 3300059477 Bacteria 927
295 Ga0587101_080283 3300059623 Bacteria 617
296 Ga0587115_069688 3300059626 Bacteria 605
297 Ga0501082_0252763 3300060353 Bacteria 1534
298 Ga0466962_0009535 3300061719 Bacteria 4656

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049570 Ga0501033_0011128 Ga0501033_0011128_5858_6346 137
2 3300049572 Ga0501036_0429298 Ga0501036_0429298_17_505 137
3 3300049573 Ga0501037_0043454 Ga0501037_0043454_596_1084 137
4 3300049574 Ga0501038_0225956 Ga0501038_0225956_955_1443 137
5 3300049579 Ga0501043_0093045 Ga0501043_0093045_596_1084 137
6 3300049584 Ga0501068_0856718 Ga0501068_0856718_93_581 137
7 3300049586 Ga0501070_0036716 Ga0501070_0036716_3521_4009 137
8 3300049587 Ga0501071_0431300 Ga0501071_0431300_496_984 137
9 3300060353 Ga0501082_0252763 Ga0501082_0252763_190_678 137
10 3300049579 Ga0501043_0246330 Ga0501043_0246330_636_1124 139
11 3300049573 Ga0501037_0882275 Ga0501037_0882275_49_537 141
12 3300049574 Ga0501038_0167786 Ga0501038_0167786_19_507 141
13 3300049823 Ga0501044_0548235 Ga0501044_0548235_556_1044 141
14 3300048920 Ga0496117_0331337 Ga0496117_0331337_268_753 144
15 3300048921 Ga0496118_0131565 Ga0496118_0131565_347_832 144
16 3300048924 Ga0496121_0088486 Ga0496121_0088486_970_1458 145
17 3300049569 Ga0501032_0044066 Ga0501032_0044066_205_693 145
18 3300049570 Ga0501033_0618926 Ga0501033_0618926_68_556 145
19 3300049571 Ga0501034_0038659 Ga0501034_0038659_3649_4137 145
20 3300049574 Ga0501038_0037145 Ga0501038_0037145_275_763 145
21 3300044658 Ga0466972_0150125 Ga0466972_0150125_636_1076 146
22 3300031824 Ga0307413_10424975 Ga0307413_104249751 147
23 3300031901 Ga0307406_11136595 Ga0307406_111365951 147
24 3300032004 Ga0307414_10348795 Ga0307414_103487952 147
25 3300025932 Ga0207690_10624229 Ga0207690_106242292 149
26 3300037418 Ga0395900_0000887 Ga0395900_0000887_28671_29153 149
27 3300037466 Ga0395898_0000622 Ga0395898_0000622_38206_38688 149
28 3300013105 Ga0157369_10293212 Ga0157369_102932121 150
29 3300047469 Ga0495673_0315222 Ga0495673_0315222_16_501 150
30 3300048924 Ga0496121_0136872 Ga0496121_0136872_1067_1552 150
31 3300050490 nmdc:mga03n38_399765_c1 nmdc:mga03n38_399765_c1_250_702 150
32 3300053136 Ga0500559_0001017 Ga0500559_0001017_7523_7978 150
33 3300053153 Ga0500616_0000078 Ga0500616_0000078_81281_81766 150
34 3300049571 Ga0501034_1181119 Ga0501034_1181119_34_522 151
35 3300053139 Ga0500568_0000486 Ga0500568_0000486_19057_19551 151
36 3300053139 Ga0500568_0005808 Ga0500568_0005808_475_960 153
37 iso_pu_bacteria 2844841374 2844844995 154
38 3300044683 Ga0466965_0598297 Ga0466965_0598297_55_540 155
39 iso_pu_bacteria 2643221616 2644095844 156
40 iso_pu_bacteria 2844841374 2844842214 156
41 iso_pu_bacteria 2884763398 2884765207 156
42 iso_pu_bacteria 2906799679 2906800600 156
43 iso_pu_bacteria 2919055335 2919057860 156
44 iso_pu_bacteria 2919523602 2919524262 156
45 iso_pu_bacteria 2928153084 2928156129 156
46 iso_pu_bacteria 2966921586 2966922157 156
47 iso_pu_bacteria 2643221542 2643733788 157
48 iso_pu_bacteria 2643221546 2643753430 157
49 iso_pu_bacteria 2643221549 2643767892 157
50 iso_pu_bacteria 2643221553 2643785615 157
51 iso_pu_bacteria 2643221619 2644111285 157
52 iso_pu_bacteria 2643221630 2644170369 157
53 iso_pu_bacteria 2643221635 2644198892 157
54 iso_pu_bacteria 2643221724 2644680029 157
55 iso_pu_bacteria 2721755702 2723641915 157
56 iso_pu_bacteria 2728369380 2730229527 157
57 iso_pu_bacteria 2747842429 2747951808 157
58 iso_pu_bacteria 2757320536 2758225949 157
59 iso_pu_bacteria 2808606372 2808901867 157
60 iso_pu_bacteria 2852646457 2852647392 157
61 iso_pu_bacteria 2852663356 2852665146 157
62 iso_pu_bacteria 2857723135 2857723669 157
63 iso_pu_bacteria 2857733635 2857733748 157
64 iso_pu_bacteria 2870622029 2870623966 157
65 iso_pu_bacteria 2904509784 2904511886 157
66 iso_pu_bacteria 2908678064 2908680803 157
67 iso_pu_bacteria 2919069694 2919071648 157
68 iso_pu_bacteria 2919443155 2919446406 157
69 iso_pu_bacteria 2935409751 2935411255 157
70 iso_pu_bacteria 2939657138 2939658445 157
71 iso_pu_bacteria 2945968032 2945971878 157
72 iso_pu_bacteria 2946033335 2946033683 157
73 iso_pu_bacteria 2946041624 2946044067 157
74 iso_pu_bacteria 2946080515 2946081068 157
75 iso_pu_bacteria 2974294766 2974297277 157
76 iso_pu_bacteria 2974324384 2974326488 157
77 iso_pu_bacteria 2977228692 2977231523 157
78 iso_pu_bacteria 2977236895 2977240304 157
79 iso_pu_bacteria 2977264416 2977266745 157
80 iso_pu_bacteria 2984542743 2984545417 157
81 iso_pu_bacteria 8004182704 8004185270 157
82 iso_pu_bacteria 8016254467 8016257437 157
83 iso_pu_bacteria 8046352972 8046353061 157
84 iso_pu_bacteria 8057345674 8057347916 157
85 iso_pu_bacteria 2643221632 2644183161 158
86 iso_pu_bacteria 2857729791 2857730072 158
87 iso_pu_bacteria 2928121344 2928123298 158
88 iso_pu_bacteria 2966924647 2966927155 158
89 iso_pu_bacteria 2995726249 2995727938 158
90 iso_pu_bacteria 8002811521 8002813133 158
91 iso_pu_bacteria 8055034563 8055036082 158
92 iso_pu_bacteria 8055037949 8055038430 158
93 3300028380 Ga0268265_11026690 Ga0268265_110266902 159
94 3300001990 JGI24737J22298_10110629 JGI24737J22298_101106291 160
95 3300002067 JGI24735J21928_10004014 JGI24735J21928_100040142 160
96 3300002772 JGI25164J39214_1002096 JGI25164J39214_10020963 160
97 3300003157 Ga0006774J45829_10616 Ga0006774J45829_106161 160
98 3300003160 Ga0006779J45831_101077 Ga0006779J45831_1010771 160
99 3300003162 Ga0006778J45830_1020423 Ga0006778J45830_10204231 160
100 3300003214 JGI25165J46597_1000002 JGI25165J46597_1000002496 160
101 3300003288 Ga0007428J48920_105076 Ga0007428J48920_1050761 160
102 3300003305 Ga0006770J48903_1025561 Ga0006770J48903_10255611 160
103 3300003308 Ga0006777J48905_1036491 Ga0006777J48905_10364911 160
104 3300003322 rootL2_10184436 rootL2_101844362 160
105 3300003559 Ga0007427J51700_100554 Ga0007427J51700_1005541 160
106 3300003568 Ga0006781J51513_1003087 Ga0006781J51513_10030871 160
107 3300003578 Ga0006562J51391_1016324 Ga0006562J51391_10163242 160
108 3300003735 Ga0006780_1010065 Ga0006780_10100651 160
109 3300003752 Ga0055539_1000058 Ga0055539_100005832 160
110 3300003756 Ga0055533_1000001 Ga0055533_1000001549 160
111 3300003759 Ga0055525_1000881 Ga0055525_10008815 160
112 3300003841 Ga0055541_1009701 Ga0055541_10097011 160
113 3300005327 Ga0070658_10183133 Ga0070658_101831332 160
114 3300005337 Ga0070682_100189077 Ga0070682_1001890771 160
115 3300005347 Ga0070668_100316261 Ga0070668_1003162612 160
116 3300005366 Ga0070659_100278871 Ga0070659_1002788712 160
117 3300005457 Ga0070662_100902405 Ga0070662_1009024051 160
118 3300005548 Ga0070665_101477808 Ga0070665_1014778081 160
119 3300005577 Ga0068857_101675476 Ga0068857_1016754761 160
120 3300005618 Ga0068864_100995945 Ga0068864_1009959451 160
121 3300005719 Ga0068861_100017123 Ga0068861_1000171235 160
122 3300005840 Ga0068870_10091117 Ga0068870_100911173 160
123 3300006038 Ga0075365_10003344 Ga0075365_100033449 160
124 3300006038 Ga0075365_10017173 Ga0075365_100171733 160
125 3300006051 Ga0075364_10014688 Ga0075364_100146884 160
126 3300006051 Ga0075364_10185887 Ga0075364_101858872 160
127 3300006051 Ga0075364_10884971 Ga0075364_108849711 160
128 3300006178 Ga0075367_10401237 Ga0075367_104012372 160
129 3300006186 Ga0075369_10034458 Ga0075369_100344582 160
130 3300006186 Ga0075369_10092507 Ga0075369_100925072 160
131 3300006186 Ga0075369_10221954 Ga0075369_102219541 160
132 3300006353 Ga0075370_10173412 Ga0075370_101734122 160
133 3300006846 Ga0075430_100722658 Ga0075430_1007226581 160
134 3300009148 Ga0105243_10181331 Ga0105243_101813313 160
135 3300011119 Ga0105246_10975830 Ga0105246_109758302 160
136 3300013104 Ga0157370_10329889 Ga0157370_103298892 160
137 3300013105 Ga0157369_10035473 Ga0157369_100354736 160
138 3300013105 Ga0157369_10089593 Ga0157369_100895933 160
139 3300013105 Ga0157369_10370734 Ga0157369_103707342 160
140 3300013308 Ga0157375_10442194 Ga0157375_104421942 160
141 3300014325 Ga0163163_11228208 Ga0163163_112282081 160
142 3300014745 Ga0157377_10136499 Ga0157377_101364992 160
143 3300014969 Ga0157376_10872579 Ga0157376_108725792 160
144 3300017792 Ga0163161_10979708 Ga0163161_109797081 160
145 3300020069 Ga0197907_10201759 Ga0197907_102017591 160
146 3300020069 Ga0197907_11161920 Ga0197907_111619201 160
147 3300020076 Ga0206355_1533748 Ga0206355_15337482 160
148 3300020081 Ga0206354_10552443 Ga0206354_105524433 160
149 3300020082 Ga0206353_11205468 Ga0206353_112054686 160
150 3300025225 Ga0209566_100026 Ga0209566_100026174 160
151 3300025226 Ga0209674_100001 Ga0209674_100001550 160
152 3300025230 Ga0209563_100001 Ga0209563_100001550 160
153 3300025230 Ga0209563_100650 Ga0209563_1006506 160
154 3300025231 Ga0207427_100089 Ga0207427_10008915 160
155 3300025233 Ga0209437_100447 Ga0209437_10044735 160
156 3300025246 Ga0209646_1000099 Ga0209646_1000099143 160
157 3300025253 Ga0209677_100001 Ga0209677_100001550 160
158 3300025253 Ga0209677_101332 Ga0209677_1013328 160
159 3300025261 Ga0209233_1000001 Ga0209233_10000012310 160
160 3300025899 Ga0207642_10678804 Ga0207642_106788041 160
161 3300025904 Ga0207647_10058364 Ga0207647_100583642 160
162 3300025908 Ga0207643_10052014 Ga0207643_100520143 160
163 3300025909 Ga0207705_10083731 Ga0207705_100837312 160
164 3300025929 Ga0207664_10095156 Ga0207664_100951563 160
165 3300025935 Ga0207709_10204723 Ga0207709_102047231 160
166 3300025961 Ga0207712_10041699 Ga0207712_100416992 160
167 3300026116 Ga0207674_10187183 Ga0207674_101871833 160
168 3300026116 Ga0207674_11596457 Ga0207674_115964571 160
169 3300026142 Ga0207698_11014987 Ga0207698_110149871 160
170 3300028379 Ga0268266_10391434 Ga0268266_103914342 160
171 3300028381 Ga0268264_11219539 Ga0268264_112195391 160
172 3300028794 Ga0307515_10285834 Ga0307515_102858341 160
173 3300031649 Ga0307514_10016953 Ga0307514_100169532 160
174 3300031649 Ga0307514_10138941 Ga0307514_101389412 160
175 3300031731 Ga0307405_10630390 Ga0307405_106303902 160
176 3300031824 Ga0307413_10422062 Ga0307413_104220622 160
177 3300031824 Ga0307413_10824033 Ga0307413_108240332 160
178 3300031852 Ga0307410_10577611 Ga0307410_105776111 160
179 3300031901 Ga0307406_10045649 Ga0307406_100456494 160
180 3300031901 Ga0307406_10127023 Ga0307406_101270232 160
181 3300031901 Ga0307406_10738242 Ga0307406_107382422 160
182 3300031901 Ga0307406_11554243 Ga0307406_115542431 160
183 3300031903 Ga0307407_11331653 Ga0307407_113316531 160
184 3300031911 Ga0307412_11076591 Ga0307412_110765911 160
185 3300031911 Ga0307412_11912507 Ga0307412_119125071 160
186 3300031995 Ga0307409_100056963 Ga0307409_1000569632 160
187 3300031995 Ga0307409_100233851 Ga0307409_1002338514 160
188 3300031995 Ga0307409_101552168 Ga0307409_1015521682 160
189 3300032002 Ga0307416_100208782 Ga0307416_1002087823 160
190 3300032004 Ga0307414_10015561 Ga0307414_100155613 160
191 3300032004 Ga0307414_10271118 Ga0307414_102711182 160
192 3300032004 Ga0307414_10417523 Ga0307414_104175232 160
193 3300032004 Ga0307414_10971738 Ga0307414_109717381 160
194 3300032004 Ga0307414_11174460 Ga0307414_111744601 160
195 3300032004 Ga0307414_11421747 Ga0307414_114217471 160
196 3300032126 Ga0307415_100513871 Ga0307415_1005138712 160
197 3300032126 Ga0307415_100887151 Ga0307415_1008871512 160
198 3300032126 Ga0307415_101456799 Ga0307415_1014567991 160
199 3300037418 Ga0395900_0023876 Ga0395900_0023876_384_866 160
200 3300037418 Ga0395900_0358980 Ga0395900_0358980_837_1319 160
201 3300038443 Ga0395901_0347697 Ga0395901_0347697_283_765 160
202 3300041413 Ga0439465_0055518 Ga0439465_0055518_583_1071 160
203 3300041441 Ga0451787_559768 Ga0451787_559768_39_527 160
204 3300041441 Ga0451787_731929 Ga0451787_731929_225_713 160
205 3300041451 Ga0451791_0935739 Ga0451791_0935739_334_822 160
206 3300041451 Ga0451791_0977117 Ga0451791_0977117_39_527 160
207 3300041451 Ga0451791_1792879 Ga0451791_1792879_840_1325 160
208 3300041452 Ga0451793_1327505 Ga0451793_1327505_65_553 160
209 3300041486 Ga0451807_1636346 Ga0451807_1636346_263_748 160
210 3300044656 Ga0466969_0232454 Ga0466969_0232454_306_788 160
211 3300044658 Ga0466972_0065064 Ga0466972_0065064_61_546 160
212 3300044658 Ga0466972_0073604 Ga0466972_0073604_333_815 160
213 3300044658 Ga0466972_0119668 Ga0466972_0119668_493_975 160
214 3300044683 Ga0466965_0000011 Ga0466965_0000011_19400_19891 160
215 3300044683 Ga0466965_0067080 Ga0466965_0067080_1045_1527 160
216 3300044683 Ga0466965_0373213 Ga0466965_0373213_53_535 160
217 3300044684 Ga0466966_0084448 Ga0466966_0084448_1439_1921 160
218 3300044684 Ga0466966_0156438 Ga0466966_0156438_407_889 160
219 3300044693 Ga0466961_0080875 Ga0466961_0080875_1116_1598 160
220 3300044735 Ga0466968_0121550 Ga0466968_0121550_498_980 160
221 3300044765 Ga0466970_0006959 Ga0466970_0006959_216_698 160
222 3300044765 Ga0466970_0041288 Ga0466970_0041288_417_899 160
223 3300044765 Ga0466970_0176243 Ga0466970_0176243_572_1054 160
224 3300045049 Ga0466959_0133628 Ga0466959_0133628_1215_1697 160
225 3300045049 Ga0466959_0234752 Ga0466959_0234752_765_1247 160
226 3300045049 Ga0466959_0473160 Ga0466959_0473160_256_738 160
227 3300045836 Ga0466958_0094036 Ga0466958_0094036_1360_1842 160
228 3300046453 Ga0495627_001282 Ga0495627_001282_106_591 160
229 3300046471 Ga0495650_0002487 Ga0495650_0002487_12011_12499 160
230 3300046471 Ga0495650_0163834 Ga0495650_0163834_63_557 160
231 3300048904 Ga0496101_0109775 Ga0496101_0109775_923_1405 160
232 3300048904 Ga0496101_0137486 Ga0496101_0137486_118_603 160
233 3300048905 Ga0496102_0536308 Ga0496102_0536308_319_801 160
234 3300048906 Ga0496103_0179161 Ga0496103_0179161_526_1023 160
235 3300048907 Ga0496104_0315858 Ga0496104_0315858_302_784 160
236 3300048907 Ga0496104_0412140 Ga0496104_0412140_171_656 160
237 3300048908 Ga0496105_0074964 Ga0496105_0074964_1344_1826 160
238 3300048908 Ga0496105_0295461 Ga0496105_0295461_686_1171 160
239 3300048910 Ga0496107_0485478 Ga0496107_0485478_142_627 160
240 3300048914 Ga0496111_0312740 Ga0496111_0312740_619_1104 160
241 3300048916 Ga0496113_0186643 Ga0496113_0186643_225_722 160
242 3300048917 Ga0496114_0179481 Ga0496114_0179481_931_1413 160
243 3300048917 Ga0496114_0297181 Ga0496114_0297181_218_703 160
244 3300048918 Ga0496115_0160346 Ga0496115_0160346_333_815 160
245 3300048920 Ga0496117_0000053 Ga0496117_0000053_175885_176370 160
246 3300048920 Ga0496117_0000346 Ga0496117_0000346_47644_48129 160
247 3300048920 Ga0496117_0003360 Ga0496117_0003360_645_1130 160
248 3300048920 Ga0496117_0013857 Ga0496117_0013857_4003_4485 160
249 3300048920 Ga0496117_0014678 Ga0496117_0014678_5002_5487 160
250 3300048920 Ga0496117_0119258 Ga0496117_0119258_325_807 160
251 3300048921 Ga0496118_0003448 Ga0496118_0003448_17723_18205 160
252 3300048921 Ga0496118_0012176 Ga0496118_0012176_6861_7346 160
253 3300048921 Ga0496118_0043484 Ga0496118_0043484_2533_3018 160
254 3300048921 Ga0496118_0200590 Ga0496118_0200590_561_1049 160
255 3300048922 Ga0496119_0005445 Ga0496119_0005445_5166_5651 160
256 3300048922 Ga0496119_0005920 Ga0496119_0005920_59_544 160
257 3300048922 Ga0496119_0020360 Ga0496119_0020360_1173_1658 160
258 3300048922 Ga0496119_0041888 Ga0496119_0041888_1540_2025 160
259 3300048923 Ga0496120_0000866 Ga0496120_0000866_31273_31758 160
260 3300048923 Ga0496120_0008386 Ga0496120_0008386_3462_3947 160
261 3300048923 Ga0496120_0037397 Ga0496120_0037397_1894_2379 160
262 3300048923 Ga0496120_0091064 Ga0496120_0091064_106_588 160
263 3300048924 Ga0496121_0000528 Ga0496121_0000528_13355_13840 160
264 3300048925 Ga0496122_0000120 Ga0496122_0000120_116701_117186 160
265 3300048925 Ga0496122_0003193 Ga0496122_0003193_10440_10925 160
266 3300048925 Ga0496122_0004987 Ga0496122_0004987_2879_3364 160
267 3300048925 Ga0496122_0016596 Ga0496122_0016596_92_580 160
268 3300048925 Ga0496122_0104622 Ga0496122_0104622_64_549 160
269 3300048925 Ga0496122_0131066 Ga0496122_0131066_173_658 160
270 3300048925 Ga0496122_0229806 Ga0496122_0229806_43_531 160
271 3300048926 Ga0496123_0000051 Ga0496123_0000051_146594_147079 160
272 3300048926 Ga0496123_0000681 Ga0496123_0000681_3615_4100 160
273 3300048926 Ga0496123_0011030 Ga0496123_0011030_6168_6653 160
274 3300048926 Ga0496123_0011928 Ga0496123_0011928_6936_7424 160
275 3300048926 Ga0496123_0232982 Ga0496123_0232982_222_710 160
276 3300048927 Ga0496124_0004150 Ga0496124_0004150_3250_3735 160
277 3300048927 Ga0496124_0014810 Ga0496124_0014810_1961_2446 160
278 3300048928 Ga0496125_0007116 Ga0496125_0007116_6437_6922 160
279 3300048928 Ga0496125_0022020 Ga0496125_0022020_5431_5916 160
280 3300048928 Ga0496125_0049645 Ga0496125_0049645_2862_3347 160
281 3300048928 Ga0496125_0123614 Ga0496125_0123614_1233_1718 160
282 3300048928 Ga0496125_0124773 Ga0496125_0124773_1130_1615 160
283 3300048928 Ga0496125_0326736 Ga0496125_0326736_28_516 160
284 3300048929 Ga0496126_0004408 Ga0496126_0004408_16341_16826 160
285 3300048929 Ga0496126_0007418 Ga0496126_0007418_55_543 160
286 3300048929 Ga0496126_0008000 Ga0496126_0008000_7027_7512 160
287 3300048929 Ga0496126_0011321 Ga0496126_0011321_6319_6804 160
288 3300048929 Ga0496126_0049574 Ga0496126_0049574_1634_2119 160
289 3300048929 Ga0496126_0087623 Ga0496126_0087623_1916_2398 160
290 3300048929 Ga0496126_0183455 Ga0496126_0183455_772_1257 160
291 3300048929 Ga0496126_0829974 Ga0496126_0829974_16_504 160
292 3300049568 Ga0501031_0096883 Ga0501031_0096883_1285_1770 160
293 3300049569 Ga0501032_0067039 Ga0501032_0067039_1400_1885 160
294 3300049569 Ga0501032_0897307 Ga0501032_0897307_39_527 160
295 3300049570 Ga0501033_0080046 Ga0501033_0080046_513_998 160
296 3300049570 Ga0501033_0160758 Ga0501033_0160758_1054_1539 160
297 3300049571 Ga0501034_0002011 Ga0501034_0002011_20404_20892 160
298 3300049571 Ga0501034_0032791 Ga0501034_0032791_3766_4251 160
299 3300049571 Ga0501034_0039944 Ga0501034_0039944_1411_1896 160
300 3300049571 Ga0501034_0057769 Ga0501034_0057769_2816_3304 160
301 3300049571 Ga0501034_0124940 Ga0501034_0124940_537_1022 160
302 3300049571 Ga0501034_0372413 Ga0501034_0372413_797_1279 160
303 3300049572 Ga0501036_0098365 Ga0501036_0098365_815_1300 160
304 3300049573 Ga0501037_0276659 Ga0501037_0276659_217_702 160
305 3300049574 Ga0501038_0001899 Ga0501038_0001899_9319_9804 160
306 3300049574 Ga0501038_0010881 Ga0501038_0010881_6522_7007 160
307 3300049575 Ga0501039_0014208 Ga0501039_0014208_425_910 160
308 3300049579 Ga0501043_0004260 Ga0501043_0004260_5989_6474 160
309 3300049580 Ga0501046_0008499 Ga0501046_0008499_3130_3615 160
310 3300049580 Ga0501046_0211272 Ga0501046_0211272_45_530 160
311 3300049581 Ga0501047_0132128 Ga0501047_0132128_85_570 160
312 3300049582 Ga0501048_0032082 Ga0501048_0032082_3064_3549 160
313 3300049584 Ga0501068_0210333 Ga0501068_0210333_691_1176 160
314 3300049586 Ga0501070_0001115 Ga0501070_0001115_16173_16655 160
315 3300049586 Ga0501070_0030053 Ga0501070_0030053_193_678 160
316 3300049589 Ga0501073_0000734 Ga0501073_0000734_14564_15052 160
317 3300049592 Ga0501076_0200625 Ga0501076_0200625_304_822 160
318 3300049742 Ga0501080_0207029 Ga0501080_0207029_259_744 160
319 3300049822 Ga0501035_0127139 Ga0501035_0127139_1046_1531 160
320 3300049822 Ga0501035_0358359 Ga0501035_0358359_710_1192 160
321 3300049823 Ga0501044_0088047 Ga0501044_0088047_54_539 160
322 3300049824 Ga0501045_0256606 Ga0501045_0256606_726_1211 160
323 3300050491 nmdc:mga00v17_19103_c1 nmdc:mga00v17_19103_c1_688_1173 160
324 3300050491 nmdc:mga00v17_197468_c1 nmdc:mga00v17_197468_c1_740_1225 160
325 3300050492 nmdc:mga0yw44_18611_c1 nmdc:mga0yw44_18611_c1_1005_1490 160
326 3300050494 nmdc:mga06z11_587550_c1 nmdc:mga06z11_587550_c1_125_610 160
327 3300050496 nmdc:mga07m45_178073_c1 nmdc:mga07m45_178073_c1_420_905 160
328 3300050516 nmdc:mga0sz30_1533_c2 nmdc:mga0sz30_1533_c2_1340_1828 160
329 3300050516 nmdc:mga0sz30_195276_c1 nmdc:mga0sz30_195276_c1_353_838 160
330 3300053080 Ga0500635_0000010 Ga0500635_0000010_127778_128260 160
331 3300053098 Ga0500650_0153675 Ga0500650_0153675_511_999 160
332 3300053104 Ga0500556_0000001 Ga0500556_0000001_591085_591573 160
333 3300053108 Ga0500562_001594 Ga0500562_001594_5094_5582 160
334 3300053117 Ga0500593_002174 Ga0500593_002174_3161_3646 160
335 3300053133 Ga0500655_066013 Ga0500655_066013_228_713 160
336 3300053136 Ga0500559_0000753 Ga0500559_0000753_20747_21232 160
337 3300053136 Ga0500559_0009040 Ga0500559_0009040_682_1170 160
338 3300053136 Ga0500559_0014900 Ga0500559_0014900_1871_2359 160
339 3300053136 Ga0500559_0292241 Ga0500559_0292241_59_544 160
340 3300053136 Ga0500559_0487596 Ga0500559_0487596_22_510 160
341 3300053139 Ga0500568_0000006 Ga0500568_0000006_103050_103538 160
342 3300053139 Ga0500568_0000049 Ga0500568_0000049_1773_2261 160
343 3300053140 Ga0500573_0026740 Ga0500573_0026740_2646_3134 160
344 3300053140 Ga0500573_0123008 Ga0500573_0123008_20_508 160
345 3300053142 Ga0500577_0008302 Ga0500577_0008302_146_634 160
346 3300053142 Ga0500577_0082848 Ga0500577_0082848_443_931 160
347 3300053142 Ga0500577_0099738 Ga0500577_0099738_565_1053 160
348 3300053155 Ga0500620_306441 Ga0500620_306441_18_503 160
349 3300053730 Ga0500645_002454 Ga0500645_002454_4824_5309 160
350 3300059477 Ga0587084_024681 Ga0587084_024681_18_503 160
351 3300059623 Ga0587101_080283 Ga0587101_080283_15_500 160
352 3300059626 Ga0587115_069688 Ga0587115_069688_107_592 160
353 3300061719 Ga0466962_0009535 Ga0466962_0009535_460_942 160
354 iso_pu_bacteria 2844852863 2844854822 160
355 iso_pu_bacteria 2897561785 2897564643 160
356 iso_pu_bacteria 8056037122 8056038908 160

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00210

Ferritin

Ferritin-like domain

36

175

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yjk-assembly1.cif.gz_B structure of dps from microbacterium arborescens in the high iron form 0.9842 11 160
4a25-assembly1.cif.gz_B x-ray structure dps from kineococcus radiotolerans in complex with mn (ii) ions. 0.9709 17 157
2yjk-assembly1.cif.gz_B structure of dps from microbacterium arborescens in the high iron form 0.9587 11 160
3ak8-assembly1.cif.gz_F crystal structure of the sep22 dodecamer, a dps-like protein from salmonella enterica subsp. enterica serovar enteritidis 0.9567 7 158
1jts-assembly2.cif.gz_T dna protection and binding by e. coli dps protein 0.9564 7 158
ID Description Score Start End Superfamily
2yjjG00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9766 10 160 1.20.1260.10
4a25D01 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9677 17 157 1.20.1260.10
2c6rA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9541 14 156 1.20.1260.10
2cf7A00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9513 19 160 1.20.1260.10
1velA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9506 14 157 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A2W1W6S1-F1-model_v4 deleted 1 20 158
AF-A0A2S9QRJ4-F1-model_v4 DNA starvation/stationary phase protection protein 0.9907 16 160 GO:0008199
GO:0016722
AF-A0A444QAV9-F1-model_v4 DNA starvation/stationary phase protection protein 0.9847 1 160 GO:0008199
GO:0016722
AF-A0A3S3ZBF7-F1-model_v4 DNA starvation/stationary phase protection protein 0.9822 1 160 GO:0008199
GO:0016722
AF-A0A517TF12-F1-model_v4 Fine tangled pili major subunit 0.9822 12 156 GO:0008199

Feature Viewer

pLDDT pTM Quality
93.97 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map