F420622

General Info

Members Datasets Scaffolds Average Seq Length
356 210 320 202

Family's Representative Sequence

Representative Sequence 3300048905|Ga0496102_0205125|Ga0496102_0205125_656_1261
Length 190
Sequence MTPAVNGSTIGDDGLARPAWASVDPMLREYYDSEWGMPVRDEQGLYERISLEGFQAGLSWATILRKRPAFRAAFKDFDPELVALDAGIVRNRLKIQSTITNARATLALRDDGGLVDFVWAFQPAATPRPNSLDEVPTTSAESIALSKALRKKGFAFVGPTTMFALMEAIGMVDTHLLDSHRRGSSGVWPQ

Samples

Sample ID Description Type Environment
1 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
2 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
3 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
4 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
5 2739367653 Kocuria sp. OV113 Isolate Unclassified
6 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
7 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
8 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
9 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
10 2816332305 Kocuria rhizophila FDAARGOS_302 Isolate Rhizosphere
11 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
12 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
13 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
14 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
15 2857727296 Kocuria sp. R-72562 Isolate Unclassified
16 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
17 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
18 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
19 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
20 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
21 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
22 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
23 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
24 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
25 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
26 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
27 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
28 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
29 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
30 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
31 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
32 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
33 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
34 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
35 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
36 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
37 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
38 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
39 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
40 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
41 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
42 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
43 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
48 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
57 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
58 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
69 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
70 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
72 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
91 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
92 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
93 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
94 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
95 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
96 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
101 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
102 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
103 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
108 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
109 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
110 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
111 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
112 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
113 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
114 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
115 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
116 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
117 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
118 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
119 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
120 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
121 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
122 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
123 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
124 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
125 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
126 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
127 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
128 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
129 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
130 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
131 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
132 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
133 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
134 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
135 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
136 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
137 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
138 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
139 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
140 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
141 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
142 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
143 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
144 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
145 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
146 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
147 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
148 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
149 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
150 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
151 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
152 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
153 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
154 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
155 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
156 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
157 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
158 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
159 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
160 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
161 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
162 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
163 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
164 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
165 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
166 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
179 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
180 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
181 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
196 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
197 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
198 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
199 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
200 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
201 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
202 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
203 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
206 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
207 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
210 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.2
Metatranscriptomes 1.69
Isolates 10.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.97
Nodule 0
Rhizoplane 8.15
Rhizosphere 85.11
Stem 0
Stem Tuber 0
Unclassified 4.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1000118 3300000549 Bacteria 13754
2 LJQas_1008819 3300000549 Bacteria 1220
3 JGI25152J39213_1000068 3300002773 Bacteria 68180
4 rootL2_10009515 3300003322 Bacteria 27363
5 Ga0065714_10146872 3300005288 Bacteria 1132
6 Ga0065714_10154921 3300005288 Bacteria 1063
7 Ga0065714_10199656 3300005288 Bacteria 880
8 Ga0070676_10008684 3300005328 Bacteria 5480
9 Ga0070670_100562748 3300005331 Bacteria 1018
10 Ga0070677_10008450 3300005333 Bacteria 3464
11 Ga0070677_10023276 3300005333 Bacteria 2292
12 Ga0068869_100361100 3300005334 Bacteria 1186
13 Ga0070668_100035867 3300005347 Bacteria 3784
14 Ga0070669_100036231 3300005353 Bacteria 3574
15 Ga0070671_100373180 3300005355 Bacteria 1218
16 Ga0070674_100063267 3300005356 Bacteria 2589
17 Ga0070674_101310020 3300005356 Bacteria 646
18 Ga0070673_100094019 3300005364 Bacteria 2456
19 Ga0070667_100015211 3300005367 Bacteria 6358
20 Ga0070678_100229362 3300005456 Bacteria 1547
21 Ga0070698_100414900 3300005471 Bacteria 1280
22 Ga0070672_100047202 3300005543 Bacteria 3341
23 Ga0068857_100723088 3300005577 Bacteria 947
24 Ga0068870_10344626 3300005840 Bacteria 954
25 Ga0068858_101324047 3300005842 Bacteria 709
26 Ga0075432_10001869 3300006058 Bacteria 6964
27 Ga0105251_10005213 3300009011 Bacteria 8570
28 Ga0105244_10005014 3300009036 Bacteria 8923
29 Ga0105244_10034930 3300009036 Bacteria 2643
30 Ga0105243_10020204 3300009148 Bacteria 5050
31 Ga0105243_10231020 3300009148 Bacteria 1641
32 Ga0105243_10282161 3300009148 Bacteria 1496
33 Ga0105242_10477548 3300009176 Bacteria 1181
34 Ga0105242_10559040 3300009176 Bacteria 1098
35 Ga0105248_10105559 3300009177 Bacteria 3176
36 Ga0105246_10005402 3300011119 Bacteria 7780
37 Ga0105246_10013655 3300011119 Bacteria 5096
38 Ga0105246_10047565 3300011119 Bacteria 2930
39 Ga0105246_10050388 3300011119 Bacteria 2856
40 Ga0105246_10099975 3300011119 Bacteria 2109
41 Ga0157373_10005428 3300013100 Bacteria 9576
42 Ga0157373_10018369 3300013100 Bacteria 5092
43 Ga0157373_10329781 3300013100 Bacteria 1086
44 Ga0157369_10096837 3300013105 Bacteria 3147
45 Ga0157374_10054864 3300013296 Bacteria 3718
46 Ga0163162_10064632 3300013306 Bacteria 3704
47 Ga0157380_10720072 3300014326 Bacteria 1005
48 Ga0209759_1013799 3300025256 Bacteria 2168
49 Ga0209129_1000052 3300025258 Bacteria 265251
50 Ga0209676_1000935 3300025292 Bacteria 35951
51 Ga0209025_1000895 3300025294 Bacteria 46371
52 Ga0209051_1003833 3300025303 Bacteria 9629
53 Ga0209051_1010793 3300025303 Bacteria 4571
54 Ga0207697_10001390 3300025315 Bacteria 13247
55 Ga0207655_1001478 3300025728 Bacteria 21596
56 Ga0207655_1021562 3300025728 Bacteria 3265
57 Ga0207682_10001521 3300025893 Bacteria 10687
58 Ga0207682_10028646 3300025893 Bacteria 2224
59 Ga0207645_10000379 3300025907 Bacteria 36688
60 Ga0207645_10543279 3300025907 Bacteria 788
61 Ga0207681_10039037 3300025923 Bacteria 3149
62 Ga0207650_10087474 3300025925 Bacteria 2374
63 Ga0207650_10092248 3300025925 Bacteria 2316
64 Ga0207687_10050692 3300025927 Bacteria 2890
65 Ga0207644_10063878 3300025931 Bacteria 2674
66 Ga0207709_10129994 3300025935 Bacteria 1715
67 Ga0207669_10020333 3300025937 Bacteria 3479
68 Ga0207691_10007811 3300025940 Bacteria 10299
69 Ga0207689_10641148 3300025942 Bacteria 895
70 Ga0207651_10007903 3300025960 Bacteria 5698
71 Ga0207668_10302039 3300025972 Bacteria 1321
72 Ga0207703_10937119 3300026035 Bacteria 830
73 Ga0207683_10123457 3300026121 Bacteria 2326
74 Ga0207428_10002801 3300027907 Bacteria 17322
75 Ga0207428_10176973 3300027907 Bacteria 1613
76 Ga0265327_10000001 3300031251 Bacteria 894475
77 Ga0307408_100006145 3300031548 Bacteria 7972
78 Ga0307408_100032579 3300031548 Bacteria 3634
79 Ga0307408_100041586 3300031548 Bacteria 3258
80 Ga0307408_100051525 3300031548 Bacteria 2965
81 Ga0307408_100099133 3300031548 Bacteria 2216
82 Ga0307408_100101630 3300031548 Bacteria 2191
83 Ga0307408_100120758 3300031548 Bacteria 2029
84 Ga0307408_100163705 3300031548 Bacteria 1769
85 Ga0307408_100561222 3300031548 Bacteria 1009
86 Ga0307405_10001135 3300031731 Bacteria 10925
87 Ga0307405_10003780 3300031731 Bacteria 7032
88 Ga0307405_10024257 3300031731 Bacteria 3461
89 Ga0307405_10209669 3300031731 Bacteria 1421
90 Ga0307405_10446464 3300031731 Bacteria 1024
91 Ga0307405_10524958 3300031731 Bacteria 953
92 Ga0307405_10663010 3300031731 Bacteria 859
93 Ga0307413_10019414 3300031824 Bacteria 3592
94 Ga0307413_10041870 3300031824 Bacteria 2686
95 Ga0307413_10047681 3300031824 Bacteria 2556
96 Ga0307413_10057697 3300031824 Bacteria 2375
97 Ga0307413_10061905 3300031824 Bacteria 2312
98 Ga0307413_10111352 3300031824 Bacteria 1833
99 Ga0307413_10200199 3300031824 Bacteria 1442
100 Ga0307410_10004116 3300031852 Bacteria 7450
101 Ga0307410_10011221 3300031852 Bacteria 5114
102 Ga0307410_10023337 3300031852 Bacteria 3843
103 Ga0307410_10041449 3300031852 Bacteria 3037
104 Ga0307410_10078966 3300031852 Bacteria 2304
105 Ga0307410_10082042 3300031852 Bacteria 2267
106 Ga0307410_10089115 3300031852 Bacteria 2185
107 Ga0307410_10312967 3300031852 Bacteria 1243
108 Ga0307410_10434457 3300031852 Bacteria 1068
109 Ga0307410_10438925 3300031852 Bacteria 1062
110 Ga0307406_10096161 3300031901 Bacteria 2006
111 Ga0307406_10122684 3300031901 Bacteria 1809
112 Ga0307406_10152720 3300031901 Bacteria 1649
113 Ga0307407_10000695 3300031903 Bacteria 10913
114 Ga0307407_10008342 3300031903 Bacteria 4748
115 Ga0307407_10013899 3300031903 Bacteria 3923
116 Ga0307407_10016097 3300031903 Bacteria 3715
117 Ga0307407_10039400 3300031903 Bacteria 2627
118 Ga0307407_10053958 3300031903 Bacteria 2315
119 Ga0307407_10083781 3300031903 Bacteria 1935
120 Ga0307412_10000535 3300031911 Bacteria 22642
121 Ga0307412_10006724 3300031911 Bacteria 6519
122 Ga0307412_10010487 3300031911 Bacteria 5339
123 Ga0307412_10018632 3300031911 Bacteria 4182
124 Ga0307412_10053137 3300031911 Bacteria 2684
125 Ga0307412_10141024 3300031911 Bacteria 1765
126 Ga0307409_100035854 3300031995 Bacteria 3638
127 Ga0307409_100072886 3300031995 Bacteria 2737
128 Ga0307409_100082556 3300031995 Bacteria 2602
129 Ga0307409_100090194 3300031995 Bacteria 2508
130 Ga0307409_100096345 3300031995 Bacteria 2441
131 Ga0307409_100204795 3300031995 Bacteria 1768
132 Ga0307409_100257239 3300031995 Bacteria 1600
133 Ga0307409_100282589 3300031995 Bacteria 1535
134 Ga0307409_100590105 3300031995 Bacteria 1096
135 Ga0307416_100002767 3300032002 Bacteria 10181
136 Ga0307416_100020995 3300032002 Bacteria 4675
137 Ga0307416_100035319 3300032002 Bacteria 3816
138 Ga0307416_100044722 3300032002 Bacteria 3479
139 Ga0307416_100063634 3300032002 Bacteria 3022
140 Ga0307416_100072053 3300032002 Bacteria 2874
141 Ga0307416_100137501 3300032002 Bacteria 2213
142 Ga0307416_100138434 3300032002 Bacteria 2207
143 Ga0307416_100142288 3300032002 Bacteria 2183
144 Ga0307416_100422336 3300032002 Bacteria 1378
145 Ga0307416_100447371 3300032002 Bacteria 1343
146 Ga0307416_100768383 3300032002 Bacteria 1057
147 Ga0307414_10011224 3300032004 Bacteria 5244
148 Ga0307414_10032809 3300032004 Bacteria 3424
149 Ga0307414_10111334 3300032004 Bacteria 2085
150 Ga0307414_10115519 3300032004 Bacteria 2053
151 Ga0307414_10202936 3300032004 Bacteria 1614
152 Ga0307411_10001115 3300032005 Bacteria 10468
153 Ga0307411_10073979 3300032005 Bacteria 2320
154 Ga0307411_10286670 3300032005 Bacteria 1313
155 Ga0307415_100042176 3300032126 Bacteria 3035
156 Ga0307415_100070089 3300032126 Bacteria 2461
157 Ga0307415_100105642 3300032126 Bacteria 2077
158 Ga0307415_100226940 3300032126 Bacteria 1501
159 Ga0395899_0084977 3300037312 Bacteria 2300
160 Ga0395899_0109771 3300037312 Bacteria 1984
161 Ga0395899_0385246 3300037312 Bacteria 931
162 Ga0395900_0069825 3300037418 Bacteria 3611
163 Ga0395900_0092417 3300037418 Bacteria 3109
164 Ga0395900_0178484 3300037418 Bacteria 2159
165 Ga0395900_0180798 3300037418 Bacteria 2143
166 Ga0395898_0019307 3300037466 Bacteria 6939
167 Ga0395898_0032331 3300037466 Bacteria 5223
168 Ga0395898_0096102 3300037466 Bacteria 2846
169 Ga0395905_0014102 3300037471 Bacteria 7640
170 Ga0395905_0678407 3300037471 Bacteria 933
171 Ga0436364_0237930 3300037853 Bacteria 6384
172 Ga0395901_0060397 3300038443 Bacteria 3945
173 Ga0395901_0094566 3300038443 Bacteria 3131
174 Ga0439466_0044310 3300041411 Bacteria 1474
175 Ga0439465_0094107 3300041413 Bacteria 1028
176 Ga0439433_0001596 3300041999 Bacteria 4710
177 Ga0439442_000015 3300042002 Bacteria 47229
178 Ga0439442_008439 3300042002 Bacteria 2080
179 Ga0439442_020334 3300042002 Bacteria 1375
180 Ga0439432_000007 3300042006 Bacteria 91974
181 Ga0439449_0001350 3300042007 Bacteria 9620
182 Ga0439449_0001886 3300042007 Bacteria 8259
183 Ga0439449_0029152 3300042007 Bacteria 2056
184 Ga0439457_002116 3300042014 Bacteria 5779
185 Ga0439457_007959 3300042014 Bacteria 2519
186 Ga0439462_0006507 3300042015 Bacteria 2905
187 Ga0450919_001411 3300042121 Bacteria 3129
188 Ga0450920_000208 3300042122 Bacteria 8651
189 Ga0450920_000897 3300042122 Bacteria 4826
190 Ga0450920_007899 3300042122 Bacteria 1935
191 Ga0450907_000019 3300042146 Bacteria 75961
192 Ga0439446_0152558 3300042156 Bacteria 760
193 Ga0450909_000053 3300042185 Bacteria 9797
194 Ga0439434_0000734 3300042435 Bacteria 9392
195 Ga0450918_000306 3300042531 Bacteria 10970
196 Ga0450918_000616 3300042531 Bacteria 7631
197 Ga0466966_0128964 3300044684 Bacteria 1550
198 Ga0466961_0091105 3300044693 Bacteria 1925
199 Ga0466970_0187781 3300044765 Bacteria 1148
200 Ga0495627_002745 3300046453 Bacteria 8197
201 Ga0495591_013508 3300046458 Bacteria 2980
202 Ga0495651_0096206 3300046462 Bacteria 2213
203 Ga0495650_0006051 3300046471 Bacteria 7641
204 Ga0495650_0009077 3300046471 Bacteria 5705
205 Ga0495650_0035742 3300046471 Bacteria 2183
206 Ga0495580_0004178 3300046472 Bacteria 12148
207 Ga0495605_0000011 3300046474 Bacteria 314856
208 Ga0495639_0000805 3300046475 Bacteria 14358
209 Ga0495639_0290427 3300046475 Bacteria 814
210 Ga0495594_0002490 3300046499 Bacteria 9595
211 Ga0495583_0000047 3300046506 Bacteria 217720
212 Ga0495616_0014574 3300046513 Bacteria 4396
213 Ga0495620_0002437 3300046515 Bacteria 10773
214 Ga0495631_0003278 3300046518 Bacteria 8898
215 Ga0495637_0004421 3300046520 Bacteria 7294
216 Ga0495648_0005555 3300046524 Bacteria 10458
217 Ga0495642_0082438 3300046528 Bacteria 1356
218 Ga0495642_0162598 3300046528 Bacteria 968
219 Ga0495654_0000866 3300046530 Bacteria 22797
220 Ga0495665_0017526 3300046531 Bacteria 3852
221 Ga0495665_0156561 3300046531 Bacteria 1188
222 Ga0495586_0007880 3300046535 Bacteria 5679
223 Ga0495586_0009259 3300046535 Bacteria 5237
224 Ga0495609_0000004 3300046538 Bacteria 697346
225 Ga0495597_0001996 3300046542 Bacteria 13695
226 Ga0495645_0172863 3300046543 Bacteria 1486
227 Ga0495633_0000206 3300046558 Bacteria 74675
228 Ga0495656_0064246 3300046615 Bacteria 1611
229 Ga0495656_0336405 3300046615 Bacteria 780
230 Ga0495668_0054424 3300046616 Bacteria 2212
231 Ga0495611_0000327 3300046648 Bacteria 31335
232 Ga0495661_0000005 3300046665 Bacteria 433622
233 Ga0495588_0044965 3300046674 Bacteria 2262
234 Ga0495588_0071006 3300046674 Bacteria 1810
235 Ga0495669_0110309 3300046684 Bacteria 1284
236 Ga0495670_0042463 3300046691 Bacteria 2268
237 Ga0495670_0367347 3300046691 Bacteria 775
238 Ga0495671_0024881 3300046692 Bacteria 3115
239 Ga0495671_0457602 3300046692 Bacteria 610
240 Ga0495589_0000470 3300046794 Bacteria 29417
241 Ga0495600_0196782 3300046809 Bacteria 1295
242 Ga0495600_0648904 3300046809 Bacteria 638
243 Ga0495660_0004371 3300046810 Bacteria 8559
244 Ga0495581_0039054 3300047315 Bacteria 2748
245 Ga0495581_0238481 3300047315 Bacteria 1063
246 Ga0495581_0296844 3300047315 Bacteria 944
247 Ga0495581_0358235 3300047315 Bacteria 851
248 Ga0495581_0672178 3300047315 Bacteria 598
249 Ga0495683_0000031 3300047323 Bacteria 150363
250 Ga0495677_0136000 3300047445 Bacteria 942
251 Ga0495679_000154 3300047446 Bacteria 61634
252 Ga0495673_0039382 3300047469 Bacteria 2144
253 Ga0496100_0009704 3300048903 Bacteria 5416
254 Ga0496101_0005979 3300048904 Bacteria 7801
255 Ga0496102_0016544 3300048905 Bacteria 6445
256 Ga0496102_0068541 3300048905 Bacteria 3255
257 Ga0496102_0140217 3300048905 Bacteria 2266
258 Ga0496102_0163634 3300048905 Bacteria 2093
259 Ga0496102_0205125 3300048905 Bacteria 1858
260 Ga0496102_0245084 3300048905 Bacteria 1689
261 Ga0496103_0006684 3300048906 Bacteria 6881
262 Ga0496103_0051225 3300048906 Bacteria 2555
263 Ga0496103_0177012 3300048906 Bacteria 1370
264 Ga0496105_0116629 3300048908 Bacteria 2202
265 Ga0496106_0012051 3300048909 Bacteria 6379
266 Ga0496106_0040977 3300048909 Bacteria 3469
267 Ga0496106_0250957 3300048909 Bacteria 1414
268 Ga0496107_0008545 3300048910 Bacteria 7086
269 Ga0496107_0020896 3300048910 Bacteria 4627
270 Ga0496107_0379676 3300048910 Bacteria 1051
271 Ga0496109_0435052 3300048912 Bacteria 1239
272 Ga0496110_0016941 3300048913 Bacteria 6091
273 Ga0496110_0204531 3300048913 Bacteria 1794
274 Ga0496110_0854997 3300048913 Bacteria 815
275 Ga0496111_0105832 3300048914 Bacteria 2070
276 Ga0496111_0233988 3300048914 Bacteria 1364
277 Ga0496112_0066784 3300048915 Bacteria 3549
278 Ga0496113_0092502 3300048916 Bacteria 2333
279 Ga0496113_0404870 3300048916 Bacteria 1095
280 Ga0496113_0916114 3300048916 Bacteria 693
281 Ga0496114_0197890 3300048917 Bacteria 1759
282 Ga0496122_0028113 3300048925 Bacteria 4784
283 Ga0496124_0287487 3300048927 Bacteria 1195
284 Ga0495678_000186 3300049459 Bacteria 72357
285 Ga0501316_014015 3300049532 Bacteria 952
286 Ga0501318_013920 3300049534 Bacteria 943
287 Ga0501321_034132 3300049537 Bacteria 692
288 Ga0501325_005990 3300049541 Bacteria 984
289 Ga0501032_0001886 3300049569 Bacteria 16563
290 Ga0501032_0167373 3300049569 Bacteria 1442
291 Ga0501034_0000729 3300049571 Bacteria 49757
292 Ga0501036_0319052 3300049572 Bacteria 1298
293 Ga0501037_0019532 3300049573 Bacteria 4999
294 Ga0501037_0566574 3300049573 Bacteria 765
295 Ga0501038_0245052 3300049574 Bacteria 1421
296 Ga0501038_0804398 3300049574 Bacteria 698
297 Ga0501039_0140846 3300049575 Bacteria 1894
298 Ga0501039_0444009 3300049575 Bacteria 1019
299 Ga0501041_0291841 3300049577 Bacteria 1027
300 Ga0501043_0253679 3300049579 Bacteria 1354
301 Ga0501043_0599917 3300049579 Bacteria 813
302 Ga0501047_0295811 3300049581 Bacteria 1462
303 Ga0501048_0580856 3300049582 Bacteria 804
304 Ga0501069_0186355 3300049585 Bacteria 1200
305 Ga0501070_0035675 3300049586 Bacteria 4154
306 Ga0501071_0004948 3300049587 Bacteria 8511
307 Ga0501071_0221975 3300049587 Bacteria 1422
308 Ga0501073_0093029 3300049589 Bacteria 2095
309 Ga0501076_0382864 3300049592 Bacteria 1156
310 Ga0501202_014015 3300049652 Bacteria 1531
311 Ga0501227_022409 3300049665 Bacteria 1462
312 Ga0501080_0422336 3300049742 Bacteria 1198
313 Ga0501035_0493085 3300049822 Bacteria 1009
314 Ga0501044_0155209 3300049823 Bacteria 2269
315 Ga0501044_0850679 3300049823 Bacteria 789
316 Ga0501212_006387 3300049851 Bacteria 1589
317 Ga0500618_017764 3300053125 Bacteria 1766
318 Ga0587090_003082 3300059510 Bacteria 1900
319 Ga0587072_009493 3300059643 Bacteria 1556
320 Ga0530510_0097648 3300061734 Bacteria 2148

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046528 Ga0495642_0082438 Ga0495642_0082438_447_974 175
2 3300047315 Ga0495581_0672178 Ga0495581_0672178_27_554 175
3 3300009148 Ga0105243_10231020 Ga0105243_102310202 176
4 3300046692 Ga0495671_0457602 Ga0495671_0457602_12_542 176
5 3300046809 Ga0495600_0648904 Ga0495600_0648904_74_604 176
6 3300047315 Ga0495581_0296844 Ga0495581_0296844_398_928 176
7 3300047445 Ga0495677_0136000 Ga0495677_0136000_352_882 176
8 3300048913 Ga0496110_0854997 Ga0496110_0854997_234_764 176
9 3300037418 Ga0395900_0180798 Ga0395900_0180798_24_572 182
10 3300049581 Ga0501047_0295811 Ga0501047_0295811_116_685 188
11 3300049822 Ga0501035_0493085 Ga0501035_0493085_204_773 188
12 3300049823 Ga0501044_0155209 Ga0501044_0155209_152_721 188
13 3300025942 Ga0207689_10641148 Ga0207689_106411481 189
14 3300049823 Ga0501044_0850679 Ga0501044_0850679_141_713 189
15 3300013100 Ga0157373_10018369 Ga0157373_100183694 190
16 3300048905 Ga0496102_0205125 Ga0496102_0205125_656_1261 190
17 3300048906 Ga0496103_0177012 Ga0496103_0177012_718_1323 190
18 3300048909 Ga0496106_0250957 Ga0496106_0250957_323_928 190
19 3300048914 Ga0496111_0233988 Ga0496111_0233988_683_1288 190
20 iso_pu_bacteria 2808606371 2808898495 190
21 iso_pu_bacteria 2811994882 2812372980 191
22 iso_pu_bacteria 2818991458 2819664834 191
23 iso_pu_bacteria 2818991462 2819689509 191
24 iso_pu_bacteria 2818991469 2819726947 191
25 3300031731 Ga0307405_10024257 Ga0307405_100242574 193
26 3300049574 Ga0501038_0804398 Ga0501038_0804398_78_659 193
27 3300049575 Ga0501039_0444009 Ga0501039_0444009_402_983 193
28 3300049577 Ga0501041_0291841 Ga0501041_0291841_391_972 193
29 3300049582 Ga0501048_0580856 Ga0501048_0580856_47_628 193
30 3300049587 Ga0501071_0221975 Ga0501071_0221975_674_1255 193
31 3300049592 Ga0501076_0382864 Ga0501076_0382864_533_1114 193
32 3300049742 Ga0501080_0422336 Ga0501080_0422336_598_1179 193
33 3300061734 Ga0530510_0097648 Ga0530510_0097648_204_785 193
34 iso_pu_bacteria 2554235227 2555229522 193
35 iso_pu_bacteria 2654587600 2655031543 193
36 iso_pu_bacteria 2939598168 2939601692 193
37 3300032004 Ga0307414_10111334 Ga0307414_101113342 194
38 3300046462 Ga0495651_0096206 Ga0495651_0096206_110_694 194
39 3300046531 Ga0495665_0017526 Ga0495665_0017526_45_632 194
40 3300046615 Ga0495656_0336405 Ga0495656_0336405_44_631 194
41 3300046684 Ga0495669_0110309 Ga0495669_0110309_668_1255 194
42 3300046809 Ga0495600_0196782 Ga0495600_0196782_420_1004 194
43 3300049652 Ga0501202_014015 Ga0501202_014015_631_1215 194
44 3300049851 Ga0501212_006387 Ga0501212_006387_584_1168 194
45 3300053125 Ga0500618_017764 Ga0500618_017764_1106_1732 194
46 iso_pu_bacteria 2844849076 2844850896 194
47 iso_pu_bacteria 2919391150 2919392609 194
48 iso_pu_bacteria 2945956166 2945956410 194
49 3300005334 Ga0068869_100361100 Ga0068869_1003611002 195
50 3300005577 Ga0068857_100723088 Ga0068857_1007230881 195
51 3300031852 Ga0307410_10434457 Ga0307410_104344571 195
52 3300031995 Ga0307409_100282589 Ga0307409_1002825892 195
53 3300048912 Ga0496109_0435052 Ga0496109_0435052_449_1036 195
54 3300048913 Ga0496110_0204531 Ga0496110_0204531_902_1489 195
55 3300048916 Ga0496113_0092502 Ga0496113_0092502_954_1541 195
56 iso_pu_bacteria 2857740372 2857743520 195
57 iso_pu_bacteria 2904497146 2904498699 195
58 iso_pu_bacteria 2904776348 2904779521 195
59 iso_pu_bacteria 2910809715 2910811283 195
60 iso_pu_bacteria 2919034639 2919036970 195
61 iso_pu_bacteria 2919538618 2919541732 195
62 iso_pu_bacteria 2932426870 2932429494 195
63 iso_pu_bacteria 2933418574 2933420534 195
64 iso_pu_bacteria 2939674588 2939678004 195
65 3300049579 Ga0501043_0599917 Ga0501043_0599917_190_792 196
66 3300049585 Ga0501069_0186355 Ga0501069_0186355_207_809 196
67 3300049586 Ga0501070_0035675 Ga0501070_0035675_889_1491 196
68 3300049587 Ga0501071_0004948 Ga0501071_0004948_633_1235 196
69 iso_pu_bacteria 2537561592 2537900049 196
70 iso_pu_bacteria 2739367653 2739603163 196
71 iso_pu_bacteria 2808606370 2808893438 196
72 iso_pu_bacteria 2816332305 2817508309 196
73 iso_pu_bacteria 2857727296 2857729049 196
74 iso_pu_bacteria 2953998280 2954002574 196
75 3300031911 Ga0307412_10141024 Ga0307412_101410241 197
76 3300038443 Ga0395901_0060397 Ga0395901_0060397_2343_2996 197
77 iso_pu_bacteria 2690315906 2691512031 197
78 iso_pu_bacteria 2919059106 2919062717 197
79 iso_pu_bacteria 2939647034 2939649618 197
80 iso_pu_bacteria 2945941187 2945945218 197
81 iso_pu_bacteria 8054107350 8054110480 197
82 3300002773 JGI25152J39213_1000068 JGI25152J39213_100006836 198
83 3300005471 Ga0070698_100414900 Ga0070698_1004149001 198
84 3300009148 Ga0105243_10020204 Ga0105243_100202047 198
85 3300011119 Ga0105246_10005402 Ga0105246_100054023 198
86 3300011119 Ga0105246_10047565 Ga0105246_100475651 198
87 3300025258 Ga0209129_1000052 Ga0209129_1000052119 198
88 3300025294 Ga0209025_1000895 Ga0209025_100089534 198
89 3300025303 Ga0209051_1010793 Ga0209051_10107934 198
90 3300025925 Ga0207650_10092248 Ga0207650_100922482 198
91 3300027907 Ga0207428_10002801 Ga0207428_1000280111 198
92 3300031548 Ga0307408_100032579 Ga0307408_1000325794 198
93 3300031548 Ga0307408_100099133 Ga0307408_1000991333 198
94 3300031548 Ga0307408_100163705 Ga0307408_1001637052 198
95 3300031731 Ga0307405_10663010 Ga0307405_106630102 198
96 3300031824 Ga0307413_10057697 Ga0307413_100576975 198
97 3300031852 Ga0307410_10089115 Ga0307410_100891153 198
98 3300031901 Ga0307406_10096161 Ga0307406_100961613 198
99 3300031901 Ga0307406_10152720 Ga0307406_101527203 198
100 3300031903 Ga0307407_10008342 Ga0307407_100083423 198
101 3300031903 Ga0307407_10039400 Ga0307407_100394002 198
102 3300031903 Ga0307407_10083781 Ga0307407_100837811 198
103 3300031911 Ga0307412_10053137 Ga0307412_100531372 198
104 3300031995 Ga0307409_100090194 Ga0307409_1000901944 198
105 3300032002 Ga0307416_100035319 Ga0307416_1000353193 198
106 3300032002 Ga0307416_100137501 Ga0307416_1001375013 198
107 3300032002 Ga0307416_100447371 Ga0307416_1004473711 198
108 3300032004 Ga0307414_10202936 Ga0307414_102029362 198
109 3300032005 Ga0307411_10073979 Ga0307411_100739793 198
110 3300032126 Ga0307415_100042176 Ga0307415_1000421762 198
111 3300037312 Ga0395899_0109771 Ga0395899_0109771_433_1029 198
112 3300037418 Ga0395900_0178484 Ga0395900_0178484_1119_1715 198
113 3300037471 Ga0395905_0678407 Ga0395905_0678407_79_675 198
114 3300041411 Ga0439466_0044310 Ga0439466_0044310_237_833 198
115 3300042007 Ga0439449_0001886 Ga0439449_0001886_7267_7863 198
116 3300042014 Ga0439457_007959 Ga0439457_007959_632_1228 198
117 3300042122 Ga0450920_007899 Ga0450920_007899_1159_1755 198
118 3300048905 Ga0496102_0068541 Ga0496102_0068541_639_1235 198
119 3300048906 Ga0496103_0006684 Ga0496103_0006684_905_1501 198
120 3300048910 Ga0496107_0379676 Ga0496107_0379676_338_934 198
121 3300049532 Ga0501316_014015 Ga0501316_014015_250_846 198
122 3300049537 Ga0501321_034132 Ga0501321_034132_67_663 198
123 3300049569 Ga0501032_0167373 Ga0501032_0167373_677_1273 198
124 3300049579 Ga0501043_0253679 Ga0501043_0253679_446_1042 198
125 3300059510 Ga0587090_003082 Ga0587090_003082_593_1189 198
126 3300059643 Ga0587072_009493 Ga0587072_009493_677_1273 198
127 3300005333 Ga0070677_10008450 Ga0070677_100084504 199
128 3300005456 Ga0070678_100229362 Ga0070678_1002293621 199
129 3300009036 Ga0105244_10005014 Ga0105244_100050145 199
130 3300011119 Ga0105246_10013655 Ga0105246_100136555 199
131 3300025303 Ga0209051_1003833 Ga0209051_10038339 199
132 3300025728 Ga0207655_1001478 Ga0207655_100147811 199
133 3300025893 Ga0207682_10028646 Ga0207682_100286462 199
134 3300026121 Ga0207683_10123457 Ga0207683_101234572 199
135 3300031548 Ga0307408_100051525 Ga0307408_1000515252 199
136 3300031824 Ga0307413_10111352 Ga0307413_101113521 199
137 3300031852 Ga0307410_10078966 Ga0307410_100789661 199
138 3300031903 Ga0307407_10053958 Ga0307407_100539582 199
139 3300031911 Ga0307412_10006724 Ga0307412_100067242 199
140 3300031995 Ga0307409_100096345 Ga0307409_1000963451 199
141 3300032002 Ga0307416_100768383 Ga0307416_1007683831 199
142 iso_pu_bacteria 2945920336 2945922915 199
143 iso_pu_bacteria 2946037020 2946041392 199
144 3300013100 Ga0157373_10005428 Ga0157373_1000542813 200
145 3300013296 Ga0157374_10054864 Ga0157374_100548644 200
146 3300025256 Ga0209759_1013799 Ga0209759_10137993 200
147 3300025907 Ga0207645_10543279 Ga0207645_105432791 200
148 3300031548 Ga0307408_100041586 Ga0307408_1000415862 200
149 3300031731 Ga0307405_10003780 Ga0307405_100037805 200
150 3300031824 Ga0307413_10047681 Ga0307413_100476812 200
151 3300031824 Ga0307413_10200199 Ga0307413_102001991 200
152 3300031852 Ga0307410_10011221 Ga0307410_100112213 200
153 3300031903 Ga0307407_10000695 Ga0307407_100006958 200
154 3300031995 Ga0307409_100035854 Ga0307409_1000358542 200
155 3300031995 Ga0307409_100204795 Ga0307409_1002047953 200
156 3300031995 Ga0307409_100257239 Ga0307409_1002572393 200
157 3300032002 Ga0307416_100002767 Ga0307416_1000027673 200
158 3300032002 Ga0307416_100138434 Ga0307416_1001384341 200
159 3300032002 Ga0307416_100422336 Ga0307416_1004223362 200
160 3300032004 Ga0307414_10032809 Ga0307414_100328092 200
161 3300032126 Ga0307415_100226940 Ga0307415_1002269401 200
162 3300037312 Ga0395899_0084977 Ga0395899_0084977_1115_1738 200
163 3300037312 Ga0395899_0385246 Ga0395899_0385246_206_829 200
164 3300037418 Ga0395900_0092417 Ga0395900_0092417_1849_2472 200
165 3300037466 Ga0395898_0019307 Ga0395898_0019307_4039_4662 200
166 3300037466 Ga0395898_0096102 Ga0395898_0096102_1955_2578 200
167 3300037471 Ga0395905_0014102 Ga0395905_0014102_1592_2215 200
168 3300038443 Ga0395901_0094566 Ga0395901_0094566_519_1142 200
169 3300042121 Ga0450919_001411 Ga0450919_001411_1735_2337 200
170 3300042122 Ga0450920_000897 Ga0450920_000897_760_1362 200
171 3300042185 Ga0450909_000053 Ga0450909_000053_6859_7461 200
172 3300042531 Ga0450918_000616 Ga0450918_000616_2041_2643 200
173 3300044684 Ga0466966_0128964 Ga0466966_0128964_42_671 200
174 3300044693 Ga0466961_0091105 Ga0466961_0091105_143_766 200
175 3300044765 Ga0466970_0187781 Ga0466970_0187781_152_775 200
176 3300046543 Ga0495645_0172863 Ga0495645_0172863_345_947 200
177 3300048905 Ga0496102_0163634 Ga0496102_0163634_1175_1777 200
178 3300048906 Ga0496103_0051225 Ga0496103_0051225_275_877 200
179 3300048915 Ga0496112_0066784 Ga0496112_0066784_1274_1876 200
180 3300049534 Ga0501318_013920 Ga0501318_013920_303_905 200
181 3300049569 Ga0501032_0001886 Ga0501032_0001886_1500_2102 200
182 3300049571 Ga0501034_0000729 Ga0501034_0000729_14926_15528 200
183 3300049573 Ga0501037_0566574 Ga0501037_0566574_90_692 200
184 3300000549 LJQas_1000118 LJQas_10001187 201
185 3300000549 LJQas_1008819 LJQas_10088191 201
186 3300003322 rootL2_10009515 rootL2_1000951511 201
187 3300005288 Ga0065714_10146872 Ga0065714_101468722 201
188 3300005288 Ga0065714_10154921 Ga0065714_101549211 201
189 3300005288 Ga0065714_10199656 Ga0065714_101996561 201
190 3300005328 Ga0070676_10008684 Ga0070676_100086847 201
191 3300005331 Ga0070670_100562748 Ga0070670_1005627482 201
192 3300005333 Ga0070677_10023276 Ga0070677_100232763 201
193 3300005347 Ga0070668_100035867 Ga0070668_1000358676 201
194 3300005353 Ga0070669_100036231 Ga0070669_1000362314 201
195 3300005355 Ga0070671_100373180 Ga0070671_1003731802 201
196 3300005356 Ga0070674_100063267 Ga0070674_1000632673 201
197 3300005356 Ga0070674_101310020 Ga0070674_1013100201 201
198 3300005364 Ga0070673_100094019 Ga0070673_1000940195 201
199 3300005367 Ga0070667_100015211 Ga0070667_1000152117 201
200 3300005543 Ga0070672_100047202 Ga0070672_1000472023 201
201 3300005840 Ga0068870_10344626 Ga0068870_103446262 201
202 3300005842 Ga0068858_101324047 Ga0068858_1013240471 201
203 3300006058 Ga0075432_10001869 Ga0075432_100018694 201
204 3300009011 Ga0105251_10005213 Ga0105251_100052137 201
205 3300009036 Ga0105244_10034930 Ga0105244_100349303 201
206 3300009148 Ga0105243_10282161 Ga0105243_102821612 201
207 3300009176 Ga0105242_10477548 Ga0105242_104775482 201
208 3300009176 Ga0105242_10559040 Ga0105242_105590401 201
209 3300009177 Ga0105248_10105559 Ga0105248_101055591 201
210 3300011119 Ga0105246_10050388 Ga0105246_100503882 201
211 3300011119 Ga0105246_10099975 Ga0105246_100999752 201
212 3300013100 Ga0157373_10329781 Ga0157373_103297812 201
213 3300013105 Ga0157369_10096837 Ga0157369_100968375 201
214 3300013306 Ga0163162_10064632 Ga0163162_100646322 201
215 3300014326 Ga0157380_10720072 Ga0157380_107200721 201
216 3300025292 Ga0209676_1000935 Ga0209676_100093527 201
217 3300025315 Ga0207697_10001390 Ga0207697_100013907 201
218 3300025728 Ga0207655_1021562 Ga0207655_10215621 201
219 3300025893 Ga0207682_10001521 Ga0207682_100015218 201
220 3300025907 Ga0207645_10000379 Ga0207645_1000037912 201
221 3300025923 Ga0207681_10039037 Ga0207681_100390371 201
222 3300025925 Ga0207650_10087474 Ga0207650_100874742 201
223 3300025927 Ga0207687_10050692 Ga0207687_100506924 201
224 3300025931 Ga0207644_10063878 Ga0207644_100638781 201
225 3300025935 Ga0207709_10129994 Ga0207709_101299941 201
226 3300025937 Ga0207669_10020333 Ga0207669_100203331 201
227 3300025940 Ga0207691_10007811 Ga0207691_100078112 201
228 3300025960 Ga0207651_10007903 Ga0207651_100079031 201
229 3300025972 Ga0207668_10302039 Ga0207668_103020391 201
230 3300026035 Ga0207703_10937119 Ga0207703_109371192 201
231 3300027907 Ga0207428_10176973 Ga0207428_101769731 201
232 3300031251 Ga0265327_10000001 Ga0265327_10000001244 201
233 3300031548 Ga0307408_100006145 Ga0307408_1000061453 201
234 3300031548 Ga0307408_100101630 Ga0307408_1001016302 201
235 3300031548 Ga0307408_100120758 Ga0307408_1001207582 201
236 3300031548 Ga0307408_100561222 Ga0307408_1005612221 201
237 3300031731 Ga0307405_10001135 Ga0307405_100011356 201
238 3300031731 Ga0307405_10209669 Ga0307405_102096691 201
239 3300031731 Ga0307405_10446464 Ga0307405_104464642 201
240 3300031731 Ga0307405_10524958 Ga0307405_105249582 201
241 3300031824 Ga0307413_10019414 Ga0307413_100194141 201
242 3300031824 Ga0307413_10041870 Ga0307413_100418703 201
243 3300031824 Ga0307413_10061905 Ga0307413_100619053 201
244 3300031852 Ga0307410_10004116 Ga0307410_100041163 201
245 3300031852 Ga0307410_10023337 Ga0307410_100233372 201
246 3300031852 Ga0307410_10041449 Ga0307410_100414491 201
247 3300031852 Ga0307410_10082042 Ga0307410_100820422 201
248 3300031852 Ga0307410_10312967 Ga0307410_103129672 201
249 3300031852 Ga0307410_10438925 Ga0307410_104389252 201
250 3300031901 Ga0307406_10122684 Ga0307406_101226842 201
251 3300031903 Ga0307407_10013899 Ga0307407_100138994 201
252 3300031903 Ga0307407_10016097 Ga0307407_100160971 201
253 3300031911 Ga0307412_10000535 Ga0307412_1000053517 201
254 3300031911 Ga0307412_10010487 Ga0307412_100104876 201
255 3300031911 Ga0307412_10018632 Ga0307412_100186326 201
256 3300031995 Ga0307409_100072886 Ga0307409_1000728864 201
257 3300031995 Ga0307409_100082556 Ga0307409_1000825562 201
258 3300031995 Ga0307409_100590105 Ga0307409_1005901051 201
259 3300032002 Ga0307416_100020995 Ga0307416_1000209953 201
260 3300032002 Ga0307416_100044722 Ga0307416_1000447224 201
261 3300032002 Ga0307416_100063634 Ga0307416_1000636344 201
262 3300032002 Ga0307416_100072053 Ga0307416_1000720535 201
263 3300032002 Ga0307416_100142288 Ga0307416_1001422883 201
264 3300032004 Ga0307414_10011224 Ga0307414_100112245 201
265 3300032004 Ga0307414_10115519 Ga0307414_101155191 201
266 3300032005 Ga0307411_10001115 Ga0307411_100011154 201
267 3300032005 Ga0307411_10286670 Ga0307411_102866701 201
268 3300032126 Ga0307415_100070089 Ga0307415_1000700894 201
269 3300032126 Ga0307415_100105642 Ga0307415_1001056422 201
270 3300037418 Ga0395900_0069825 Ga0395900_0069825_2962_3579 201
271 3300037466 Ga0395898_0032331 Ga0395898_0032331_304_921 201
272 3300037853 Ga0436364_0237930 Ga0436364_0237930_3057_3680 201
273 3300041413 Ga0439465_0094107 Ga0439465_0094107_404_1018 201
274 3300041999 Ga0439433_0001596 Ga0439433_0001596_781_1392 201
275 3300042002 Ga0439442_000015 Ga0439442_000015_18639_19253 201
276 3300042002 Ga0439442_008439 Ga0439442_008439_628_1239 201
277 3300042002 Ga0439442_020334 Ga0439442_020334_323_937 201
278 3300042006 Ga0439432_000007 Ga0439432_000007_79161_79841 201
279 3300042007 Ga0439449_0001350 Ga0439449_0001350_384_995 201
280 3300042007 Ga0439449_0029152 Ga0439449_0029152_903_1517 201
281 3300042014 Ga0439457_002116 Ga0439457_002116_3276_3887 201
282 3300042015 Ga0439462_0006507 Ga0439462_0006507_2234_2845 201
283 3300042122 Ga0450920_000208 Ga0450920_000208_7240_7854 201
284 3300042146 Ga0450907_000019 Ga0450907_000019_16352_16966 201
285 3300042156 Ga0439446_0152558 Ga0439446_0152558_78_692 201
286 3300042435 Ga0439434_0000734 Ga0439434_0000734_2627_3241 201
287 3300042531 Ga0450918_000306 Ga0450918_000306_7334_7948 201
288 3300046453 Ga0495627_002745 Ga0495627_002745_3491_4162 201
289 3300046458 Ga0495591_013508 Ga0495591_013508_1810_2481 201
290 3300046471 Ga0495650_0006051 Ga0495650_0006051_6805_7476 201
291 3300046471 Ga0495650_0009077 Ga0495650_0009077_4407_5060 201
292 3300046471 Ga0495650_0035742 Ga0495650_0035742_673_1293 201
293 3300046472 Ga0495580_0004178 Ga0495580_0004178_25_630 201
294 3300046474 Ga0495605_0000011 Ga0495605_0000011_144448_145119 201
295 3300046475 Ga0495639_0000805 Ga0495639_0000805_1701_2306 201
296 3300046475 Ga0495639_0290427 Ga0495639_0290427_194_799 201
297 3300046499 Ga0495594_0002490 Ga0495594_0002490_6065_6736 201
298 3300046506 Ga0495583_0000047 Ga0495583_0000047_169302_169973 201
299 3300046513 Ga0495616_0014574 Ga0495616_0014574_2167_2838 201
300 3300046515 Ga0495620_0002437 Ga0495620_0002437_4375_5046 201
301 3300046518 Ga0495631_0003278 Ga0495631_0003278_4245_4916 201
302 3300046520 Ga0495637_0004421 Ga0495637_0004421_2119_2790 201
303 3300046524 Ga0495648_0005555 Ga0495648_0005555_3768_4439 201
304 3300046528 Ga0495642_0162598 Ga0495642_0162598_353_958 201
305 3300046530 Ga0495654_0000866 Ga0495654_0000866_428_1099 201
306 3300046531 Ga0495665_0156561 Ga0495665_0156561_377_982 201
307 3300046535 Ga0495586_0007880 Ga0495586_0007880_1042_1647 201
308 3300046535 Ga0495586_0009259 Ga0495586_0009259_805_1410 201
309 3300046538 Ga0495609_0000004 Ga0495609_0000004_531688_532359 201
310 3300046542 Ga0495597_0001996 Ga0495597_0001996_7005_7676 201
311 3300046558 Ga0495633_0000206 Ga0495633_0000206_46937_47608 201
312 3300046615 Ga0495656_0064246 Ga0495656_0064246_467_1072 201
313 3300046616 Ga0495668_0054424 Ga0495668_0054424_130_735 201
314 3300046648 Ga0495611_0000327 Ga0495611_0000327_11649_12320 201
315 3300046665 Ga0495661_0000005 Ga0495661_0000005_176139_176810 201
316 3300046674 Ga0495588_0044965 Ga0495588_0044965_406_1011 201
317 3300046674 Ga0495588_0071006 Ga0495588_0071006_1124_1729 201
318 3300046691 Ga0495670_0042463 Ga0495670_0042463_824_1495 201
319 3300046691 Ga0495670_0367347 Ga0495670_0367347_78_683 201
320 3300046692 Ga0495671_0024881 Ga0495671_0024881_824_1495 201
321 3300046794 Ga0495589_0000470 Ga0495589_0000470_22711_23382 201
322 3300046810 Ga0495660_0004371 Ga0495660_0004371_6041_6712 201
323 3300047315 Ga0495581_0039054 Ga0495581_0039054_385_990 201
324 3300047315 Ga0495581_0238481 Ga0495581_0238481_215_820 201
325 3300047315 Ga0495581_0358235 Ga0495581_0358235_91_696 201
326 3300047323 Ga0495683_0000031 Ga0495683_0000031_122678_123349 201
327 3300047446 Ga0495679_000154 Ga0495679_000154_5899_6570 201
328 3300047469 Ga0495673_0039382 Ga0495673_0039382_346_1017 201
329 3300048903 Ga0496100_0009704 Ga0496100_0009704_2794_3399 201
330 3300048904 Ga0496101_0005979 Ga0496101_0005979_4510_5115 201
331 3300048905 Ga0496102_0016544 Ga0496102_0016544_988_1593 201
332 3300048905 Ga0496102_0140217 Ga0496102_0140217_1394_1999 201
333 3300048905 Ga0496102_0245084 Ga0496102_0245084_1013_1618 201
334 3300048908 Ga0496105_0116629 Ga0496105_0116629_27_632 201
335 3300048909 Ga0496106_0012051 Ga0496106_0012051_865_1470 201
336 3300048909 Ga0496106_0040977 Ga0496106_0040977_1471_2076 201
337 3300048910 Ga0496107_0008545 Ga0496107_0008545_2371_2976 201
338 3300048910 Ga0496107_0020896 Ga0496107_0020896_639_1244 201
339 3300048913 Ga0496110_0016941 Ga0496110_0016941_1376_1981 201
340 3300048914 Ga0496111_0105832 Ga0496111_0105832_329_934 201
341 3300048916 Ga0496113_0404870 Ga0496113_0404870_201_806 201
342 3300048916 Ga0496113_0916114 Ga0496113_0916114_32_637 201
343 3300048917 Ga0496114_0197890 Ga0496114_0197890_681_1286 201
344 3300048925 Ga0496122_0028113 Ga0496122_0028113_2671_3342 201
345 3300048927 Ga0496124_0287487 Ga0496124_0287487_534_1139 201
346 3300049459 Ga0495678_000186 Ga0495678_000186_65651_66322 201
347 3300049541 Ga0501325_005990 Ga0501325_005990_30_650 201
348 3300049572 Ga0501036_0319052 Ga0501036_0319052_437_1069 201
349 3300049573 Ga0501037_0019532 Ga0501037_0019532_1344_1955 201
350 3300049574 Ga0501038_0245052 Ga0501038_0245052_181_813 201
351 3300049575 Ga0501039_0140846 Ga0501039_0140846_1050_1682 201
352 3300049589 Ga0501073_0093029 Ga0501073_0093029_345_977 201
353 3300049665 Ga0501227_022409 Ga0501227_022409_446_1066 201
354 iso_pu_bacteria 2808606366 2808877002 201
355 iso_pu_bacteria 2946024296 2946027127 201
356 iso_pu_bacteria 2966924647 2966925474 201

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03352

Adenine_glyco

Methyladenine glycosylase

20

182

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ofk-assembly1.cif.gz_A crystal structure of 3-methyladenine dna glycosylase i (tag) 0.9448 19 192
4ai4-assembly1.cif.gz_A crystal structure of e38q mutant of 3-methyladenine dna glycosylase i from staphylococcus aureus 0.9092 19 189
2ofk-assembly1.cif.gz_A crystal structure of 3-methyladenine dna glycosylase i (tag) 0.8997 19 192
1p7m-assembly1.cif.gz_A solution structure and base perturbation studies reveal a novel mode of alkylated base recognition by 3-methyladenine dna glycosylase i 0.8874 19 188
4ai5-assembly3.cif.gz_C crystal structure of y16f of 3-methyladenine dna glycosylase i (tag) in complex with 3-methyladenine 0.8853 19 201
ID Description Score Start End Superfamily
af_O05311_6_193_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.949 15 190 1.10.340.30
af_P05100_1_187_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9482 19 190 1.10.340.30
af_C6TKE8_117_301_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9341 22 192 1.10.340.30
1p7mA00 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.8874 19 188 1.10.340.30
af_O05311_6_193_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.8855 15 190 1.10.340.30
ID Description Score Start End GO Terms
AF-A0A4V3I715-F1-model_v4 deleted 0.9825 6 201
AF-A0A239K667-F1-model_v4 DNA-3-methyladenine glycosylase I 0.9804 2 201 GO:0006284
GO:0008725
GO:0046872
AF-E2S522-F1-model_v4 DNA-3-methyladenine glycosylase I (EC 3.2.2.20) 0.9804 6 199 GO:0006284
GO:0008725
GO:0046872
AF-A0A7W5IJ97-F1-model_v4 DNA-3-methyladenine glycosylase I (EC 3.2.2.20) 0.9802 7 201 GO:0006284
GO:0008725
GO:0046872
AF-A0A372K9F1-F1-model_v4 DNA-3-methyladenine glycosylase I 0.9802 7 201 GO:0006284
GO:0008725
GO:0046872

Feature Viewer

pLDDT pTM Quality
92.61 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map