F420622
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 356 | 210 | 320 | 202 |
Family's Representative Sequence
| Representative Sequence | 3300048905|Ga0496102_0205125|Ga0496102_0205125_656_1261 |
| Length | 190 |
| Sequence | MTPAVNGSTIGDDGLARPAWASVDPMLREYYDSEWGMPVRDEQGLYERISLEGFQAGLSWATILRKRPAFRAAFKDFDPELVALDAGIVRNRLKIQSTITNARATLALRDDGGLVDFVWAFQPAATPRPNSLDEVPTTSAESIALSKALRKKGFAFVGPTTMFALMEAIGMVDTHLLDSHRRGSSGVWPQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2537561592 | Arthrobacter crystallopoietes BAB-32 | Isolate | Rhizosphere |
| 2 | 2554235227 | Arthrobacter sp. PAO19 | Isolate | Rhizosphere |
| 3 | 2654587600 | Glutamicibacter halophytocola KLBMP5180 | Isolate | Unclassified |
| 4 | 2690315906 | Arthrobacter sp. OY3WO11 | Isolate | Unclassified |
| 5 | 2739367653 | Kocuria sp. OV113 | Isolate | Unclassified |
| 6 | 2808606366 | Arthrobacter sp. SLBN-83 | Isolate | Unclassified |
| 7 | 2808606370 | Arthrobacter sp. SLBN-100 | Isolate | Unclassified |
| 8 | 2808606371 | Arthrobacter sp. SLBN-53 | Isolate | Unclassified |
| 9 | 2811994882 | Terrabacter sp. SLBN-196 | Isolate | Unclassified |
| 10 | 2816332305 | Kocuria rhizophila FDAARGOS_302 | Isolate | Rhizosphere |
| 11 | 2818991458 | Terrabacter sp. 3211 | Isolate | Rhizosphere |
| 12 | 2818991462 | Terrabacter sp. 3264 | Isolate | Rhizosphere |
| 13 | 2818991469 | Terrabacter lapilli 3265 | Isolate | Rhizosphere |
| 14 | 2844849076 | Arthrobacter cupressi DSM 24664 | Isolate | Rhizosphere |
| 15 | 2857727296 | Kocuria sp. R-72562 | Isolate | Unclassified |
| 16 | 2857740372 | Paenarthrobacter sp. R-74611 | Isolate | Unclassified |
| 17 | 2904497146 | Arthrobacter sp. 1276 | Isolate | Rhizosphere |
| 18 | 2904776348 | Paenarthrobacter sp. 1092 | Isolate | Rhizosphere |
| 19 | 2910809715 | Paenarthrobacter sp. CM16 | Isolate | Unclassified |
| 20 | 2919034639 | Paenarthrobacter nitroguajacolicus 247 | Isolate | Rhizosphere |
| 21 | 2919059106 | Arthrobacter sp. 1088 | Isolate | Rhizosphere |
| 22 | 2919391150 | Arthrobacter ipis 2973 | Isolate | Unclassified |
| 23 | 2919538618 | Paenarthrobacter nitroguajacolicus 3945 | Isolate | Unclassified |
| 24 | 2932426870 | Paenarthrobacter sp. 4246 | Isolate | Rhizosphere |
| 25 | 2933418574 | Jeotgalibacillus campisalis 4120 | Isolate | Rhizosphere |
| 26 | 2939598168 | Arthrobacter sp. 754 | Isolate | Rhizosphere |
| 27 | 2939647034 | Arthrobacter sp. 2762 | Isolate | Rhizosphere |
| 28 | 2939674588 | Arthrobacter bambusae 3552 | Isolate | Rhizosphere |
| 29 | 2945920336 | Pseudarthrobacter siccitolerans W1I3 | Isolate | Rhizosphere |
| 30 | 2945941187 | Arthrobacter pascens W1I14 | Isolate | Rhizosphere |
| 31 | 2945956166 | Arthrobacter globiformus W2I3 | Isolate | Rhizosphere |
| 32 | 2946024296 | Arthrobacter woluwensis W4I2 | Isolate | Rhizosphere |
| 33 | 2946037020 | Arthrobacter sp. W4I7 | Isolate | Rhizosphere |
| 34 | 2953998280 | Pseudarthrobacter sp. W1I19 | Isolate | Rhizosphere |
| 35 | 2966924647 | Frigoribacterium sp. 2355 | Isolate | Rhizosphere |
| 36 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 37 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 38 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 39 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 40 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 44 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 57 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 69 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 70 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 90 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 91 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 92 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 93 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 94 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 95 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 96 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 97 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 98 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 99 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 100 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 101 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 102 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 103 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 104 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 105 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 106 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 107 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 108 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 109 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 110 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 111 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 112 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 113 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 114 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 115 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 116 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 117 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 118 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 119 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 120 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 121 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 122 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 123 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 124 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 125 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 126 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 127 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 166 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 167 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 168 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 169 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 170 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 171 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 172 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 173 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 174 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 175 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 176 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 177 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 178 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 179 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 180 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 182 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 183 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 184 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 185 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 195 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 196 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 201 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 202 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 206 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 207 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 208 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 209 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 210 | 8054107350 | Arthrobacter rhizosphaerae CCNWLXL 1-35 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.2 |
| Metatranscriptomes | 1.69 |
| Isolates | 10.11 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.97 |
| Nodule | 0 |
| Rhizoplane | 8.15 |
| Rhizosphere | 85.11 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.78 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1000118 | 3300000549 | Bacteria | 13754 |
| 2 | LJQas_1008819 | 3300000549 | Bacteria | 1220 |
| 3 | JGI25152J39213_1000068 | 3300002773 | Bacteria | 68180 |
| 4 | rootL2_10009515 | 3300003322 | Bacteria | 27363 |
| 5 | Ga0065714_10146872 | 3300005288 | Bacteria | 1132 |
| 6 | Ga0065714_10154921 | 3300005288 | Bacteria | 1063 |
| 7 | Ga0065714_10199656 | 3300005288 | Bacteria | 880 |
| 8 | Ga0070676_10008684 | 3300005328 | Bacteria | 5480 |
| 9 | Ga0070670_100562748 | 3300005331 | Bacteria | 1018 |
| 10 | Ga0070677_10008450 | 3300005333 | Bacteria | 3464 |
| 11 | Ga0070677_10023276 | 3300005333 | Bacteria | 2292 |
| 12 | Ga0068869_100361100 | 3300005334 | Bacteria | 1186 |
| 13 | Ga0070668_100035867 | 3300005347 | Bacteria | 3784 |
| 14 | Ga0070669_100036231 | 3300005353 | Bacteria | 3574 |
| 15 | Ga0070671_100373180 | 3300005355 | Bacteria | 1218 |
| 16 | Ga0070674_100063267 | 3300005356 | Bacteria | 2589 |
| 17 | Ga0070674_101310020 | 3300005356 | Bacteria | 646 |
| 18 | Ga0070673_100094019 | 3300005364 | Bacteria | 2456 |
| 19 | Ga0070667_100015211 | 3300005367 | Bacteria | 6358 |
| 20 | Ga0070678_100229362 | 3300005456 | Bacteria | 1547 |
| 21 | Ga0070698_100414900 | 3300005471 | Bacteria | 1280 |
| 22 | Ga0070672_100047202 | 3300005543 | Bacteria | 3341 |
| 23 | Ga0068857_100723088 | 3300005577 | Bacteria | 947 |
| 24 | Ga0068870_10344626 | 3300005840 | Bacteria | 954 |
| 25 | Ga0068858_101324047 | 3300005842 | Bacteria | 709 |
| 26 | Ga0075432_10001869 | 3300006058 | Bacteria | 6964 |
| 27 | Ga0105251_10005213 | 3300009011 | Bacteria | 8570 |
| 28 | Ga0105244_10005014 | 3300009036 | Bacteria | 8923 |
| 29 | Ga0105244_10034930 | 3300009036 | Bacteria | 2643 |
| 30 | Ga0105243_10020204 | 3300009148 | Bacteria | 5050 |
| 31 | Ga0105243_10231020 | 3300009148 | Bacteria | 1641 |
| 32 | Ga0105243_10282161 | 3300009148 | Bacteria | 1496 |
| 33 | Ga0105242_10477548 | 3300009176 | Bacteria | 1181 |
| 34 | Ga0105242_10559040 | 3300009176 | Bacteria | 1098 |
| 35 | Ga0105248_10105559 | 3300009177 | Bacteria | 3176 |
| 36 | Ga0105246_10005402 | 3300011119 | Bacteria | 7780 |
| 37 | Ga0105246_10013655 | 3300011119 | Bacteria | 5096 |
| 38 | Ga0105246_10047565 | 3300011119 | Bacteria | 2930 |
| 39 | Ga0105246_10050388 | 3300011119 | Bacteria | 2856 |
| 40 | Ga0105246_10099975 | 3300011119 | Bacteria | 2109 |
| 41 | Ga0157373_10005428 | 3300013100 | Bacteria | 9576 |
| 42 | Ga0157373_10018369 | 3300013100 | Bacteria | 5092 |
| 43 | Ga0157373_10329781 | 3300013100 | Bacteria | 1086 |
| 44 | Ga0157369_10096837 | 3300013105 | Bacteria | 3147 |
| 45 | Ga0157374_10054864 | 3300013296 | Bacteria | 3718 |
| 46 | Ga0163162_10064632 | 3300013306 | Bacteria | 3704 |
| 47 | Ga0157380_10720072 | 3300014326 | Bacteria | 1005 |
| 48 | Ga0209759_1013799 | 3300025256 | Bacteria | 2168 |
| 49 | Ga0209129_1000052 | 3300025258 | Bacteria | 265251 |
| 50 | Ga0209676_1000935 | 3300025292 | Bacteria | 35951 |
| 51 | Ga0209025_1000895 | 3300025294 | Bacteria | 46371 |
| 52 | Ga0209051_1003833 | 3300025303 | Bacteria | 9629 |
| 53 | Ga0209051_1010793 | 3300025303 | Bacteria | 4571 |
| 54 | Ga0207697_10001390 | 3300025315 | Bacteria | 13247 |
| 55 | Ga0207655_1001478 | 3300025728 | Bacteria | 21596 |
| 56 | Ga0207655_1021562 | 3300025728 | Bacteria | 3265 |
| 57 | Ga0207682_10001521 | 3300025893 | Bacteria | 10687 |
| 58 | Ga0207682_10028646 | 3300025893 | Bacteria | 2224 |
| 59 | Ga0207645_10000379 | 3300025907 | Bacteria | 36688 |
| 60 | Ga0207645_10543279 | 3300025907 | Bacteria | 788 |
| 61 | Ga0207681_10039037 | 3300025923 | Bacteria | 3149 |
| 62 | Ga0207650_10087474 | 3300025925 | Bacteria | 2374 |
| 63 | Ga0207650_10092248 | 3300025925 | Bacteria | 2316 |
| 64 | Ga0207687_10050692 | 3300025927 | Bacteria | 2890 |
| 65 | Ga0207644_10063878 | 3300025931 | Bacteria | 2674 |
| 66 | Ga0207709_10129994 | 3300025935 | Bacteria | 1715 |
| 67 | Ga0207669_10020333 | 3300025937 | Bacteria | 3479 |
| 68 | Ga0207691_10007811 | 3300025940 | Bacteria | 10299 |
| 69 | Ga0207689_10641148 | 3300025942 | Bacteria | 895 |
| 70 | Ga0207651_10007903 | 3300025960 | Bacteria | 5698 |
| 71 | Ga0207668_10302039 | 3300025972 | Bacteria | 1321 |
| 72 | Ga0207703_10937119 | 3300026035 | Bacteria | 830 |
| 73 | Ga0207683_10123457 | 3300026121 | Bacteria | 2326 |
| 74 | Ga0207428_10002801 | 3300027907 | Bacteria | 17322 |
| 75 | Ga0207428_10176973 | 3300027907 | Bacteria | 1613 |
| 76 | Ga0265327_10000001 | 3300031251 | Bacteria | 894475 |
| 77 | Ga0307408_100006145 | 3300031548 | Bacteria | 7972 |
| 78 | Ga0307408_100032579 | 3300031548 | Bacteria | 3634 |
| 79 | Ga0307408_100041586 | 3300031548 | Bacteria | 3258 |
| 80 | Ga0307408_100051525 | 3300031548 | Bacteria | 2965 |
| 81 | Ga0307408_100099133 | 3300031548 | Bacteria | 2216 |
| 82 | Ga0307408_100101630 | 3300031548 | Bacteria | 2191 |
| 83 | Ga0307408_100120758 | 3300031548 | Bacteria | 2029 |
| 84 | Ga0307408_100163705 | 3300031548 | Bacteria | 1769 |
| 85 | Ga0307408_100561222 | 3300031548 | Bacteria | 1009 |
| 86 | Ga0307405_10001135 | 3300031731 | Bacteria | 10925 |
| 87 | Ga0307405_10003780 | 3300031731 | Bacteria | 7032 |
| 88 | Ga0307405_10024257 | 3300031731 | Bacteria | 3461 |
| 89 | Ga0307405_10209669 | 3300031731 | Bacteria | 1421 |
| 90 | Ga0307405_10446464 | 3300031731 | Bacteria | 1024 |
| 91 | Ga0307405_10524958 | 3300031731 | Bacteria | 953 |
| 92 | Ga0307405_10663010 | 3300031731 | Bacteria | 859 |
| 93 | Ga0307413_10019414 | 3300031824 | Bacteria | 3592 |
| 94 | Ga0307413_10041870 | 3300031824 | Bacteria | 2686 |
| 95 | Ga0307413_10047681 | 3300031824 | Bacteria | 2556 |
| 96 | Ga0307413_10057697 | 3300031824 | Bacteria | 2375 |
| 97 | Ga0307413_10061905 | 3300031824 | Bacteria | 2312 |
| 98 | Ga0307413_10111352 | 3300031824 | Bacteria | 1833 |
| 99 | Ga0307413_10200199 | 3300031824 | Bacteria | 1442 |
| 100 | Ga0307410_10004116 | 3300031852 | Bacteria | 7450 |
| 101 | Ga0307410_10011221 | 3300031852 | Bacteria | 5114 |
| 102 | Ga0307410_10023337 | 3300031852 | Bacteria | 3843 |
| 103 | Ga0307410_10041449 | 3300031852 | Bacteria | 3037 |
| 104 | Ga0307410_10078966 | 3300031852 | Bacteria | 2304 |
| 105 | Ga0307410_10082042 | 3300031852 | Bacteria | 2267 |
| 106 | Ga0307410_10089115 | 3300031852 | Bacteria | 2185 |
| 107 | Ga0307410_10312967 | 3300031852 | Bacteria | 1243 |
| 108 | Ga0307410_10434457 | 3300031852 | Bacteria | 1068 |
| 109 | Ga0307410_10438925 | 3300031852 | Bacteria | 1062 |
| 110 | Ga0307406_10096161 | 3300031901 | Bacteria | 2006 |
| 111 | Ga0307406_10122684 | 3300031901 | Bacteria | 1809 |
| 112 | Ga0307406_10152720 | 3300031901 | Bacteria | 1649 |
| 113 | Ga0307407_10000695 | 3300031903 | Bacteria | 10913 |
| 114 | Ga0307407_10008342 | 3300031903 | Bacteria | 4748 |
| 115 | Ga0307407_10013899 | 3300031903 | Bacteria | 3923 |
| 116 | Ga0307407_10016097 | 3300031903 | Bacteria | 3715 |
| 117 | Ga0307407_10039400 | 3300031903 | Bacteria | 2627 |
| 118 | Ga0307407_10053958 | 3300031903 | Bacteria | 2315 |
| 119 | Ga0307407_10083781 | 3300031903 | Bacteria | 1935 |
| 120 | Ga0307412_10000535 | 3300031911 | Bacteria | 22642 |
| 121 | Ga0307412_10006724 | 3300031911 | Bacteria | 6519 |
| 122 | Ga0307412_10010487 | 3300031911 | Bacteria | 5339 |
| 123 | Ga0307412_10018632 | 3300031911 | Bacteria | 4182 |
| 124 | Ga0307412_10053137 | 3300031911 | Bacteria | 2684 |
| 125 | Ga0307412_10141024 | 3300031911 | Bacteria | 1765 |
| 126 | Ga0307409_100035854 | 3300031995 | Bacteria | 3638 |
| 127 | Ga0307409_100072886 | 3300031995 | Bacteria | 2737 |
| 128 | Ga0307409_100082556 | 3300031995 | Bacteria | 2602 |
| 129 | Ga0307409_100090194 | 3300031995 | Bacteria | 2508 |
| 130 | Ga0307409_100096345 | 3300031995 | Bacteria | 2441 |
| 131 | Ga0307409_100204795 | 3300031995 | Bacteria | 1768 |
| 132 | Ga0307409_100257239 | 3300031995 | Bacteria | 1600 |
| 133 | Ga0307409_100282589 | 3300031995 | Bacteria | 1535 |
| 134 | Ga0307409_100590105 | 3300031995 | Bacteria | 1096 |
| 135 | Ga0307416_100002767 | 3300032002 | Bacteria | 10181 |
| 136 | Ga0307416_100020995 | 3300032002 | Bacteria | 4675 |
| 137 | Ga0307416_100035319 | 3300032002 | Bacteria | 3816 |
| 138 | Ga0307416_100044722 | 3300032002 | Bacteria | 3479 |
| 139 | Ga0307416_100063634 | 3300032002 | Bacteria | 3022 |
| 140 | Ga0307416_100072053 | 3300032002 | Bacteria | 2874 |
| 141 | Ga0307416_100137501 | 3300032002 | Bacteria | 2213 |
| 142 | Ga0307416_100138434 | 3300032002 | Bacteria | 2207 |
| 143 | Ga0307416_100142288 | 3300032002 | Bacteria | 2183 |
| 144 | Ga0307416_100422336 | 3300032002 | Bacteria | 1378 |
| 145 | Ga0307416_100447371 | 3300032002 | Bacteria | 1343 |
| 146 | Ga0307416_100768383 | 3300032002 | Bacteria | 1057 |
| 147 | Ga0307414_10011224 | 3300032004 | Bacteria | 5244 |
| 148 | Ga0307414_10032809 | 3300032004 | Bacteria | 3424 |
| 149 | Ga0307414_10111334 | 3300032004 | Bacteria | 2085 |
| 150 | Ga0307414_10115519 | 3300032004 | Bacteria | 2053 |
| 151 | Ga0307414_10202936 | 3300032004 | Bacteria | 1614 |
| 152 | Ga0307411_10001115 | 3300032005 | Bacteria | 10468 |
| 153 | Ga0307411_10073979 | 3300032005 | Bacteria | 2320 |
| 154 | Ga0307411_10286670 | 3300032005 | Bacteria | 1313 |
| 155 | Ga0307415_100042176 | 3300032126 | Bacteria | 3035 |
| 156 | Ga0307415_100070089 | 3300032126 | Bacteria | 2461 |
| 157 | Ga0307415_100105642 | 3300032126 | Bacteria | 2077 |
| 158 | Ga0307415_100226940 | 3300032126 | Bacteria | 1501 |
| 159 | Ga0395899_0084977 | 3300037312 | Bacteria | 2300 |
| 160 | Ga0395899_0109771 | 3300037312 | Bacteria | 1984 |
| 161 | Ga0395899_0385246 | 3300037312 | Bacteria | 931 |
| 162 | Ga0395900_0069825 | 3300037418 | Bacteria | 3611 |
| 163 | Ga0395900_0092417 | 3300037418 | Bacteria | 3109 |
| 164 | Ga0395900_0178484 | 3300037418 | Bacteria | 2159 |
| 165 | Ga0395900_0180798 | 3300037418 | Bacteria | 2143 |
| 166 | Ga0395898_0019307 | 3300037466 | Bacteria | 6939 |
| 167 | Ga0395898_0032331 | 3300037466 | Bacteria | 5223 |
| 168 | Ga0395898_0096102 | 3300037466 | Bacteria | 2846 |
| 169 | Ga0395905_0014102 | 3300037471 | Bacteria | 7640 |
| 170 | Ga0395905_0678407 | 3300037471 | Bacteria | 933 |
| 171 | Ga0436364_0237930 | 3300037853 | Bacteria | 6384 |
| 172 | Ga0395901_0060397 | 3300038443 | Bacteria | 3945 |
| 173 | Ga0395901_0094566 | 3300038443 | Bacteria | 3131 |
| 174 | Ga0439466_0044310 | 3300041411 | Bacteria | 1474 |
| 175 | Ga0439465_0094107 | 3300041413 | Bacteria | 1028 |
| 176 | Ga0439433_0001596 | 3300041999 | Bacteria | 4710 |
| 177 | Ga0439442_000015 | 3300042002 | Bacteria | 47229 |
| 178 | Ga0439442_008439 | 3300042002 | Bacteria | 2080 |
| 179 | Ga0439442_020334 | 3300042002 | Bacteria | 1375 |
| 180 | Ga0439432_000007 | 3300042006 | Bacteria | 91974 |
| 181 | Ga0439449_0001350 | 3300042007 | Bacteria | 9620 |
| 182 | Ga0439449_0001886 | 3300042007 | Bacteria | 8259 |
| 183 | Ga0439449_0029152 | 3300042007 | Bacteria | 2056 |
| 184 | Ga0439457_002116 | 3300042014 | Bacteria | 5779 |
| 185 | Ga0439457_007959 | 3300042014 | Bacteria | 2519 |
| 186 | Ga0439462_0006507 | 3300042015 | Bacteria | 2905 |
| 187 | Ga0450919_001411 | 3300042121 | Bacteria | 3129 |
| 188 | Ga0450920_000208 | 3300042122 | Bacteria | 8651 |
| 189 | Ga0450920_000897 | 3300042122 | Bacteria | 4826 |
| 190 | Ga0450920_007899 | 3300042122 | Bacteria | 1935 |
| 191 | Ga0450907_000019 | 3300042146 | Bacteria | 75961 |
| 192 | Ga0439446_0152558 | 3300042156 | Bacteria | 760 |
| 193 | Ga0450909_000053 | 3300042185 | Bacteria | 9797 |
| 194 | Ga0439434_0000734 | 3300042435 | Bacteria | 9392 |
| 195 | Ga0450918_000306 | 3300042531 | Bacteria | 10970 |
| 196 | Ga0450918_000616 | 3300042531 | Bacteria | 7631 |
| 197 | Ga0466966_0128964 | 3300044684 | Bacteria | 1550 |
| 198 | Ga0466961_0091105 | 3300044693 | Bacteria | 1925 |
| 199 | Ga0466970_0187781 | 3300044765 | Bacteria | 1148 |
| 200 | Ga0495627_002745 | 3300046453 | Bacteria | 8197 |
| 201 | Ga0495591_013508 | 3300046458 | Bacteria | 2980 |
| 202 | Ga0495651_0096206 | 3300046462 | Bacteria | 2213 |
| 203 | Ga0495650_0006051 | 3300046471 | Bacteria | 7641 |
| 204 | Ga0495650_0009077 | 3300046471 | Bacteria | 5705 |
| 205 | Ga0495650_0035742 | 3300046471 | Bacteria | 2183 |
| 206 | Ga0495580_0004178 | 3300046472 | Bacteria | 12148 |
| 207 | Ga0495605_0000011 | 3300046474 | Bacteria | 314856 |
| 208 | Ga0495639_0000805 | 3300046475 | Bacteria | 14358 |
| 209 | Ga0495639_0290427 | 3300046475 | Bacteria | 814 |
| 210 | Ga0495594_0002490 | 3300046499 | Bacteria | 9595 |
| 211 | Ga0495583_0000047 | 3300046506 | Bacteria | 217720 |
| 212 | Ga0495616_0014574 | 3300046513 | Bacteria | 4396 |
| 213 | Ga0495620_0002437 | 3300046515 | Bacteria | 10773 |
| 214 | Ga0495631_0003278 | 3300046518 | Bacteria | 8898 |
| 215 | Ga0495637_0004421 | 3300046520 | Bacteria | 7294 |
| 216 | Ga0495648_0005555 | 3300046524 | Bacteria | 10458 |
| 217 | Ga0495642_0082438 | 3300046528 | Bacteria | 1356 |
| 218 | Ga0495642_0162598 | 3300046528 | Bacteria | 968 |
| 219 | Ga0495654_0000866 | 3300046530 | Bacteria | 22797 |
| 220 | Ga0495665_0017526 | 3300046531 | Bacteria | 3852 |
| 221 | Ga0495665_0156561 | 3300046531 | Bacteria | 1188 |
| 222 | Ga0495586_0007880 | 3300046535 | Bacteria | 5679 |
| 223 | Ga0495586_0009259 | 3300046535 | Bacteria | 5237 |
| 224 | Ga0495609_0000004 | 3300046538 | Bacteria | 697346 |
| 225 | Ga0495597_0001996 | 3300046542 | Bacteria | 13695 |
| 226 | Ga0495645_0172863 | 3300046543 | Bacteria | 1486 |
| 227 | Ga0495633_0000206 | 3300046558 | Bacteria | 74675 |
| 228 | Ga0495656_0064246 | 3300046615 | Bacteria | 1611 |
| 229 | Ga0495656_0336405 | 3300046615 | Bacteria | 780 |
| 230 | Ga0495668_0054424 | 3300046616 | Bacteria | 2212 |
| 231 | Ga0495611_0000327 | 3300046648 | Bacteria | 31335 |
| 232 | Ga0495661_0000005 | 3300046665 | Bacteria | 433622 |
| 233 | Ga0495588_0044965 | 3300046674 | Bacteria | 2262 |
| 234 | Ga0495588_0071006 | 3300046674 | Bacteria | 1810 |
| 235 | Ga0495669_0110309 | 3300046684 | Bacteria | 1284 |
| 236 | Ga0495670_0042463 | 3300046691 | Bacteria | 2268 |
| 237 | Ga0495670_0367347 | 3300046691 | Bacteria | 775 |
| 238 | Ga0495671_0024881 | 3300046692 | Bacteria | 3115 |
| 239 | Ga0495671_0457602 | 3300046692 | Bacteria | 610 |
| 240 | Ga0495589_0000470 | 3300046794 | Bacteria | 29417 |
| 241 | Ga0495600_0196782 | 3300046809 | Bacteria | 1295 |
| 242 | Ga0495600_0648904 | 3300046809 | Bacteria | 638 |
| 243 | Ga0495660_0004371 | 3300046810 | Bacteria | 8559 |
| 244 | Ga0495581_0039054 | 3300047315 | Bacteria | 2748 |
| 245 | Ga0495581_0238481 | 3300047315 | Bacteria | 1063 |
| 246 | Ga0495581_0296844 | 3300047315 | Bacteria | 944 |
| 247 | Ga0495581_0358235 | 3300047315 | Bacteria | 851 |
| 248 | Ga0495581_0672178 | 3300047315 | Bacteria | 598 |
| 249 | Ga0495683_0000031 | 3300047323 | Bacteria | 150363 |
| 250 | Ga0495677_0136000 | 3300047445 | Bacteria | 942 |
| 251 | Ga0495679_000154 | 3300047446 | Bacteria | 61634 |
| 252 | Ga0495673_0039382 | 3300047469 | Bacteria | 2144 |
| 253 | Ga0496100_0009704 | 3300048903 | Bacteria | 5416 |
| 254 | Ga0496101_0005979 | 3300048904 | Bacteria | 7801 |
| 255 | Ga0496102_0016544 | 3300048905 | Bacteria | 6445 |
| 256 | Ga0496102_0068541 | 3300048905 | Bacteria | 3255 |
| 257 | Ga0496102_0140217 | 3300048905 | Bacteria | 2266 |
| 258 | Ga0496102_0163634 | 3300048905 | Bacteria | 2093 |
| 259 | Ga0496102_0205125 | 3300048905 | Bacteria | 1858 |
| 260 | Ga0496102_0245084 | 3300048905 | Bacteria | 1689 |
| 261 | Ga0496103_0006684 | 3300048906 | Bacteria | 6881 |
| 262 | Ga0496103_0051225 | 3300048906 | Bacteria | 2555 |
| 263 | Ga0496103_0177012 | 3300048906 | Bacteria | 1370 |
| 264 | Ga0496105_0116629 | 3300048908 | Bacteria | 2202 |
| 265 | Ga0496106_0012051 | 3300048909 | Bacteria | 6379 |
| 266 | Ga0496106_0040977 | 3300048909 | Bacteria | 3469 |
| 267 | Ga0496106_0250957 | 3300048909 | Bacteria | 1414 |
| 268 | Ga0496107_0008545 | 3300048910 | Bacteria | 7086 |
| 269 | Ga0496107_0020896 | 3300048910 | Bacteria | 4627 |
| 270 | Ga0496107_0379676 | 3300048910 | Bacteria | 1051 |
| 271 | Ga0496109_0435052 | 3300048912 | Bacteria | 1239 |
| 272 | Ga0496110_0016941 | 3300048913 | Bacteria | 6091 |
| 273 | Ga0496110_0204531 | 3300048913 | Bacteria | 1794 |
| 274 | Ga0496110_0854997 | 3300048913 | Bacteria | 815 |
| 275 | Ga0496111_0105832 | 3300048914 | Bacteria | 2070 |
| 276 | Ga0496111_0233988 | 3300048914 | Bacteria | 1364 |
| 277 | Ga0496112_0066784 | 3300048915 | Bacteria | 3549 |
| 278 | Ga0496113_0092502 | 3300048916 | Bacteria | 2333 |
| 279 | Ga0496113_0404870 | 3300048916 | Bacteria | 1095 |
| 280 | Ga0496113_0916114 | 3300048916 | Bacteria | 693 |
| 281 | Ga0496114_0197890 | 3300048917 | Bacteria | 1759 |
| 282 | Ga0496122_0028113 | 3300048925 | Bacteria | 4784 |
| 283 | Ga0496124_0287487 | 3300048927 | Bacteria | 1195 |
| 284 | Ga0495678_000186 | 3300049459 | Bacteria | 72357 |
| 285 | Ga0501316_014015 | 3300049532 | Bacteria | 952 |
| 286 | Ga0501318_013920 | 3300049534 | Bacteria | 943 |
| 287 | Ga0501321_034132 | 3300049537 | Bacteria | 692 |
| 288 | Ga0501325_005990 | 3300049541 | Bacteria | 984 |
| 289 | Ga0501032_0001886 | 3300049569 | Bacteria | 16563 |
| 290 | Ga0501032_0167373 | 3300049569 | Bacteria | 1442 |
| 291 | Ga0501034_0000729 | 3300049571 | Bacteria | 49757 |
| 292 | Ga0501036_0319052 | 3300049572 | Bacteria | 1298 |
| 293 | Ga0501037_0019532 | 3300049573 | Bacteria | 4999 |
| 294 | Ga0501037_0566574 | 3300049573 | Bacteria | 765 |
| 295 | Ga0501038_0245052 | 3300049574 | Bacteria | 1421 |
| 296 | Ga0501038_0804398 | 3300049574 | Bacteria | 698 |
| 297 | Ga0501039_0140846 | 3300049575 | Bacteria | 1894 |
| 298 | Ga0501039_0444009 | 3300049575 | Bacteria | 1019 |
| 299 | Ga0501041_0291841 | 3300049577 | Bacteria | 1027 |
| 300 | Ga0501043_0253679 | 3300049579 | Bacteria | 1354 |
| 301 | Ga0501043_0599917 | 3300049579 | Bacteria | 813 |
| 302 | Ga0501047_0295811 | 3300049581 | Bacteria | 1462 |
| 303 | Ga0501048_0580856 | 3300049582 | Bacteria | 804 |
| 304 | Ga0501069_0186355 | 3300049585 | Bacteria | 1200 |
| 305 | Ga0501070_0035675 | 3300049586 | Bacteria | 4154 |
| 306 | Ga0501071_0004948 | 3300049587 | Bacteria | 8511 |
| 307 | Ga0501071_0221975 | 3300049587 | Bacteria | 1422 |
| 308 | Ga0501073_0093029 | 3300049589 | Bacteria | 2095 |
| 309 | Ga0501076_0382864 | 3300049592 | Bacteria | 1156 |
| 310 | Ga0501202_014015 | 3300049652 | Bacteria | 1531 |
| 311 | Ga0501227_022409 | 3300049665 | Bacteria | 1462 |
| 312 | Ga0501080_0422336 | 3300049742 | Bacteria | 1198 |
| 313 | Ga0501035_0493085 | 3300049822 | Bacteria | 1009 |
| 314 | Ga0501044_0155209 | 3300049823 | Bacteria | 2269 |
| 315 | Ga0501044_0850679 | 3300049823 | Bacteria | 789 |
| 316 | Ga0501212_006387 | 3300049851 | Bacteria | 1589 |
| 317 | Ga0500618_017764 | 3300053125 | Bacteria | 1766 |
| 318 | Ga0587090_003082 | 3300059510 | Bacteria | 1900 |
| 319 | Ga0587072_009493 | 3300059643 | Bacteria | 1556 |
| 320 | Ga0530510_0097648 | 3300061734 | Bacteria | 2148 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046528 | Ga0495642_0082438 | Ga0495642_0082438_447_974 | 175 |
| 2 | 3300047315 | Ga0495581_0672178 | Ga0495581_0672178_27_554 | 175 |
| 3 | 3300009148 | Ga0105243_10231020 | Ga0105243_102310202 | 176 |
| 4 | 3300046692 | Ga0495671_0457602 | Ga0495671_0457602_12_542 | 176 |
| 5 | 3300046809 | Ga0495600_0648904 | Ga0495600_0648904_74_604 | 176 |
| 6 | 3300047315 | Ga0495581_0296844 | Ga0495581_0296844_398_928 | 176 |
| 7 | 3300047445 | Ga0495677_0136000 | Ga0495677_0136000_352_882 | 176 |
| 8 | 3300048913 | Ga0496110_0854997 | Ga0496110_0854997_234_764 | 176 |
| 9 | 3300037418 | Ga0395900_0180798 | Ga0395900_0180798_24_572 | 182 |
| 10 | 3300049581 | Ga0501047_0295811 | Ga0501047_0295811_116_685 | 188 |
| 11 | 3300049822 | Ga0501035_0493085 | Ga0501035_0493085_204_773 | 188 |
| 12 | 3300049823 | Ga0501044_0155209 | Ga0501044_0155209_152_721 | 188 |
| 13 | 3300025942 | Ga0207689_10641148 | Ga0207689_106411481 | 189 |
| 14 | 3300049823 | Ga0501044_0850679 | Ga0501044_0850679_141_713 | 189 |
| 15 | 3300013100 | Ga0157373_10018369 | Ga0157373_100183694 | 190 |
| 16 | 3300048905 | Ga0496102_0205125 | Ga0496102_0205125_656_1261 | 190 |
| 17 | 3300048906 | Ga0496103_0177012 | Ga0496103_0177012_718_1323 | 190 |
| 18 | 3300048909 | Ga0496106_0250957 | Ga0496106_0250957_323_928 | 190 |
| 19 | 3300048914 | Ga0496111_0233988 | Ga0496111_0233988_683_1288 | 190 |
| 20 | iso_pu_bacteria | 2808606371 | 2808898495 | 190 |
| 21 | iso_pu_bacteria | 2811994882 | 2812372980 | 191 |
| 22 | iso_pu_bacteria | 2818991458 | 2819664834 | 191 |
| 23 | iso_pu_bacteria | 2818991462 | 2819689509 | 191 |
| 24 | iso_pu_bacteria | 2818991469 | 2819726947 | 191 |
| 25 | 3300031731 | Ga0307405_10024257 | Ga0307405_100242574 | 193 |
| 26 | 3300049574 | Ga0501038_0804398 | Ga0501038_0804398_78_659 | 193 |
| 27 | 3300049575 | Ga0501039_0444009 | Ga0501039_0444009_402_983 | 193 |
| 28 | 3300049577 | Ga0501041_0291841 | Ga0501041_0291841_391_972 | 193 |
| 29 | 3300049582 | Ga0501048_0580856 | Ga0501048_0580856_47_628 | 193 |
| 30 | 3300049587 | Ga0501071_0221975 | Ga0501071_0221975_674_1255 | 193 |
| 31 | 3300049592 | Ga0501076_0382864 | Ga0501076_0382864_533_1114 | 193 |
| 32 | 3300049742 | Ga0501080_0422336 | Ga0501080_0422336_598_1179 | 193 |
| 33 | 3300061734 | Ga0530510_0097648 | Ga0530510_0097648_204_785 | 193 |
| 34 | iso_pu_bacteria | 2554235227 | 2555229522 | 193 |
| 35 | iso_pu_bacteria | 2654587600 | 2655031543 | 193 |
| 36 | iso_pu_bacteria | 2939598168 | 2939601692 | 193 |
| 37 | 3300032004 | Ga0307414_10111334 | Ga0307414_101113342 | 194 |
| 38 | 3300046462 | Ga0495651_0096206 | Ga0495651_0096206_110_694 | 194 |
| 39 | 3300046531 | Ga0495665_0017526 | Ga0495665_0017526_45_632 | 194 |
| 40 | 3300046615 | Ga0495656_0336405 | Ga0495656_0336405_44_631 | 194 |
| 41 | 3300046684 | Ga0495669_0110309 | Ga0495669_0110309_668_1255 | 194 |
| 42 | 3300046809 | Ga0495600_0196782 | Ga0495600_0196782_420_1004 | 194 |
| 43 | 3300049652 | Ga0501202_014015 | Ga0501202_014015_631_1215 | 194 |
| 44 | 3300049851 | Ga0501212_006387 | Ga0501212_006387_584_1168 | 194 |
| 45 | 3300053125 | Ga0500618_017764 | Ga0500618_017764_1106_1732 | 194 |
| 46 | iso_pu_bacteria | 2844849076 | 2844850896 | 194 |
| 47 | iso_pu_bacteria | 2919391150 | 2919392609 | 194 |
| 48 | iso_pu_bacteria | 2945956166 | 2945956410 | 194 |
| 49 | 3300005334 | Ga0068869_100361100 | Ga0068869_1003611002 | 195 |
| 50 | 3300005577 | Ga0068857_100723088 | Ga0068857_1007230881 | 195 |
| 51 | 3300031852 | Ga0307410_10434457 | Ga0307410_104344571 | 195 |
| 52 | 3300031995 | Ga0307409_100282589 | Ga0307409_1002825892 | 195 |
| 53 | 3300048912 | Ga0496109_0435052 | Ga0496109_0435052_449_1036 | 195 |
| 54 | 3300048913 | Ga0496110_0204531 | Ga0496110_0204531_902_1489 | 195 |
| 55 | 3300048916 | Ga0496113_0092502 | Ga0496113_0092502_954_1541 | 195 |
| 56 | iso_pu_bacteria | 2857740372 | 2857743520 | 195 |
| 57 | iso_pu_bacteria | 2904497146 | 2904498699 | 195 |
| 58 | iso_pu_bacteria | 2904776348 | 2904779521 | 195 |
| 59 | iso_pu_bacteria | 2910809715 | 2910811283 | 195 |
| 60 | iso_pu_bacteria | 2919034639 | 2919036970 | 195 |
| 61 | iso_pu_bacteria | 2919538618 | 2919541732 | 195 |
| 62 | iso_pu_bacteria | 2932426870 | 2932429494 | 195 |
| 63 | iso_pu_bacteria | 2933418574 | 2933420534 | 195 |
| 64 | iso_pu_bacteria | 2939674588 | 2939678004 | 195 |
| 65 | 3300049579 | Ga0501043_0599917 | Ga0501043_0599917_190_792 | 196 |
| 66 | 3300049585 | Ga0501069_0186355 | Ga0501069_0186355_207_809 | 196 |
| 67 | 3300049586 | Ga0501070_0035675 | Ga0501070_0035675_889_1491 | 196 |
| 68 | 3300049587 | Ga0501071_0004948 | Ga0501071_0004948_633_1235 | 196 |
| 69 | iso_pu_bacteria | 2537561592 | 2537900049 | 196 |
| 70 | iso_pu_bacteria | 2739367653 | 2739603163 | 196 |
| 71 | iso_pu_bacteria | 2808606370 | 2808893438 | 196 |
| 72 | iso_pu_bacteria | 2816332305 | 2817508309 | 196 |
| 73 | iso_pu_bacteria | 2857727296 | 2857729049 | 196 |
| 74 | iso_pu_bacteria | 2953998280 | 2954002574 | 196 |
| 75 | 3300031911 | Ga0307412_10141024 | Ga0307412_101410241 | 197 |
| 76 | 3300038443 | Ga0395901_0060397 | Ga0395901_0060397_2343_2996 | 197 |
| 77 | iso_pu_bacteria | 2690315906 | 2691512031 | 197 |
| 78 | iso_pu_bacteria | 2919059106 | 2919062717 | 197 |
| 79 | iso_pu_bacteria | 2939647034 | 2939649618 | 197 |
| 80 | iso_pu_bacteria | 2945941187 | 2945945218 | 197 |
| 81 | iso_pu_bacteria | 8054107350 | 8054110480 | 197 |
| 82 | 3300002773 | JGI25152J39213_1000068 | JGI25152J39213_100006836 | 198 |
| 83 | 3300005471 | Ga0070698_100414900 | Ga0070698_1004149001 | 198 |
| 84 | 3300009148 | Ga0105243_10020204 | Ga0105243_100202047 | 198 |
| 85 | 3300011119 | Ga0105246_10005402 | Ga0105246_100054023 | 198 |
| 86 | 3300011119 | Ga0105246_10047565 | Ga0105246_100475651 | 198 |
| 87 | 3300025258 | Ga0209129_1000052 | Ga0209129_1000052119 | 198 |
| 88 | 3300025294 | Ga0209025_1000895 | Ga0209025_100089534 | 198 |
| 89 | 3300025303 | Ga0209051_1010793 | Ga0209051_10107934 | 198 |
| 90 | 3300025925 | Ga0207650_10092248 | Ga0207650_100922482 | 198 |
| 91 | 3300027907 | Ga0207428_10002801 | Ga0207428_1000280111 | 198 |
| 92 | 3300031548 | Ga0307408_100032579 | Ga0307408_1000325794 | 198 |
| 93 | 3300031548 | Ga0307408_100099133 | Ga0307408_1000991333 | 198 |
| 94 | 3300031548 | Ga0307408_100163705 | Ga0307408_1001637052 | 198 |
| 95 | 3300031731 | Ga0307405_10663010 | Ga0307405_106630102 | 198 |
| 96 | 3300031824 | Ga0307413_10057697 | Ga0307413_100576975 | 198 |
| 97 | 3300031852 | Ga0307410_10089115 | Ga0307410_100891153 | 198 |
| 98 | 3300031901 | Ga0307406_10096161 | Ga0307406_100961613 | 198 |
| 99 | 3300031901 | Ga0307406_10152720 | Ga0307406_101527203 | 198 |
| 100 | 3300031903 | Ga0307407_10008342 | Ga0307407_100083423 | 198 |
| 101 | 3300031903 | Ga0307407_10039400 | Ga0307407_100394002 | 198 |
| 102 | 3300031903 | Ga0307407_10083781 | Ga0307407_100837811 | 198 |
| 103 | 3300031911 | Ga0307412_10053137 | Ga0307412_100531372 | 198 |
| 104 | 3300031995 | Ga0307409_100090194 | Ga0307409_1000901944 | 198 |
| 105 | 3300032002 | Ga0307416_100035319 | Ga0307416_1000353193 | 198 |
| 106 | 3300032002 | Ga0307416_100137501 | Ga0307416_1001375013 | 198 |
| 107 | 3300032002 | Ga0307416_100447371 | Ga0307416_1004473711 | 198 |
| 108 | 3300032004 | Ga0307414_10202936 | Ga0307414_102029362 | 198 |
| 109 | 3300032005 | Ga0307411_10073979 | Ga0307411_100739793 | 198 |
| 110 | 3300032126 | Ga0307415_100042176 | Ga0307415_1000421762 | 198 |
| 111 | 3300037312 | Ga0395899_0109771 | Ga0395899_0109771_433_1029 | 198 |
| 112 | 3300037418 | Ga0395900_0178484 | Ga0395900_0178484_1119_1715 | 198 |
| 113 | 3300037471 | Ga0395905_0678407 | Ga0395905_0678407_79_675 | 198 |
| 114 | 3300041411 | Ga0439466_0044310 | Ga0439466_0044310_237_833 | 198 |
| 115 | 3300042007 | Ga0439449_0001886 | Ga0439449_0001886_7267_7863 | 198 |
| 116 | 3300042014 | Ga0439457_007959 | Ga0439457_007959_632_1228 | 198 |
| 117 | 3300042122 | Ga0450920_007899 | Ga0450920_007899_1159_1755 | 198 |
| 118 | 3300048905 | Ga0496102_0068541 | Ga0496102_0068541_639_1235 | 198 |
| 119 | 3300048906 | Ga0496103_0006684 | Ga0496103_0006684_905_1501 | 198 |
| 120 | 3300048910 | Ga0496107_0379676 | Ga0496107_0379676_338_934 | 198 |
| 121 | 3300049532 | Ga0501316_014015 | Ga0501316_014015_250_846 | 198 |
| 122 | 3300049537 | Ga0501321_034132 | Ga0501321_034132_67_663 | 198 |
| 123 | 3300049569 | Ga0501032_0167373 | Ga0501032_0167373_677_1273 | 198 |
| 124 | 3300049579 | Ga0501043_0253679 | Ga0501043_0253679_446_1042 | 198 |
| 125 | 3300059510 | Ga0587090_003082 | Ga0587090_003082_593_1189 | 198 |
| 126 | 3300059643 | Ga0587072_009493 | Ga0587072_009493_677_1273 | 198 |
| 127 | 3300005333 | Ga0070677_10008450 | Ga0070677_100084504 | 199 |
| 128 | 3300005456 | Ga0070678_100229362 | Ga0070678_1002293621 | 199 |
| 129 | 3300009036 | Ga0105244_10005014 | Ga0105244_100050145 | 199 |
| 130 | 3300011119 | Ga0105246_10013655 | Ga0105246_100136555 | 199 |
| 131 | 3300025303 | Ga0209051_1003833 | Ga0209051_10038339 | 199 |
| 132 | 3300025728 | Ga0207655_1001478 | Ga0207655_100147811 | 199 |
| 133 | 3300025893 | Ga0207682_10028646 | Ga0207682_100286462 | 199 |
| 134 | 3300026121 | Ga0207683_10123457 | Ga0207683_101234572 | 199 |
| 135 | 3300031548 | Ga0307408_100051525 | Ga0307408_1000515252 | 199 |
| 136 | 3300031824 | Ga0307413_10111352 | Ga0307413_101113521 | 199 |
| 137 | 3300031852 | Ga0307410_10078966 | Ga0307410_100789661 | 199 |
| 138 | 3300031903 | Ga0307407_10053958 | Ga0307407_100539582 | 199 |
| 139 | 3300031911 | Ga0307412_10006724 | Ga0307412_100067242 | 199 |
| 140 | 3300031995 | Ga0307409_100096345 | Ga0307409_1000963451 | 199 |
| 141 | 3300032002 | Ga0307416_100768383 | Ga0307416_1007683831 | 199 |
| 142 | iso_pu_bacteria | 2945920336 | 2945922915 | 199 |
| 143 | iso_pu_bacteria | 2946037020 | 2946041392 | 199 |
| 144 | 3300013100 | Ga0157373_10005428 | Ga0157373_1000542813 | 200 |
| 145 | 3300013296 | Ga0157374_10054864 | Ga0157374_100548644 | 200 |
| 146 | 3300025256 | Ga0209759_1013799 | Ga0209759_10137993 | 200 |
| 147 | 3300025907 | Ga0207645_10543279 | Ga0207645_105432791 | 200 |
| 148 | 3300031548 | Ga0307408_100041586 | Ga0307408_1000415862 | 200 |
| 149 | 3300031731 | Ga0307405_10003780 | Ga0307405_100037805 | 200 |
| 150 | 3300031824 | Ga0307413_10047681 | Ga0307413_100476812 | 200 |
| 151 | 3300031824 | Ga0307413_10200199 | Ga0307413_102001991 | 200 |
| 152 | 3300031852 | Ga0307410_10011221 | Ga0307410_100112213 | 200 |
| 153 | 3300031903 | Ga0307407_10000695 | Ga0307407_100006958 | 200 |
| 154 | 3300031995 | Ga0307409_100035854 | Ga0307409_1000358542 | 200 |
| 155 | 3300031995 | Ga0307409_100204795 | Ga0307409_1002047953 | 200 |
| 156 | 3300031995 | Ga0307409_100257239 | Ga0307409_1002572393 | 200 |
| 157 | 3300032002 | Ga0307416_100002767 | Ga0307416_1000027673 | 200 |
| 158 | 3300032002 | Ga0307416_100138434 | Ga0307416_1001384341 | 200 |
| 159 | 3300032002 | Ga0307416_100422336 | Ga0307416_1004223362 | 200 |
| 160 | 3300032004 | Ga0307414_10032809 | Ga0307414_100328092 | 200 |
| 161 | 3300032126 | Ga0307415_100226940 | Ga0307415_1002269401 | 200 |
| 162 | 3300037312 | Ga0395899_0084977 | Ga0395899_0084977_1115_1738 | 200 |
| 163 | 3300037312 | Ga0395899_0385246 | Ga0395899_0385246_206_829 | 200 |
| 164 | 3300037418 | Ga0395900_0092417 | Ga0395900_0092417_1849_2472 | 200 |
| 165 | 3300037466 | Ga0395898_0019307 | Ga0395898_0019307_4039_4662 | 200 |
| 166 | 3300037466 | Ga0395898_0096102 | Ga0395898_0096102_1955_2578 | 200 |
| 167 | 3300037471 | Ga0395905_0014102 | Ga0395905_0014102_1592_2215 | 200 |
| 168 | 3300038443 | Ga0395901_0094566 | Ga0395901_0094566_519_1142 | 200 |
| 169 | 3300042121 | Ga0450919_001411 | Ga0450919_001411_1735_2337 | 200 |
| 170 | 3300042122 | Ga0450920_000897 | Ga0450920_000897_760_1362 | 200 |
| 171 | 3300042185 | Ga0450909_000053 | Ga0450909_000053_6859_7461 | 200 |
| 172 | 3300042531 | Ga0450918_000616 | Ga0450918_000616_2041_2643 | 200 |
| 173 | 3300044684 | Ga0466966_0128964 | Ga0466966_0128964_42_671 | 200 |
| 174 | 3300044693 | Ga0466961_0091105 | Ga0466961_0091105_143_766 | 200 |
| 175 | 3300044765 | Ga0466970_0187781 | Ga0466970_0187781_152_775 | 200 |
| 176 | 3300046543 | Ga0495645_0172863 | Ga0495645_0172863_345_947 | 200 |
| 177 | 3300048905 | Ga0496102_0163634 | Ga0496102_0163634_1175_1777 | 200 |
| 178 | 3300048906 | Ga0496103_0051225 | Ga0496103_0051225_275_877 | 200 |
| 179 | 3300048915 | Ga0496112_0066784 | Ga0496112_0066784_1274_1876 | 200 |
| 180 | 3300049534 | Ga0501318_013920 | Ga0501318_013920_303_905 | 200 |
| 181 | 3300049569 | Ga0501032_0001886 | Ga0501032_0001886_1500_2102 | 200 |
| 182 | 3300049571 | Ga0501034_0000729 | Ga0501034_0000729_14926_15528 | 200 |
| 183 | 3300049573 | Ga0501037_0566574 | Ga0501037_0566574_90_692 | 200 |
| 184 | 3300000549 | LJQas_1000118 | LJQas_10001187 | 201 |
| 185 | 3300000549 | LJQas_1008819 | LJQas_10088191 | 201 |
| 186 | 3300003322 | rootL2_10009515 | rootL2_1000951511 | 201 |
| 187 | 3300005288 | Ga0065714_10146872 | Ga0065714_101468722 | 201 |
| 188 | 3300005288 | Ga0065714_10154921 | Ga0065714_101549211 | 201 |
| 189 | 3300005288 | Ga0065714_10199656 | Ga0065714_101996561 | 201 |
| 190 | 3300005328 | Ga0070676_10008684 | Ga0070676_100086847 | 201 |
| 191 | 3300005331 | Ga0070670_100562748 | Ga0070670_1005627482 | 201 |
| 192 | 3300005333 | Ga0070677_10023276 | Ga0070677_100232763 | 201 |
| 193 | 3300005347 | Ga0070668_100035867 | Ga0070668_1000358676 | 201 |
| 194 | 3300005353 | Ga0070669_100036231 | Ga0070669_1000362314 | 201 |
| 195 | 3300005355 | Ga0070671_100373180 | Ga0070671_1003731802 | 201 |
| 196 | 3300005356 | Ga0070674_100063267 | Ga0070674_1000632673 | 201 |
| 197 | 3300005356 | Ga0070674_101310020 | Ga0070674_1013100201 | 201 |
| 198 | 3300005364 | Ga0070673_100094019 | Ga0070673_1000940195 | 201 |
| 199 | 3300005367 | Ga0070667_100015211 | Ga0070667_1000152117 | 201 |
| 200 | 3300005543 | Ga0070672_100047202 | Ga0070672_1000472023 | 201 |
| 201 | 3300005840 | Ga0068870_10344626 | Ga0068870_103446262 | 201 |
| 202 | 3300005842 | Ga0068858_101324047 | Ga0068858_1013240471 | 201 |
| 203 | 3300006058 | Ga0075432_10001869 | Ga0075432_100018694 | 201 |
| 204 | 3300009011 | Ga0105251_10005213 | Ga0105251_100052137 | 201 |
| 205 | 3300009036 | Ga0105244_10034930 | Ga0105244_100349303 | 201 |
| 206 | 3300009148 | Ga0105243_10282161 | Ga0105243_102821612 | 201 |
| 207 | 3300009176 | Ga0105242_10477548 | Ga0105242_104775482 | 201 |
| 208 | 3300009176 | Ga0105242_10559040 | Ga0105242_105590401 | 201 |
| 209 | 3300009177 | Ga0105248_10105559 | Ga0105248_101055591 | 201 |
| 210 | 3300011119 | Ga0105246_10050388 | Ga0105246_100503882 | 201 |
| 211 | 3300011119 | Ga0105246_10099975 | Ga0105246_100999752 | 201 |
| 212 | 3300013100 | Ga0157373_10329781 | Ga0157373_103297812 | 201 |
| 213 | 3300013105 | Ga0157369_10096837 | Ga0157369_100968375 | 201 |
| 214 | 3300013306 | Ga0163162_10064632 | Ga0163162_100646322 | 201 |
| 215 | 3300014326 | Ga0157380_10720072 | Ga0157380_107200721 | 201 |
| 216 | 3300025292 | Ga0209676_1000935 | Ga0209676_100093527 | 201 |
| 217 | 3300025315 | Ga0207697_10001390 | Ga0207697_100013907 | 201 |
| 218 | 3300025728 | Ga0207655_1021562 | Ga0207655_10215621 | 201 |
| 219 | 3300025893 | Ga0207682_10001521 | Ga0207682_100015218 | 201 |
| 220 | 3300025907 | Ga0207645_10000379 | Ga0207645_1000037912 | 201 |
| 221 | 3300025923 | Ga0207681_10039037 | Ga0207681_100390371 | 201 |
| 222 | 3300025925 | Ga0207650_10087474 | Ga0207650_100874742 | 201 |
| 223 | 3300025927 | Ga0207687_10050692 | Ga0207687_100506924 | 201 |
| 224 | 3300025931 | Ga0207644_10063878 | Ga0207644_100638781 | 201 |
| 225 | 3300025935 | Ga0207709_10129994 | Ga0207709_101299941 | 201 |
| 226 | 3300025937 | Ga0207669_10020333 | Ga0207669_100203331 | 201 |
| 227 | 3300025940 | Ga0207691_10007811 | Ga0207691_100078112 | 201 |
| 228 | 3300025960 | Ga0207651_10007903 | Ga0207651_100079031 | 201 |
| 229 | 3300025972 | Ga0207668_10302039 | Ga0207668_103020391 | 201 |
| 230 | 3300026035 | Ga0207703_10937119 | Ga0207703_109371192 | 201 |
| 231 | 3300027907 | Ga0207428_10176973 | Ga0207428_101769731 | 201 |
| 232 | 3300031251 | Ga0265327_10000001 | Ga0265327_10000001244 | 201 |
| 233 | 3300031548 | Ga0307408_100006145 | Ga0307408_1000061453 | 201 |
| 234 | 3300031548 | Ga0307408_100101630 | Ga0307408_1001016302 | 201 |
| 235 | 3300031548 | Ga0307408_100120758 | Ga0307408_1001207582 | 201 |
| 236 | 3300031548 | Ga0307408_100561222 | Ga0307408_1005612221 | 201 |
| 237 | 3300031731 | Ga0307405_10001135 | Ga0307405_100011356 | 201 |
| 238 | 3300031731 | Ga0307405_10209669 | Ga0307405_102096691 | 201 |
| 239 | 3300031731 | Ga0307405_10446464 | Ga0307405_104464642 | 201 |
| 240 | 3300031731 | Ga0307405_10524958 | Ga0307405_105249582 | 201 |
| 241 | 3300031824 | Ga0307413_10019414 | Ga0307413_100194141 | 201 |
| 242 | 3300031824 | Ga0307413_10041870 | Ga0307413_100418703 | 201 |
| 243 | 3300031824 | Ga0307413_10061905 | Ga0307413_100619053 | 201 |
| 244 | 3300031852 | Ga0307410_10004116 | Ga0307410_100041163 | 201 |
| 245 | 3300031852 | Ga0307410_10023337 | Ga0307410_100233372 | 201 |
| 246 | 3300031852 | Ga0307410_10041449 | Ga0307410_100414491 | 201 |
| 247 | 3300031852 | Ga0307410_10082042 | Ga0307410_100820422 | 201 |
| 248 | 3300031852 | Ga0307410_10312967 | Ga0307410_103129672 | 201 |
| 249 | 3300031852 | Ga0307410_10438925 | Ga0307410_104389252 | 201 |
| 250 | 3300031901 | Ga0307406_10122684 | Ga0307406_101226842 | 201 |
| 251 | 3300031903 | Ga0307407_10013899 | Ga0307407_100138994 | 201 |
| 252 | 3300031903 | Ga0307407_10016097 | Ga0307407_100160971 | 201 |
| 253 | 3300031911 | Ga0307412_10000535 | Ga0307412_1000053517 | 201 |
| 254 | 3300031911 | Ga0307412_10010487 | Ga0307412_100104876 | 201 |
| 255 | 3300031911 | Ga0307412_10018632 | Ga0307412_100186326 | 201 |
| 256 | 3300031995 | Ga0307409_100072886 | Ga0307409_1000728864 | 201 |
| 257 | 3300031995 | Ga0307409_100082556 | Ga0307409_1000825562 | 201 |
| 258 | 3300031995 | Ga0307409_100590105 | Ga0307409_1005901051 | 201 |
| 259 | 3300032002 | Ga0307416_100020995 | Ga0307416_1000209953 | 201 |
| 260 | 3300032002 | Ga0307416_100044722 | Ga0307416_1000447224 | 201 |
| 261 | 3300032002 | Ga0307416_100063634 | Ga0307416_1000636344 | 201 |
| 262 | 3300032002 | Ga0307416_100072053 | Ga0307416_1000720535 | 201 |
| 263 | 3300032002 | Ga0307416_100142288 | Ga0307416_1001422883 | 201 |
| 264 | 3300032004 | Ga0307414_10011224 | Ga0307414_100112245 | 201 |
| 265 | 3300032004 | Ga0307414_10115519 | Ga0307414_101155191 | 201 |
| 266 | 3300032005 | Ga0307411_10001115 | Ga0307411_100011154 | 201 |
| 267 | 3300032005 | Ga0307411_10286670 | Ga0307411_102866701 | 201 |
| 268 | 3300032126 | Ga0307415_100070089 | Ga0307415_1000700894 | 201 |
| 269 | 3300032126 | Ga0307415_100105642 | Ga0307415_1001056422 | 201 |
| 270 | 3300037418 | Ga0395900_0069825 | Ga0395900_0069825_2962_3579 | 201 |
| 271 | 3300037466 | Ga0395898_0032331 | Ga0395898_0032331_304_921 | 201 |
| 272 | 3300037853 | Ga0436364_0237930 | Ga0436364_0237930_3057_3680 | 201 |
| 273 | 3300041413 | Ga0439465_0094107 | Ga0439465_0094107_404_1018 | 201 |
| 274 | 3300041999 | Ga0439433_0001596 | Ga0439433_0001596_781_1392 | 201 |
| 275 | 3300042002 | Ga0439442_000015 | Ga0439442_000015_18639_19253 | 201 |
| 276 | 3300042002 | Ga0439442_008439 | Ga0439442_008439_628_1239 | 201 |
| 277 | 3300042002 | Ga0439442_020334 | Ga0439442_020334_323_937 | 201 |
| 278 | 3300042006 | Ga0439432_000007 | Ga0439432_000007_79161_79841 | 201 |
| 279 | 3300042007 | Ga0439449_0001350 | Ga0439449_0001350_384_995 | 201 |
| 280 | 3300042007 | Ga0439449_0029152 | Ga0439449_0029152_903_1517 | 201 |
| 281 | 3300042014 | Ga0439457_002116 | Ga0439457_002116_3276_3887 | 201 |
| 282 | 3300042015 | Ga0439462_0006507 | Ga0439462_0006507_2234_2845 | 201 |
| 283 | 3300042122 | Ga0450920_000208 | Ga0450920_000208_7240_7854 | 201 |
| 284 | 3300042146 | Ga0450907_000019 | Ga0450907_000019_16352_16966 | 201 |
| 285 | 3300042156 | Ga0439446_0152558 | Ga0439446_0152558_78_692 | 201 |
| 286 | 3300042435 | Ga0439434_0000734 | Ga0439434_0000734_2627_3241 | 201 |
| 287 | 3300042531 | Ga0450918_000306 | Ga0450918_000306_7334_7948 | 201 |
| 288 | 3300046453 | Ga0495627_002745 | Ga0495627_002745_3491_4162 | 201 |
| 289 | 3300046458 | Ga0495591_013508 | Ga0495591_013508_1810_2481 | 201 |
| 290 | 3300046471 | Ga0495650_0006051 | Ga0495650_0006051_6805_7476 | 201 |
| 291 | 3300046471 | Ga0495650_0009077 | Ga0495650_0009077_4407_5060 | 201 |
| 292 | 3300046471 | Ga0495650_0035742 | Ga0495650_0035742_673_1293 | 201 |
| 293 | 3300046472 | Ga0495580_0004178 | Ga0495580_0004178_25_630 | 201 |
| 294 | 3300046474 | Ga0495605_0000011 | Ga0495605_0000011_144448_145119 | 201 |
| 295 | 3300046475 | Ga0495639_0000805 | Ga0495639_0000805_1701_2306 | 201 |
| 296 | 3300046475 | Ga0495639_0290427 | Ga0495639_0290427_194_799 | 201 |
| 297 | 3300046499 | Ga0495594_0002490 | Ga0495594_0002490_6065_6736 | 201 |
| 298 | 3300046506 | Ga0495583_0000047 | Ga0495583_0000047_169302_169973 | 201 |
| 299 | 3300046513 | Ga0495616_0014574 | Ga0495616_0014574_2167_2838 | 201 |
| 300 | 3300046515 | Ga0495620_0002437 | Ga0495620_0002437_4375_5046 | 201 |
| 301 | 3300046518 | Ga0495631_0003278 | Ga0495631_0003278_4245_4916 | 201 |
| 302 | 3300046520 | Ga0495637_0004421 | Ga0495637_0004421_2119_2790 | 201 |
| 303 | 3300046524 | Ga0495648_0005555 | Ga0495648_0005555_3768_4439 | 201 |
| 304 | 3300046528 | Ga0495642_0162598 | Ga0495642_0162598_353_958 | 201 |
| 305 | 3300046530 | Ga0495654_0000866 | Ga0495654_0000866_428_1099 | 201 |
| 306 | 3300046531 | Ga0495665_0156561 | Ga0495665_0156561_377_982 | 201 |
| 307 | 3300046535 | Ga0495586_0007880 | Ga0495586_0007880_1042_1647 | 201 |
| 308 | 3300046535 | Ga0495586_0009259 | Ga0495586_0009259_805_1410 | 201 |
| 309 | 3300046538 | Ga0495609_0000004 | Ga0495609_0000004_531688_532359 | 201 |
| 310 | 3300046542 | Ga0495597_0001996 | Ga0495597_0001996_7005_7676 | 201 |
| 311 | 3300046558 | Ga0495633_0000206 | Ga0495633_0000206_46937_47608 | 201 |
| 312 | 3300046615 | Ga0495656_0064246 | Ga0495656_0064246_467_1072 | 201 |
| 313 | 3300046616 | Ga0495668_0054424 | Ga0495668_0054424_130_735 | 201 |
| 314 | 3300046648 | Ga0495611_0000327 | Ga0495611_0000327_11649_12320 | 201 |
| 315 | 3300046665 | Ga0495661_0000005 | Ga0495661_0000005_176139_176810 | 201 |
| 316 | 3300046674 | Ga0495588_0044965 | Ga0495588_0044965_406_1011 | 201 |
| 317 | 3300046674 | Ga0495588_0071006 | Ga0495588_0071006_1124_1729 | 201 |
| 318 | 3300046691 | Ga0495670_0042463 | Ga0495670_0042463_824_1495 | 201 |
| 319 | 3300046691 | Ga0495670_0367347 | Ga0495670_0367347_78_683 | 201 |
| 320 | 3300046692 | Ga0495671_0024881 | Ga0495671_0024881_824_1495 | 201 |
| 321 | 3300046794 | Ga0495589_0000470 | Ga0495589_0000470_22711_23382 | 201 |
| 322 | 3300046810 | Ga0495660_0004371 | Ga0495660_0004371_6041_6712 | 201 |
| 323 | 3300047315 | Ga0495581_0039054 | Ga0495581_0039054_385_990 | 201 |
| 324 | 3300047315 | Ga0495581_0238481 | Ga0495581_0238481_215_820 | 201 |
| 325 | 3300047315 | Ga0495581_0358235 | Ga0495581_0358235_91_696 | 201 |
| 326 | 3300047323 | Ga0495683_0000031 | Ga0495683_0000031_122678_123349 | 201 |
| 327 | 3300047446 | Ga0495679_000154 | Ga0495679_000154_5899_6570 | 201 |
| 328 | 3300047469 | Ga0495673_0039382 | Ga0495673_0039382_346_1017 | 201 |
| 329 | 3300048903 | Ga0496100_0009704 | Ga0496100_0009704_2794_3399 | 201 |
| 330 | 3300048904 | Ga0496101_0005979 | Ga0496101_0005979_4510_5115 | 201 |
| 331 | 3300048905 | Ga0496102_0016544 | Ga0496102_0016544_988_1593 | 201 |
| 332 | 3300048905 | Ga0496102_0140217 | Ga0496102_0140217_1394_1999 | 201 |
| 333 | 3300048905 | Ga0496102_0245084 | Ga0496102_0245084_1013_1618 | 201 |
| 334 | 3300048908 | Ga0496105_0116629 | Ga0496105_0116629_27_632 | 201 |
| 335 | 3300048909 | Ga0496106_0012051 | Ga0496106_0012051_865_1470 | 201 |
| 336 | 3300048909 | Ga0496106_0040977 | Ga0496106_0040977_1471_2076 | 201 |
| 337 | 3300048910 | Ga0496107_0008545 | Ga0496107_0008545_2371_2976 | 201 |
| 338 | 3300048910 | Ga0496107_0020896 | Ga0496107_0020896_639_1244 | 201 |
| 339 | 3300048913 | Ga0496110_0016941 | Ga0496110_0016941_1376_1981 | 201 |
| 340 | 3300048914 | Ga0496111_0105832 | Ga0496111_0105832_329_934 | 201 |
| 341 | 3300048916 | Ga0496113_0404870 | Ga0496113_0404870_201_806 | 201 |
| 342 | 3300048916 | Ga0496113_0916114 | Ga0496113_0916114_32_637 | 201 |
| 343 | 3300048917 | Ga0496114_0197890 | Ga0496114_0197890_681_1286 | 201 |
| 344 | 3300048925 | Ga0496122_0028113 | Ga0496122_0028113_2671_3342 | 201 |
| 345 | 3300048927 | Ga0496124_0287487 | Ga0496124_0287487_534_1139 | 201 |
| 346 | 3300049459 | Ga0495678_000186 | Ga0495678_000186_65651_66322 | 201 |
| 347 | 3300049541 | Ga0501325_005990 | Ga0501325_005990_30_650 | 201 |
| 348 | 3300049572 | Ga0501036_0319052 | Ga0501036_0319052_437_1069 | 201 |
| 349 | 3300049573 | Ga0501037_0019532 | Ga0501037_0019532_1344_1955 | 201 |
| 350 | 3300049574 | Ga0501038_0245052 | Ga0501038_0245052_181_813 | 201 |
| 351 | 3300049575 | Ga0501039_0140846 | Ga0501039_0140846_1050_1682 | 201 |
| 352 | 3300049589 | Ga0501073_0093029 | Ga0501073_0093029_345_977 | 201 |
| 353 | 3300049665 | Ga0501227_022409 | Ga0501227_022409_446_1066 | 201 |
| 354 | iso_pu_bacteria | 2808606366 | 2808877002 | 201 |
| 355 | iso_pu_bacteria | 2946024296 | 2946027127 | 201 |
| 356 | iso_pu_bacteria | 2966924647 | 2966925474 | 201 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ofk-assembly1.cif.gz_A | crystal structure of 3-methyladenine dna glycosylase i (tag) | 0.9448 | 19 | 192 |
| 4ai4-assembly1.cif.gz_A | crystal structure of e38q mutant of 3-methyladenine dna glycosylase i from staphylococcus aureus | 0.9092 | 19 | 189 |
| 2ofk-assembly1.cif.gz_A | crystal structure of 3-methyladenine dna glycosylase i (tag) | 0.8997 | 19 | 192 |
| 1p7m-assembly1.cif.gz_A | solution structure and base perturbation studies reveal a novel mode of alkylated base recognition by 3-methyladenine dna glycosylase i | 0.8874 | 19 | 188 |
| 4ai5-assembly3.cif.gz_C | crystal structure of y16f of 3-methyladenine dna glycosylase i (tag) in complex with 3-methyladenine | 0.8853 | 19 | 201 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O05311_6_193_1.10.340.30 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.949 | 15 | 190 | 1.10.340.30 |
| af_P05100_1_187_1.10.340.30 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.9482 | 19 | 190 | 1.10.340.30 |
| af_C6TKE8_117_301_1.10.340.30 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.9341 | 22 | 192 | 1.10.340.30 |
| 1p7mA00 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.8874 | 19 | 188 | 1.10.340.30 |
| af_O05311_6_193_1.10.340.30 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.8855 | 15 | 190 | 1.10.340.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4V3I715-F1-model_v4 | deleted | 0.9825 | 6 | 201 |
|
| AF-A0A239K667-F1-model_v4 | DNA-3-methyladenine glycosylase I | 0.9804 | 2 | 201 |
GO:0006284
GO:0008725 GO:0046872 |
| AF-E2S522-F1-model_v4 | DNA-3-methyladenine glycosylase I (EC 3.2.2.20) | 0.9804 | 6 | 199 |
GO:0006284
GO:0008725 GO:0046872 |
| AF-A0A7W5IJ97-F1-model_v4 | DNA-3-methyladenine glycosylase I (EC 3.2.2.20) | 0.9802 | 7 | 201 |
GO:0006284
GO:0008725 GO:0046872 |
| AF-A0A372K9F1-F1-model_v4 | DNA-3-methyladenine glycosylase I | 0.9802 | 7 | 201 |
GO:0006284
GO:0008725 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar