F420657
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 356 | 193 | 356 | 238 |
Family's Representative Sequence
| Representative Sequence | 3300050495|nmdc:mga04h51_32151_c1|nmdc:mga04h51_32151_c1_74_946 |
| Length | 290 |
| Sequence | LAWNLPVVLAPLIATTLRPASWAYPGAEAPGLPGQNRNARIRRDARDSDNIPPMSGNAATPLKTGEYAERGDYHRQPDQAWDYLPTFLAKLEYVRGYLSALAPGTRVLDAGCGEGILVEEFAGRLAIEGVDPNYVSAHVRRASLLELPYGGGVFERVLCLDVLEHLTYEEQPRALAELHRVLAPSGELLVSSPNLAHLQSRVHFLLTGRLIRTASEIKHPGDRPIAEYLRLFERAGFVVVERRGIFPTVPVLTAWIRRRPAERAWLHRLLTRLIPVPGLAFLNLIRLRRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 23 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 32 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 33 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 35 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 36 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 37 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 38 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 39 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 40 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 41 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 42 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 43 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 44 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 45 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 46 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 47 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 48 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 49 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 50 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 52 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 53 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 54 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 55 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 56 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 57 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 58 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 59 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 61 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 118 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 121 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 122 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 123 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 124 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 125 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 126 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 127 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 128 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 129 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 130 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 131 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 132 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 133 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 134 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 135 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 136 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 137 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 138 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 139 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 140 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 141 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 142 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 143 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 144 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 149 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 150 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 151 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 152 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 153 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 154 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 155 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 156 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 157 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 158 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 159 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 160 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 161 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 163 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 165 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 171 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 172 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 173 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 174 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 175 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 176 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 177 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 178 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 179 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 182 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 183 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 186 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 187 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 188 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 190 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 191 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 192 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.24 |
| Nodule | 0 |
| Rhizoplane | 8.71 |
| Rhizosphere | 80.06 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10001426 | 3300005290 | Bacteria | 6615 |
| 2 | Ga0065712_10148379 | 3300005290 | Unclassified | 1389 |
| 3 | Ga0065715_10089094 | 3300005293 | Bacteria | 14501 |
| 4 | Ga0065715_10157753 | 3300005293 | Bacteria | 1647 |
| 5 | Ga0070683_100006066 | 3300005329 | Bacteria | 10132 |
| 6 | Ga0070683_100009991 | 3300005329 | Bacteria | 8137 |
| 7 | Ga0070683_100914841 | 3300005329 | Bacteria | 842 |
| 8 | Ga0070670_100017474 | 3300005331 | Bacteria | 6153 |
| 9 | Ga0070670_100020809 | 3300005331 | Bacteria | 5641 |
| 10 | Ga0068869_100298508 | 3300005334 | Bacteria | 1300 |
| 11 | Ga0068868_100597702 | 3300005338 | Bacteria | 977 |
| 12 | Ga0070689_100218040 | 3300005340 | Bacteria | 1564 |
| 13 | Ga0070668_100058776 | 3300005347 | Bacteria | 2975 |
| 14 | Ga0070669_100000591 | 3300005353 | Bacteria | 26963 |
| 15 | Ga0070675_100037009 | 3300005354 | Bacteria | 3973 |
| 16 | Ga0070675_100194819 | 3300005354 | Bacteria | 1757 |
| 17 | Ga0070671_100024766 | 3300005355 | Bacteria | 4915 |
| 18 | Ga0070671_100179125 | 3300005355 | Bacteria | 1794 |
| 19 | Ga0070674_100006875 | 3300005356 | Bacteria | 6667 |
| 20 | Ga0070673_100005521 | 3300005364 | Bacteria | 8101 |
| 21 | Ga0070673_100675026 | 3300005364 | Unclassified | 947 |
| 22 | Ga0070688_100083639 | 3300005365 | Bacteria | 2071 |
| 23 | Ga0070659_100185280 | 3300005366 | Bacteria | 1709 |
| 24 | Ga0070659_100274989 | 3300005366 | Bacteria | 1400 |
| 25 | Ga0070667_100191584 | 3300005367 | Unclassified | 1811 |
| 26 | Ga0070667_100342002 | 3300005367 | Unclassified | 1353 |
| 27 | Ga0070701_10110488 | 3300005438 | Bacteria | 1535 |
| 28 | Ga0070711_100046400 | 3300005439 | Unclassified | 2960 |
| 29 | Ga0070663_100048041 | 3300005455 | Bacteria | 3025 |
| 30 | Ga0070663_100059271 | 3300005455 | Bacteria | 2751 |
| 31 | Ga0070663_100068398 | 3300005455 | Bacteria | 2578 |
| 32 | Ga0070663_100124514 | 3300005455 | Bacteria | 1951 |
| 33 | Ga0070663_100777988 | 3300005455 | Bacteria | 819 |
| 34 | Ga0070678_100167810 | 3300005456 | Bacteria | 1784 |
| 35 | Ga0070678_100240950 | 3300005456 | Bacteria | 1512 |
| 36 | Ga0070678_100301478 | 3300005456 | Unclassified | 1362 |
| 37 | Ga0070678_100816791 | 3300005456 | Bacteria | 847 |
| 38 | Ga0070662_100137546 | 3300005457 | Bacteria | 1890 |
| 39 | Ga0070662_100319426 | 3300005457 | Bacteria | 1266 |
| 40 | Ga0070662_100419144 | 3300005457 | Bacteria | 1107 |
| 41 | Ga0070662_100521203 | 3300005457 | Bacteria | 993 |
| 42 | Ga0068867_100186380 | 3300005459 | Bacteria | 1653 |
| 43 | Ga0070685_10090468 | 3300005466 | Bacteria | 1851 |
| 44 | Ga0070685_10096314 | 3300005466 | Bacteria | 1800 |
| 45 | Ga0070685_10305040 | 3300005466 | Bacteria | 1074 |
| 46 | Ga0070679_100224453 | 3300005530 | Bacteria | 1839 |
| 47 | Ga0070684_100000794 | 3300005535 | Bacteria | 21947 |
| 48 | Ga0070684_100058079 | 3300005535 | Bacteria | 3380 |
| 49 | Ga0070684_100190455 | 3300005535 | Bacteria | 1866 |
| 50 | Ga0070672_100004257 | 3300005543 | Bacteria | 9357 |
| 51 | Ga0070672_100021194 | 3300005543 | Unclassified | 4751 |
| 52 | Ga0070672_100118059 | 3300005543 | Bacteria | 2169 |
| 53 | Ga0070672_100238479 | 3300005543 | Unclassified | 1529 |
| 54 | Ga0070686_100189997 | 3300005544 | Bacteria | 1465 |
| 55 | Ga0070696_100261301 | 3300005546 | Bacteria | 1313 |
| 56 | Ga0070665_100173543 | 3300005548 | Bacteria | 2157 |
| 57 | Ga0070665_100483603 | 3300005548 | Bacteria | 1249 |
| 58 | Ga0070664_100099364 | 3300005564 | Unclassified | 2529 |
| 59 | Ga0070664_100285785 | 3300005564 | Bacteria | 1488 |
| 60 | Ga0068857_100011444 | 3300005577 | Bacteria | 7720 |
| 61 | Ga0068857_100246983 | 3300005577 | Bacteria | 1635 |
| 62 | Ga0068854_100102538 | 3300005578 | Bacteria | 2147 |
| 63 | Ga0070702_100140405 | 3300005615 | Bacteria | 1538 |
| 64 | Ga0068852_100031548 | 3300005616 | Bacteria | 4375 |
| 65 | Ga0068859_100438330 | 3300005617 | Bacteria | 1403 |
| 66 | Ga0068864_100003748 | 3300005618 | Bacteria | 12551 |
| 67 | Ga0068866_10146413 | 3300005718 | Unclassified | 1362 |
| 68 | Ga0068861_100042493 | 3300005719 | Unclassified | 3407 |
| 69 | Ga0068870_10149361 | 3300005840 | Bacteria | 1375 |
| 70 | Ga0068863_100080040 | 3300005841 | Bacteria | 3095 |
| 71 | Ga0068863_100181637 | 3300005841 | Bacteria | 2020 |
| 72 | Ga0068858_100037953 | 3300005842 | Bacteria | 4468 |
| 73 | Ga0068858_100780323 | 3300005842 | Unclassified | 932 |
| 74 | Ga0068860_100096141 | 3300005843 | Bacteria | 2824 |
| 75 | Ga0068860_100451431 | 3300005843 | Bacteria | 1278 |
| 76 | Ga0068862_100075382 | 3300005844 | Bacteria | 2918 |
| 77 | Ga0068862_100156555 | 3300005844 | Bacteria | 2031 |
| 78 | Ga0068862_100377822 | 3300005844 | Bacteria | 1321 |
| 79 | Ga0075368_10007991 | 3300006042 | Bacteria | 3752 |
| 80 | Ga0075368_10075548 | 3300006042 | Bacteria | 1366 |
| 81 | Ga0075363_100017770 | 3300006048 | Bacteria | 3532 |
| 82 | Ga0075364_10023220 | 3300006051 | Bacteria | 3925 |
| 83 | Ga0075364_10180484 | 3300006051 | Bacteria | 1428 |
| 84 | Ga0075364_10180814 | 3300006051 | Unclassified | 1427 |
| 85 | Ga0075362_10000172 | 3300006177 | Bacteria | 17809 |
| 86 | Ga0075367_10001714 | 3300006178 | Bacteria | 9599 |
| 87 | Ga0075367_10118580 | 3300006178 | Bacteria | 1629 |
| 88 | Ga0075367_10124036 | 3300006178 | Unclassified | 1593 |
| 89 | Ga0075366_10010371 | 3300006195 | Bacteria | 5231 |
| 90 | Ga0075366_10019756 | 3300006195 | Bacteria | 3904 |
| 91 | Ga0075366_10040428 | 3300006195 | Bacteria | 2758 |
| 92 | Ga0075366_10040638 | 3300006195 | Bacteria | 2751 |
| 93 | Ga0097621_100112057 | 3300006237 | Unclassified | 2306 |
| 94 | Ga0097621_100122902 | 3300006237 | Unclassified | 2203 |
| 95 | Ga0097621_100123938 | 3300006237 | Bacteria | 2194 |
| 96 | Ga0075370_10019409 | 3300006353 | Bacteria | 3702 |
| 97 | Ga0075370_10023058 | 3300006353 | Bacteria | 3424 |
| 98 | Ga0075370_10200358 | 3300006353 | Unclassified | 1177 |
| 99 | Ga0068871_100457489 | 3300006358 | Bacteria | 1145 |
| 100 | Ga0075428_100052367 | 3300006844 | Unclassified | 4474 |
| 101 | Ga0075428_100082046 | 3300006844 | Bacteria | 3518 |
| 102 | Ga0075428_100309227 | 3300006844 | Bacteria | 1699 |
| 103 | Ga0075430_100214823 | 3300006846 | Bacteria | 1596 |
| 104 | Ga0075430_100649257 | 3300006846 | Unclassified | 870 |
| 105 | Ga0075431_100046933 | 3300006847 | Unclassified | 4454 |
| 106 | Ga0075431_100104348 | 3300006847 | Bacteria | 2925 |
| 107 | Ga0075431_100588037 | 3300006847 | Bacteria | 1098 |
| 108 | Ga0075433_10065901 | 3300006852 | Unclassified | 3177 |
| 109 | Ga0075434_100036651 | 3300006871 | Bacteria | 4852 |
| 110 | Ga0068865_100046035 | 3300006881 | Unclassified | 2992 |
| 111 | Ga0068865_100077126 | 3300006881 | Unclassified | 2380 |
| 112 | Ga0097620_100230264 | 3300006931 | Unclassified | 1941 |
| 113 | Ga0097620_100438378 | 3300006931 | Bacteria | 1403 |
| 114 | Ga0097620_100928278 | 3300006931 | Bacteria | 954 |
| 115 | Ga0075435_100007573 | 3300007076 | Bacteria | 7754 |
| 116 | Ga0105240_10060893 | 3300009093 | Bacteria | 4705 |
| 117 | Ga0111539_10007621 | 3300009094 | Bacteria | 13832 |
| 118 | Ga0111539_10034317 | 3300009094 | Bacteria | 6154 |
| 119 | Ga0111539_10052174 | 3300009094 | Bacteria | 4868 |
| 120 | Ga0105245_10051387 | 3300009098 | Unclassified | 3695 |
| 121 | Ga0114129_10003376 | 3300009147 | Bacteria | 22429 |
| 122 | Ga0114129_10063604 | 3300009147 | Bacteria | 5152 |
| 123 | Ga0105243_10086638 | 3300009148 | Unclassified | 2569 |
| 124 | Ga0105243_10133631 | 3300009148 | Unclassified | 2108 |
| 125 | Ga0105242_10208677 | 3300009176 | Unclassified | 1739 |
| 126 | Ga0105242_10753114 | 3300009176 | Bacteria | 959 |
| 127 | Ga0105248_10011919 | 3300009177 | Bacteria | 9587 |
| 128 | Ga0105248_10030443 | 3300009177 | Bacteria | 6025 |
| 129 | Ga0105248_10137826 | 3300009177 | Unclassified | 2753 |
| 130 | Ga0105248_11141528 | 3300009177 | Bacteria | 881 |
| 131 | Ga0105249_10005392 | 3300009553 | Bacteria | 11041 |
| 132 | Ga0105249_10047632 | 3300009553 | Bacteria | 3906 |
| 133 | Ga0105246_10237183 | 3300011119 | Bacteria | 1440 |
| 134 | Ga0157374_10007676 | 3300013296 | Bacteria | 9210 |
| 135 | Ga0157374_10207361 | 3300013296 | Bacteria | 1921 |
| 136 | Ga0157375_10011766 | 3300013308 | Bacteria | 7737 |
| 137 | Ga0157375_10175910 | 3300013308 | Bacteria | 2290 |
| 138 | Ga0163163_10000071 | 3300014325 | Bacteria | 112778 |
| 139 | Ga0163163_10039373 | 3300014325 | Unclassified | 4613 |
| 140 | Ga0163163_10050297 | 3300014325 | Bacteria | 4104 |
| 141 | Ga0163163_10120454 | 3300014325 | Bacteria | 2658 |
| 142 | Ga0157376_10005550 | 3300014969 | Bacteria | 8822 |
| 143 | Ga0157376_10171589 | 3300014969 | Bacteria | 1976 |
| 144 | Ga0157376_10430180 | 3300014969 | Bacteria | 1283 |
| 145 | Ga0163161_10006816 | 3300017792 | Bacteria | 7899 |
| 146 | Ga0207697_10001192 | 3300025315 | Bacteria | 14265 |
| 147 | Ga0207697_10094932 | 3300025315 | Unclassified | 1267 |
| 148 | Ga0207656_10146830 | 3300025321 | Bacteria | 1114 |
| 149 | Ga0207682_10023014 | 3300025893 | Bacteria | 2459 |
| 150 | Ga0207642_10047091 | 3300025899 | Unclassified | 1926 |
| 151 | Ga0207688_10001657 | 3300025901 | Bacteria | 11775 |
| 152 | Ga0207680_10232202 | 3300025903 | Bacteria | 1268 |
| 153 | Ga0207643_10141035 | 3300025908 | Bacteria | 1440 |
| 154 | Ga0207695_10144431 | 3300025913 | Bacteria | 2325 |
| 155 | Ga0207663_10091444 | 3300025916 | Unclassified | 2020 |
| 156 | Ga0207681_10008075 | 3300025923 | Bacteria | 6440 |
| 157 | Ga0207681_10078292 | 3300025923 | Bacteria | 2326 |
| 158 | Ga0207681_10273611 | 3300025923 | Unclassified | 1327 |
| 159 | Ga0207650_10004419 | 3300025925 | Bacteria | 9604 |
| 160 | Ga0207650_10059042 | 3300025925 | Bacteria | 2858 |
| 161 | Ga0207650_10077802 | 3300025925 | Bacteria | 2508 |
| 162 | Ga0207659_10022055 | 3300025926 | Bacteria | 4237 |
| 163 | Ga0207659_10035620 | 3300025926 | Bacteria | 3442 |
| 164 | Ga0207659_10054761 | 3300025926 | Bacteria | 2850 |
| 165 | Ga0207659_10570384 | 3300025926 | Bacteria | 963 |
| 166 | Ga0207687_10065291 | 3300025927 | Unclassified | 2584 |
| 167 | Ga0207700_10043891 | 3300025928 | Bacteria | 3287 |
| 168 | Ga0207644_10104618 | 3300025931 | Bacteria | 2131 |
| 169 | Ga0207690_10380786 | 3300025932 | Bacteria | 1121 |
| 170 | Ga0207706_10048109 | 3300025933 | Bacteria | 3772 |
| 171 | Ga0207706_10186854 | 3300025933 | Bacteria | 1819 |
| 172 | Ga0207686_10188022 | 3300025934 | Unclassified | 1470 |
| 173 | Ga0207709_10455884 | 3300025935 | Bacteria | 989 |
| 174 | Ga0207670_10060210 | 3300025936 | Bacteria | 2586 |
| 175 | Ga0207669_10004380 | 3300025937 | Bacteria | 6210 |
| 176 | Ga0207691_10009602 | 3300025940 | Bacteria | 9285 |
| 177 | Ga0207691_10018514 | 3300025940 | Bacteria | 6600 |
| 178 | Ga0207691_10058361 | 3300025940 | Bacteria | 3510 |
| 179 | Ga0207691_10268287 | 3300025940 | Unclassified | 1470 |
| 180 | Ga0207711_10077056 | 3300025941 | Unclassified | 2905 |
| 181 | Ga0207711_10175518 | 3300025941 | Unclassified | 1946 |
| 182 | Ga0207711_10187316 | 3300025941 | Bacteria | 1884 |
| 183 | Ga0207689_10054112 | 3300025942 | Bacteria | 3306 |
| 184 | Ga0207661_10012911 | 3300025944 | Bacteria | 6091 |
| 185 | Ga0207661_10573852 | 3300025944 | Bacteria | 1034 |
| 186 | Ga0207661_10693696 | 3300025944 | Bacteria | 936 |
| 187 | Ga0207679_10013518 | 3300025945 | Bacteria | 5351 |
| 188 | Ga0207679_10429572 | 3300025945 | Bacteria | 1167 |
| 189 | Ga0207651_10045802 | 3300025960 | Bacteria | 2936 |
| 190 | Ga0207651_10574170 | 3300025960 | Unclassified | 983 |
| 191 | Ga0207712_10167266 | 3300025961 | Bacteria | 1715 |
| 192 | Ga0207712_10339464 | 3300025961 | Bacteria | 1245 |
| 193 | Ga0207668_10045042 | 3300025972 | Bacteria | 3006 |
| 194 | Ga0207668_10186661 | 3300025972 | Bacteria | 1640 |
| 195 | Ga0207668_10254985 | 3300025972 | Bacteria | 1427 |
| 196 | Ga0207668_10293485 | 3300025972 | Unclassified | 1339 |
| 197 | Ga0207640_10080928 | 3300025981 | Bacteria | 2219 |
| 198 | Ga0207640_10513119 | 3300025981 | Bacteria | 1000 |
| 199 | Ga0207658_10202314 | 3300025986 | Bacteria | 1659 |
| 200 | Ga0207677_10029854 | 3300026023 | Unclassified | 3471 |
| 201 | Ga0207677_10103814 | 3300026023 | Bacteria | 2099 |
| 202 | Ga0207677_10172005 | 3300026023 | Bacteria | 1695 |
| 203 | Ga0207703_10220450 | 3300026035 | Bacteria | 1696 |
| 204 | Ga0207678_10042956 | 3300026067 | Bacteria | 3913 |
| 205 | Ga0207678_10062582 | 3300026067 | Bacteria | 3198 |
| 206 | Ga0207678_10068105 | 3300026067 | Bacteria | 3055 |
| 207 | Ga0207678_10093767 | 3300026067 | Unclassified | 2565 |
| 208 | Ga0207678_10703105 | 3300026067 | Bacteria | 890 |
| 209 | Ga0207641_10118241 | 3300026088 | Unclassified | 2361 |
| 210 | Ga0207648_10028213 | 3300026089 | Bacteria | 4978 |
| 211 | Ga0207648_10075461 | 3300026089 | Bacteria | 2939 |
| 212 | Ga0207676_10017916 | 3300026095 | Bacteria | 5139 |
| 213 | Ga0207676_10117993 | 3300026095 | Unclassified | 2233 |
| 214 | Ga0207674_10017837 | 3300026116 | Bacteria | 7737 |
| 215 | Ga0207674_10084373 | 3300026116 | Bacteria | 3175 |
| 216 | Ga0207675_100022178 | 3300026118 | Bacteria | 5912 |
| 217 | Ga0207683_10091622 | 3300026121 | Bacteria | 2708 |
| 218 | Ga0207683_10201763 | 3300026121 | Unclassified | 1808 |
| 219 | Ga0207683_10220917 | 3300026121 | Bacteria | 1726 |
| 220 | Ga0207683_10265299 | 3300026121 | Bacteria | 1568 |
| 221 | Ga0207683_10268713 | 3300026121 | Bacteria | 1558 |
| 222 | Ga0207698_10039891 | 3300026142 | Unclassified | 3482 |
| 223 | Ga0209971_1027381 | 3300027682 | Bacteria | 1364 |
| 224 | Ga0207428_10004122 | 3300027907 | Bacteria | 13931 |
| 225 | Ga0207428_10021671 | 3300027907 | Bacteria | 5437 |
| 226 | Ga0207428_10032055 | 3300027907 | Bacteria | 4327 |
| 227 | Ga0268266_10138814 | 3300028379 | Bacteria | 2180 |
| 228 | Ga0268266_10434785 | 3300028379 | Bacteria | 1245 |
| 229 | Ga0268265_10072277 | 3300028380 | Bacteria | 2690 |
| 230 | Ga0307408_100016064 | 3300031548 | Bacteria | 4991 |
| 231 | Ga0307408_100447506 | 3300031548 | Unclassified | 1120 |
| 232 | Ga0307406_10129847 | 3300031901 | Unclassified | 1767 |
| 233 | Ga0307407_10316655 | 3300031903 | Unclassified | 1093 |
| 234 | Ga0307412_10080206 | 3300031911 | Unclassified | 2254 |
| 235 | Ga0307409_100349400 | 3300031995 | Bacteria | 1395 |
| 236 | Ga0307416_100705693 | 3300032002 | Unclassified | 1098 |
| 237 | Ga0307411_10241669 | 3300032005 | Unclassified | 1414 |
| 238 | Ga0373934_0017983 | 3300035086 | Bacteria | 2702 |
| 239 | Ga0373934_0189481 | 3300035086 | Bacteria | 846 |
| 240 | Ga0373956_0006502 | 3300035119 | Bacteria | 4684 |
| 241 | Ga0373957_0232250 | 3300035120 | Bacteria | 774 |
| 242 | Ga0373946_0276461 | 3300035171 | Bacteria | 825 |
| 243 | Ga0373955_0001722 | 3300035172 | Bacteria | 9366 |
| 244 | Ga0373955_0164766 | 3300035172 | Unclassified | 1310 |
| 245 | Ga0373933_0014341 | 3300035724 | Bacteria | 4406 |
| 246 | Ga0373947_0015502 | 3300035725 | Bacteria | 4378 |
| 247 | Ga0373947_0159285 | 3300035725 | Bacteria | 1459 |
| 248 | Ga0373937_0002816 | 3300036401 | Bacteria | 14530 |
| 249 | Ga0373937_0009769 | 3300036401 | Bacteria | 8365 |
| 250 | Ga0373937_0102218 | 3300036401 | Bacteria | 2661 |
| 251 | Ga0373937_0482721 | 3300036401 | Unclassified | 1177 |
| 252 | Ga0373925_0005688 | 3300037068 | Bacteria | 9267 |
| 253 | Ga0373925_0305117 | 3300037068 | Bacteria | 1286 |
| 254 | Ga0395905_0315761 | 3300037471 | Unclassified | 1452 |
| 255 | Ga0450920_001817 | 3300042122 | Bacteria | 3578 |
| 256 | Ga0450894_001967 | 3300042131 | Bacteria | 2835 |
| 257 | Ga0450898_002120 | 3300042134 | Bacteria | 2737 |
| 258 | Ga0450908_003328 | 3300042184 | Unclassified | 3125 |
| 259 | Ga0450908_009422 | 3300042184 | Bacteria | 1813 |
| 260 | Ga0450918_007598 | 3300042531 | Bacteria | 1915 |
| 261 | Ga0453683_0156941 | 3300044673 | Bacteria | 1439 |
| 262 | Ga0451576_1194671 | 3300045051 | Unclassified | 794 |
| 263 | Ga0495638_0012848 | 3300046460 | Bacteria | 5722 |
| 264 | Ga0495651_0084759 | 3300046462 | Bacteria | 2387 |
| 265 | Ga0495613_0108219 | 3300046689 | Bacteria | 2005 |
| 266 | Ga0495680_0063257 | 3300047322 | Unclassified | 2842 |
| 267 | Ga0495680_0381494 | 3300047322 | Unclassified | 976 |
| 268 | Ga0496101_0089408 | 3300048904 | Bacteria | 2289 |
| 269 | Ga0496101_0143833 | 3300048904 | Bacteria | 1820 |
| 270 | Ga0496102_0042682 | 3300048905 | Bacteria | 4110 |
| 271 | Ga0496102_0189604 | 3300048905 | Bacteria | 1937 |
| 272 | Ga0496104_0010994 | 3300048907 | Bacteria | 8098 |
| 273 | Ga0496104_0032261 | 3300048907 | Bacteria | 4874 |
| 274 | Ga0496104_0091142 | 3300048907 | Bacteria | 2913 |
| 275 | Ga0496105_0023298 | 3300048908 | Bacteria | 5019 |
| 276 | Ga0496105_0035576 | 3300048908 | Bacteria | 4099 |
| 277 | Ga0496105_0326134 | 3300048908 | Bacteria | 1230 |
| 278 | Ga0496106_0035343 | 3300048909 | Bacteria | 3737 |
| 279 | Ga0496106_0163999 | 3300048909 | Bacteria | 1758 |
| 280 | Ga0496107_0029675 | 3300048910 | Unclassified | 3893 |
| 281 | Ga0496108_0006443 | 3300048911 | Bacteria | 9514 |
| 282 | Ga0496108_0049980 | 3300048911 | Bacteria | 3499 |
| 283 | Ga0496108_0056656 | 3300048911 | Bacteria | 3294 |
| 284 | Ga0496108_0105465 | 3300048911 | Bacteria | 2406 |
| 285 | Ga0496109_0036296 | 3300048912 | Bacteria | 4448 |
| 286 | Ga0496109_0284139 | 3300048912 | Bacteria | 1559 |
| 287 | Ga0496109_0609473 | 3300048912 | Bacteria | 1028 |
| 288 | Ga0496110_0000816 | 3300048913 | Bacteria | 21833 |
| 289 | Ga0496110_0034547 | 3300048913 | Bacteria | 4380 |
| 290 | Ga0496110_0350436 | 3300048913 | Bacteria | 1345 |
| 291 | Ga0496110_0363151 | 3300048913 | Bacteria | 1319 |
| 292 | Ga0496111_0001752 | 3300048914 | Bacteria | 12708 |
| 293 | Ga0496112_0000213 | 3300048915 | Bacteria | 37294 |
| 294 | Ga0496112_0030034 | 3300048915 | Bacteria | 5259 |
| 295 | Ga0496112_0062483 | 3300048915 | Bacteria | 3673 |
| 296 | Ga0496113_0004934 | 3300048916 | Bacteria | 8262 |
| 297 | Ga0496114_0037065 | 3300048917 | Bacteria | 4032 |
| 298 | Ga0496114_0276933 | 3300048917 | Bacteria | 1479 |
| 299 | Ga0501034_0010143 | 3300049571 | Bacteria | 9829 |
| 300 | Ga0501040_0018715 | 3300049576 | Bacteria | 4600 |
| 301 | Ga0501041_0550488 | 3300049577 | Unclassified | 735 |
| 302 | Ga0501042_0681891 | 3300049578 | Unclassified | 747 |
| 303 | Ga0501072_0359813 | 3300049588 | Bacteria | 1155 |
| 304 | Ga0501073_0436588 | 3300049589 | Bacteria | 905 |
| 305 | Ga0501076_0022769 | 3300049592 | Bacteria | 4818 |
| 306 | Ga0501079_0764974 | 3300049741 | Unclassified | 760 |
| 307 | Ga0501080_0354726 | 3300049742 | Bacteria | 1324 |
| 308 | nmdc:mga03683_650_c1 | 3300050489 | Bacteria | 9969 |
| 309 | nmdc:mga03n38_263971_c1 | 3300050490 | Unclassified | 914 |
| 310 | nmdc:mga00v17_2930_c1 | 3300050491 | Bacteria | 8751 |
| 311 | nmdc:mga00v17_383758_c1 | 3300050491 | Bacteria | 913 |
| 312 | nmdc:mga00v17_68436_c1 | 3300050491 | Bacteria | 2195 |
| 313 | nmdc:mga0k408_11387_c1 | 3300050493 | Bacteria | 4843 |
| 314 | nmdc:mga0k408_241842_c1 | 3300050493 | Bacteria | 1078 |
| 315 | nmdc:mga0k408_259444_c1 | 3300050493 | Bacteria | 1038 |
| 316 | nmdc:mga0k408_400915_c1 | 3300050493 | Unclassified | 816 |
| 317 | nmdc:mga0k408_6654_c1 | 3300050493 | Bacteria | 6163 |
| 318 | nmdc:mga0k408_7268_c1 | 3300050493 | Bacteria | 5918 |
| 319 | nmdc:mga06z11_101861_c1 | 3300050494 | Unclassified | 1577 |
| 320 | nmdc:mga06z11_310129_c1 | 3300050494 | Archaea | 940 |
| 321 | nmdc:mga06z11_31891_c1 | 3300050494 | Bacteria | 2565 |
| 322 | nmdc:mga06z11_3976_c1 | 3300050494 | Bacteria | 5765 |
| 323 | nmdc:mga06z11_55326_c1 | 3300050494 | Bacteria | 2048 |
| 324 | nmdc:mga04h51_10983_c1 | 3300050495 | Bacteria | 2503 |
| 325 | nmdc:mga04h51_32151_c1 | 3300050495 | Unclassified | 1662 |
| 326 | nmdc:mga07m45_15727_c1 | 3300050496 | Bacteria | 4042 |
| 327 | nmdc:mga07m45_29063_c1 | 3300050496 | Bacteria | 3054 |
| 328 | nmdc:mga05p37_11149_c1 | 3300050507 | Bacteria | 10681 |
| 329 | nmdc:mga05p37_4420_c1 | 3300050507 | Bacteria | 16424 |
| 330 | nmdc:mga05p37_625_c2 | 3300050507 | Bacteria | 19945 |
| 331 | nmdc:mga05p37_94334_c1 | 3300050507 | Bacteria | 3687 |
| 332 | nmdc:mga0qj67_575340_c1 | 3300050509 | Unclassified | 902 |
| 333 | nmdc:mga0qj67_8989_c1 | 3300050509 | Bacteria | 7411 |
| 334 | nmdc:mga06r32_209832_c1 | 3300050510 | Unclassified | 1935 |
| 335 | nmdc:mga06r32_49581_c1 | 3300050510 | Bacteria | 4015 |
| 336 | nmdc:mga06r32_65586_c1 | 3300050510 | Bacteria | 3503 |
| 337 | nmdc:mga06r32_892667_c1 | 3300050510 | Bacteria | 846 |
| 338 | nmdc:mga08y16_112546_c1 | 3300050511 | Bacteria | 2833 |
| 339 | nmdc:mga08y16_1617_c1 | 3300050511 | Bacteria | 22810 |
| 340 | nmdc:mga08y16_3139_c1 | 3300050511 | Bacteria | 17106 |
| 341 | nmdc:mga0n895_2195_c1 | 3300050512 | Bacteria | 15101 |
| 342 | nmdc:mga0n895_8924_c1 | 3300050512 | Bacteria | 8736 |
| 343 | nmdc:mga0a205_150419_c1 | 3300050515 | Unclassified | 2228 |
| 344 | nmdc:mga0a205_437468_c1 | 3300050515 | Bacteria | 1169 |
| 345 | Ga0495595_0119927 | 3300053084 | Bacteria | 1281 |
| 346 | Ga0495619_0030965 | 3300053085 | Bacteria | 3465 |
| 347 | Ga0495619_0147478 | 3300053085 | Bacteria | 1622 |
| 348 | Ga0500555_000107 | 3300053103 | Bacteria | 39405 |
| 349 | Ga0500616_0001026 | 3300053153 | Bacteria | 29622 |
| 350 | Ga0500645_000553 | 3300053730 | Bacteria | 24693 |
| 351 | Ga0501084_0668897 | 3300054114 | Bacteria | 876 |
| 352 | Ga0590071_000557 | 3300059421 | Bacteria | 10786 |
| 353 | Ga0590075_002743 | 3300059424 | Bacteria | 4218 |
| 354 | Ga0590077_000276 | 3300059426 | Bacteria | 14588 |
| 355 | Ga0501082_0330155 | 3300060353 | Bacteria | 1329 |
| 356 | Ga0530510_0014629 | 3300061734 | Bacteria | 5539 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005290 | Ga0065712_10148379 | Ga0065712_101483792 | 229 |
| 2 | 3300005293 | Ga0065715_10089094 | Ga0065715_100890948 | 229 |
| 3 | 3300005331 | Ga0070670_100020809 | Ga0070670_1000208092 | 229 |
| 4 | 3300005334 | Ga0068869_100298508 | Ga0068869_1002985082 | 229 |
| 5 | 3300005340 | Ga0070689_100218040 | Ga0070689_1002180402 | 229 |
| 6 | 3300005347 | Ga0070668_100058776 | Ga0070668_1000587763 | 229 |
| 7 | 3300005354 | Ga0070675_100037009 | Ga0070675_1000370092 | 229 |
| 8 | 3300005364 | Ga0070673_100005521 | Ga0070673_1000055212 | 229 |
| 9 | 3300005367 | Ga0070667_100342002 | Ga0070667_1003420022 | 229 |
| 10 | 3300005457 | Ga0070662_100137546 | Ga0070662_1001375462 | 229 |
| 11 | 3300005459 | Ga0068867_100186380 | Ga0068867_1001863801 | 229 |
| 12 | 3300005466 | Ga0070685_10090468 | Ga0070685_100904682 | 229 |
| 13 | 3300005543 | Ga0070672_100004257 | Ga0070672_1000042577 | 229 |
| 14 | 3300005546 | Ga0070696_100261301 | Ga0070696_1002613012 | 229 |
| 15 | 3300005615 | Ga0070702_100140405 | Ga0070702_1001404051 | 229 |
| 16 | 3300005618 | Ga0068864_100003748 | Ga0068864_1000037486 | 229 |
| 17 | 3300005840 | Ga0068870_10149361 | Ga0068870_101493612 | 229 |
| 18 | 3300005844 | Ga0068862_100156555 | Ga0068862_1001565552 | 229 |
| 19 | 3300009177 | Ga0105248_10030443 | Ga0105248_100304432 | 229 |
| 20 | 3300009553 | Ga0105249_10047632 | Ga0105249_100476323 | 229 |
| 21 | 3300011119 | Ga0105246_10237183 | Ga0105246_102371832 | 229 |
| 22 | 3300025908 | Ga0207643_10141035 | Ga0207643_101410352 | 229 |
| 23 | 3300025923 | Ga0207681_10078292 | Ga0207681_100782922 | 229 |
| 24 | 3300025926 | Ga0207659_10022055 | Ga0207659_100220553 | 229 |
| 25 | 3300025933 | Ga0207706_10048109 | Ga0207706_100481092 | 229 |
| 26 | 3300025935 | Ga0207709_10455884 | Ga0207709_104558842 | 229 |
| 27 | 3300025936 | Ga0207670_10060210 | Ga0207670_100602102 | 229 |
| 28 | 3300025940 | Ga0207691_10009602 | Ga0207691_100096023 | 229 |
| 29 | 3300025941 | Ga0207711_10187316 | Ga0207711_101873163 | 229 |
| 30 | 3300025960 | Ga0207651_10045802 | Ga0207651_100458022 | 229 |
| 31 | 3300025961 | Ga0207712_10167266 | Ga0207712_101672662 | 229 |
| 32 | 3300025972 | Ga0207668_10045042 | Ga0207668_100450423 | 229 |
| 33 | 3300025986 | Ga0207658_10202314 | Ga0207658_102023142 | 229 |
| 34 | 3300026023 | Ga0207677_10103814 | Ga0207677_101038143 | 229 |
| 35 | 3300026035 | Ga0207703_10220450 | Ga0207703_102204502 | 229 |
| 36 | 3300026089 | Ga0207648_10075461 | Ga0207648_100754614 | 229 |
| 37 | 3300026095 | Ga0207676_10017916 | Ga0207676_100179163 | 229 |
| 38 | 3300026121 | Ga0207683_10091622 | Ga0207683_100916222 | 229 |
| 39 | 3300028379 | Ga0268266_10434785 | Ga0268266_104347851 | 229 |
| 40 | 3300028380 | Ga0268265_10072277 | Ga0268265_100722774 | 229 |
| 41 | 3300048904 | Ga0496101_0089408 | Ga0496101_0089408_798_1505 | 229 |
| 42 | 3300048905 | Ga0496102_0189604 | Ga0496102_0189604_721_1428 | 229 |
| 43 | 3300048907 | Ga0496104_0091142 | Ga0496104_0091142_514_1221 | 229 |
| 44 | 3300048908 | Ga0496105_0035576 | Ga0496105_0035576_439_1146 | 229 |
| 45 | 3300048909 | Ga0496106_0163999 | Ga0496106_0163999_229_936 | 229 |
| 46 | 3300048911 | Ga0496108_0105465 | Ga0496108_0105465_1053_1760 | 229 |
| 47 | 3300048912 | Ga0496109_0036296 | Ga0496109_0036296_2957_3664 | 229 |
| 48 | 3300048913 | Ga0496110_0034547 | Ga0496110_0034547_2982_3689 | 229 |
| 49 | 3300048915 | Ga0496112_0062483 | Ga0496112_0062483_692_1399 | 229 |
| 50 | 3300048916 | Ga0496113_0004934 | Ga0496113_0004934_2427_3134 | 229 |
| 51 | 3300005338 | Ga0068868_100597702 | Ga0068868_1005977021 | 230 |
| 52 | 3300005355 | Ga0070671_100024766 | Ga0070671_1000247664 | 230 |
| 53 | 3300005455 | Ga0070663_100048041 | Ga0070663_1000480412 | 230 |
| 54 | 3300005455 | Ga0070663_100124514 | Ga0070663_1001245143 | 230 |
| 55 | 3300005456 | Ga0070678_100167810 | Ga0070678_1001678102 | 230 |
| 56 | 3300005548 | Ga0070665_100173543 | Ga0070665_1001735432 | 230 |
| 57 | 3300005841 | Ga0068863_100080040 | Ga0068863_1000800402 | 230 |
| 58 | 3300006195 | Ga0075366_10040638 | Ga0075366_100406384 | 230 |
| 59 | 3300009094 | Ga0111539_10052174 | Ga0111539_100521742 | 230 |
| 60 | 3300014325 | Ga0163163_10050297 | Ga0163163_100502972 | 230 |
| 61 | 3300025893 | Ga0207682_10023014 | Ga0207682_100230142 | 230 |
| 62 | 3300025926 | Ga0207659_10035620 | Ga0207659_100356202 | 230 |
| 63 | 3300025940 | Ga0207691_10018514 | Ga0207691_100185143 | 230 |
| 64 | 3300025981 | Ga0207640_10080928 | Ga0207640_100809282 | 230 |
| 65 | 3300026023 | Ga0207677_10172005 | Ga0207677_101720052 | 230 |
| 66 | 3300026067 | Ga0207678_10042956 | Ga0207678_100429563 | 230 |
| 67 | 3300026067 | Ga0207678_10062582 | Ga0207678_100625823 | 230 |
| 68 | 3300026121 | Ga0207683_10265299 | Ga0207683_102652993 | 230 |
| 69 | 3300027907 | Ga0207428_10021671 | Ga0207428_100216713 | 230 |
| 70 | 3300028379 | Ga0268266_10138814 | Ga0268266_101388142 | 230 |
| 71 | 3300032002 | Ga0307416_100705693 | Ga0307416_1007056932 | 230 |
| 72 | 3300042122 | Ga0450920_001817 | Ga0450920_001817_2671_3372 | 230 |
| 73 | 3300042131 | Ga0450894_001967 | Ga0450894_001967_891_1592 | 230 |
| 74 | 3300042184 | Ga0450908_003328 | Ga0450908_003328_791_1492 | 230 |
| 75 | 3300048913 | Ga0496110_0350436 | Ga0496110_0350436_528_1229 | 230 |
| 76 | 3300049578 | Ga0501042_0681891 | Ga0501042_0681891_15_713 | 230 |
| 77 | 3300050493 | nmdc:mga0k408_400915_c1 | nmdc:mga0k408_400915_c1_50_751 | 230 |
| 78 | 3300050507 | nmdc:mga05p37_11149_c1 | nmdc:mga05p37_11149_c1_9944_10642 | 230 |
| 79 | 3300050511 | nmdc:mga08y16_1617_c1 | nmdc:mga08y16_1617_c1_95_793 | 230 |
| 80 | 3300050515 | nmdc:mga0a205_437468_c1 | nmdc:mga0a205_437468_c1_14_712 | 230 |
| 81 | 3300046689 | Ga0495613_0108219 | Ga0495613_0108219_14_718 | 231 |
| 82 | 3300005329 | Ga0070683_100009991 | Ga0070683_1000099915 | 232 |
| 83 | 3300005439 | Ga0070711_100046400 | Ga0070711_1000464002 | 232 |
| 84 | 3300005456 | Ga0070678_100816791 | Ga0070678_1008167911 | 232 |
| 85 | 3300005535 | Ga0070684_100058079 | Ga0070684_1000580793 | 232 |
| 86 | 3300005564 | Ga0070664_100099364 | Ga0070664_1000993643 | 232 |
| 87 | 3300005564 | Ga0070664_100285785 | Ga0070664_1002857852 | 232 |
| 88 | 3300005577 | Ga0068857_100011444 | Ga0068857_1000114447 | 232 |
| 89 | 3300005843 | Ga0068860_100451431 | Ga0068860_1004514312 | 232 |
| 90 | 3300006042 | Ga0075368_10007991 | Ga0075368_100079913 | 232 |
| 91 | 3300006048 | Ga0075363_100017770 | Ga0075363_1000177703 | 232 |
| 92 | 3300006051 | Ga0075364_10023220 | Ga0075364_100232201 | 232 |
| 93 | 3300006177 | Ga0075362_10000172 | Ga0075362_100001728 | 232 |
| 94 | 3300006178 | Ga0075367_10001714 | Ga0075367_100017142 | 232 |
| 95 | 3300006178 | Ga0075367_10124036 | Ga0075367_101240362 | 232 |
| 96 | 3300006195 | Ga0075366_10019756 | Ga0075366_100197565 | 232 |
| 97 | 3300006195 | Ga0075366_10040428 | Ga0075366_100404283 | 232 |
| 98 | 3300006237 | Ga0097621_100123938 | Ga0097621_1001239383 | 232 |
| 99 | 3300006353 | Ga0075370_10019409 | Ga0075370_100194092 | 232 |
| 100 | 3300006353 | Ga0075370_10023058 | Ga0075370_100230583 | 232 |
| 101 | 3300006844 | Ga0075428_100082046 | Ga0075428_1000820462 | 232 |
| 102 | 3300006846 | Ga0075430_100214823 | Ga0075430_1002148232 | 232 |
| 103 | 3300006847 | Ga0075431_100104348 | Ga0075431_1001043484 | 232 |
| 104 | 3300006852 | Ga0075433_10065901 | Ga0075433_100659013 | 232 |
| 105 | 3300006871 | Ga0075434_100036651 | Ga0075434_1000366515 | 232 |
| 106 | 3300007076 | Ga0075435_100007573 | Ga0075435_1000075735 | 232 |
| 107 | 3300009093 | Ga0105240_10060893 | Ga0105240_100608933 | 232 |
| 108 | 3300009148 | Ga0105243_10133631 | Ga0105243_101336312 | 232 |
| 109 | 3300014325 | Ga0163163_10000071 | Ga0163163_1000007132 | 232 |
| 110 | 3300014969 | Ga0157376_10171589 | Ga0157376_101715892 | 232 |
| 111 | 3300025913 | Ga0207695_10144431 | Ga0207695_101444312 | 232 |
| 112 | 3300025916 | Ga0207663_10091444 | Ga0207663_100914443 | 232 |
| 113 | 3300025925 | Ga0207650_10004419 | Ga0207650_100044197 | 232 |
| 114 | 3300025928 | Ga0207700_10043891 | Ga0207700_100438911 | 232 |
| 115 | 3300025944 | Ga0207661_10573852 | Ga0207661_105738522 | 232 |
| 116 | 3300025945 | Ga0207679_10013518 | Ga0207679_100135183 | 232 |
| 117 | 3300025945 | Ga0207679_10429572 | Ga0207679_104295722 | 232 |
| 118 | 3300025972 | Ga0207668_10186661 | Ga0207668_101866612 | 232 |
| 119 | 3300026116 | Ga0207674_10017837 | Ga0207674_100178377 | 232 |
| 120 | 3300027907 | Ga0207428_10032055 | Ga0207428_100320554 | 232 |
| 121 | 3300035086 | Ga0373934_0017983 | Ga0373934_0017983_1541_2251 | 232 |
| 122 | 3300035086 | Ga0373934_0189481 | Ga0373934_0189481_115_819 | 232 |
| 123 | 3300035119 | Ga0373956_0006502 | Ga0373956_0006502_823_1533 | 232 |
| 124 | 3300035120 | Ga0373957_0232250 | Ga0373957_0232250_17_721 | 232 |
| 125 | 3300035172 | Ga0373955_0001722 | Ga0373955_0001722_7159_7869 | 232 |
| 126 | 3300035172 | Ga0373955_0164766 | Ga0373955_0164766_169_873 | 232 |
| 127 | 3300035724 | Ga0373933_0014341 | Ga0373933_0014341_1627_2337 | 232 |
| 128 | 3300035725 | Ga0373947_0159285 | Ga0373947_0159285_117_827 | 232 |
| 129 | 3300036401 | Ga0373937_0002816 | Ga0373937_0002816_5623_6327 | 232 |
| 130 | 3300036401 | Ga0373937_0009769 | Ga0373937_0009769_2378_3088 | 232 |
| 131 | 3300036401 | Ga0373937_0102218 | Ga0373937_0102218_17_724 | 232 |
| 132 | 3300036401 | Ga0373937_0482721 | Ga0373937_0482721_186_896 | 232 |
| 133 | 3300037068 | Ga0373925_0005688 | Ga0373925_0005688_8092_8796 | 232 |
| 134 | 3300037068 | Ga0373925_0305117 | Ga0373925_0305117_221_928 | 232 |
| 135 | 3300037471 | Ga0395905_0315761 | Ga0395905_0315761_734_1441 | 232 |
| 136 | 3300044673 | Ga0453683_0156941 | Ga0453683_0156941_193_903 | 232 |
| 137 | 3300046462 | Ga0495651_0084759 | Ga0495651_0084759_1520_2230 | 232 |
| 138 | 3300047322 | Ga0495680_0063257 | Ga0495680_0063257_2001_2711 | 232 |
| 139 | 3300047322 | Ga0495680_0381494 | Ga0495680_0381494_124_834 | 232 |
| 140 | 3300048915 | Ga0496112_0030034 | Ga0496112_0030034_4503_5216 | 232 |
| 141 | 3300048917 | Ga0496114_0276933 | Ga0496114_0276933_162_872 | 232 |
| 142 | 3300049571 | Ga0501034_0010143 | Ga0501034_0010143_5918_6625 | 232 |
| 143 | 3300049589 | Ga0501073_0436588 | Ga0501073_0436588_114_821 | 232 |
| 144 | 3300050489 | nmdc:mga03683_650_c1 | nmdc:mga03683_650_c1_3744_4451 | 232 |
| 145 | 3300050490 | nmdc:mga03n38_263971_c1 | nmdc:mga03n38_263971_c1_194_901 | 232 |
| 146 | 3300050491 | nmdc:mga00v17_2930_c1 | nmdc:mga00v17_2930_c1_3058_3765 | 232 |
| 147 | 3300050493 | nmdc:mga0k408_241842_c1 | nmdc:mga0k408_241842_c1_151_858 | 232 |
| 148 | 3300050493 | nmdc:mga0k408_6654_c1 | nmdc:mga0k408_6654_c1_5114_5821 | 232 |
| 149 | 3300050494 | nmdc:mga06z11_101861_c1 | nmdc:mga06z11_101861_c1_268_975 | 232 |
| 150 | 3300050494 | nmdc:mga06z11_31891_c1 | nmdc:mga06z11_31891_c1_882_1589 | 232 |
| 151 | 3300050494 | nmdc:mga06z11_3976_c1 | nmdc:mga06z11_3976_c1_4218_4925 | 232 |
| 152 | 3300050496 | nmdc:mga07m45_29063_c1 | nmdc:mga07m45_29063_c1_1287_1994 | 232 |
| 153 | 3300050512 | nmdc:mga0n895_8924_c1 | nmdc:mga0n895_8924_c1_5600_6304 | 232 |
| 154 | 3300050515 | nmdc:mga0a205_150419_c1 | nmdc:mga0a205_150419_c1_944_1648 | 232 |
| 155 | 3300053084 | Ga0495595_0119927 | Ga0495595_0119927_281_988 | 232 |
| 156 | 3300053085 | Ga0495619_0030965 | Ga0495619_0030965_774_1481 | 232 |
| 157 | 3300053085 | Ga0495619_0147478 | Ga0495619_0147478_568_1278 | 232 |
| 158 | 3300006846 | Ga0075430_100649257 | Ga0075430_1006492572 | 233 |
| 159 | 3300031548 | Ga0307408_100447506 | Ga0307408_1004475062 | 233 |
| 160 | 3300042134 | Ga0450898_002120 | Ga0450898_002120_390_1100 | 233 |
| 161 | 3300042184 | Ga0450908_009422 | Ga0450908_009422_622_1332 | 233 |
| 162 | 3300042531 | Ga0450918_007598 | Ga0450918_007598_32_742 | 233 |
| 163 | 3300046460 | Ga0495638_0012848 | Ga0495638_0012848_483_1199 | 233 |
| 164 | 3300049577 | Ga0501041_0550488 | Ga0501041_0550488_13_720 | 233 |
| 165 | 3300049741 | Ga0501079_0764974 | Ga0501079_0764974_22_729 | 233 |
| 166 | 3300050495 | nmdc:mga04h51_32151_c1 | nmdc:mga04h51_32151_c1_74_946 | 233 |
| 167 | 3300050509 | nmdc:mga0qj67_575340_c1 | nmdc:mga0qj67_575340_c1_177_884 | 233 |
| 168 | 3300059421 | Ga0590071_000557 | Ga0590071_000557_4894_5601 | 233 |
| 169 | 3300059424 | Ga0590075_002743 | Ga0590075_002743_2634_3341 | 233 |
| 170 | 3300059426 | Ga0590077_000276 | Ga0590077_000276_8250_8957 | 233 |
| 171 | 3300005290 | Ga0065712_10001426 | Ga0065712_100014262 | 234 |
| 172 | 3300005293 | Ga0065715_10157753 | Ga0065715_101577531 | 234 |
| 173 | 3300005329 | Ga0070683_100006066 | Ga0070683_1000060663 | 234 |
| 174 | 3300005329 | Ga0070683_100914841 | Ga0070683_1009148411 | 234 |
| 175 | 3300005331 | Ga0070670_100017474 | Ga0070670_1000174746 | 234 |
| 176 | 3300005353 | Ga0070669_100000591 | Ga0070669_10000059110 | 234 |
| 177 | 3300005354 | Ga0070675_100194819 | Ga0070675_1001948192 | 234 |
| 178 | 3300005355 | Ga0070671_100179125 | Ga0070671_1001791252 | 234 |
| 179 | 3300005356 | Ga0070674_100006875 | Ga0070674_1000068753 | 234 |
| 180 | 3300005364 | Ga0070673_100675026 | Ga0070673_1006750262 | 234 |
| 181 | 3300005365 | Ga0070688_100083639 | Ga0070688_1000836392 | 234 |
| 182 | 3300005366 | Ga0070659_100185280 | Ga0070659_1001852802 | 234 |
| 183 | 3300005366 | Ga0070659_100274989 | Ga0070659_1002749892 | 234 |
| 184 | 3300005367 | Ga0070667_100191584 | Ga0070667_1001915842 | 234 |
| 185 | 3300005438 | Ga0070701_10110488 | Ga0070701_101104881 | 234 |
| 186 | 3300005455 | Ga0070663_100059271 | Ga0070663_1000592712 | 234 |
| 187 | 3300005455 | Ga0070663_100068398 | Ga0070663_1000683982 | 234 |
| 188 | 3300005455 | Ga0070663_100777988 | Ga0070663_1007779881 | 234 |
| 189 | 3300005456 | Ga0070678_100240950 | Ga0070678_1002409501 | 234 |
| 190 | 3300005456 | Ga0070678_100301478 | Ga0070678_1003014782 | 234 |
| 191 | 3300005457 | Ga0070662_100319426 | Ga0070662_1003194262 | 234 |
| 192 | 3300005457 | Ga0070662_100419144 | Ga0070662_1004191442 | 234 |
| 193 | 3300005457 | Ga0070662_100521203 | Ga0070662_1005212031 | 234 |
| 194 | 3300005466 | Ga0070685_10096314 | Ga0070685_100963142 | 234 |
| 195 | 3300005466 | Ga0070685_10305040 | Ga0070685_103050402 | 234 |
| 196 | 3300005530 | Ga0070679_100224453 | Ga0070679_1002244532 | 234 |
| 197 | 3300005535 | Ga0070684_100000794 | Ga0070684_1000007942 | 234 |
| 198 | 3300005535 | Ga0070684_100190455 | Ga0070684_1001904552 | 234 |
| 199 | 3300005543 | Ga0070672_100021194 | Ga0070672_1000211943 | 234 |
| 200 | 3300005543 | Ga0070672_100118059 | Ga0070672_1001180592 | 234 |
| 201 | 3300005543 | Ga0070672_100238479 | Ga0070672_1002384792 | 234 |
| 202 | 3300005544 | Ga0070686_100189997 | Ga0070686_1001899971 | 234 |
| 203 | 3300005548 | Ga0070665_100483603 | Ga0070665_1004836032 | 234 |
| 204 | 3300005577 | Ga0068857_100246983 | Ga0068857_1002469832 | 234 |
| 205 | 3300005578 | Ga0068854_100102538 | Ga0068854_1001025383 | 234 |
| 206 | 3300005616 | Ga0068852_100031548 | Ga0068852_1000315482 | 234 |
| 207 | 3300005617 | Ga0068859_100438330 | Ga0068859_1004383301 | 234 |
| 208 | 3300005718 | Ga0068866_10146413 | Ga0068866_101464132 | 234 |
| 209 | 3300005719 | Ga0068861_100042493 | Ga0068861_1000424932 | 234 |
| 210 | 3300005841 | Ga0068863_100181637 | Ga0068863_1001816372 | 234 |
| 211 | 3300005842 | Ga0068858_100037953 | Ga0068858_1000379534 | 234 |
| 212 | 3300005842 | Ga0068858_100780323 | Ga0068858_1007803232 | 234 |
| 213 | 3300005843 | Ga0068860_100096141 | Ga0068860_1000961412 | 234 |
| 214 | 3300005844 | Ga0068862_100075382 | Ga0068862_1000753822 | 234 |
| 215 | 3300005844 | Ga0068862_100377822 | Ga0068862_1003778222 | 234 |
| 216 | 3300006042 | Ga0075368_10075548 | Ga0075368_100755482 | 234 |
| 217 | 3300006051 | Ga0075364_10180484 | Ga0075364_101804842 | 234 |
| 218 | 3300006051 | Ga0075364_10180814 | Ga0075364_101808142 | 234 |
| 219 | 3300006178 | Ga0075367_10118580 | Ga0075367_101185802 | 234 |
| 220 | 3300006195 | Ga0075366_10010371 | Ga0075366_100103714 | 234 |
| 221 | 3300006237 | Ga0097621_100112057 | Ga0097621_1001120572 | 234 |
| 222 | 3300006237 | Ga0097621_100122902 | Ga0097621_1001229022 | 234 |
| 223 | 3300006353 | Ga0075370_10200358 | Ga0075370_102003582 | 234 |
| 224 | 3300006358 | Ga0068871_100457489 | Ga0068871_1004574891 | 234 |
| 225 | 3300006844 | Ga0075428_100052367 | Ga0075428_1000523672 | 234 |
| 226 | 3300006844 | Ga0075428_100309227 | Ga0075428_1003092272 | 234 |
| 227 | 3300006847 | Ga0075431_100046933 | Ga0075431_1000469332 | 234 |
| 228 | 3300006847 | Ga0075431_100588037 | Ga0075431_1005880371 | 234 |
| 229 | 3300006881 | Ga0068865_100046035 | Ga0068865_1000460353 | 234 |
| 230 | 3300006881 | Ga0068865_100077126 | Ga0068865_1000771263 | 234 |
| 231 | 3300006931 | Ga0097620_100230264 | Ga0097620_1002302642 | 234 |
| 232 | 3300006931 | Ga0097620_100438378 | Ga0097620_1004383781 | 234 |
| 233 | 3300006931 | Ga0097620_100928278 | Ga0097620_1009282782 | 234 |
| 234 | 3300009094 | Ga0111539_10007621 | Ga0111539_100076215 | 234 |
| 235 | 3300009094 | Ga0111539_10034317 | Ga0111539_100343173 | 234 |
| 236 | 3300009098 | Ga0105245_10051387 | Ga0105245_100513872 | 234 |
| 237 | 3300009147 | Ga0114129_10003376 | Ga0114129_1000337617 | 234 |
| 238 | 3300009147 | Ga0114129_10063604 | Ga0114129_100636042 | 234 |
| 239 | 3300009148 | Ga0105243_10086638 | Ga0105243_100866383 | 234 |
| 240 | 3300009176 | Ga0105242_10208677 | Ga0105242_102086772 | 234 |
| 241 | 3300009176 | Ga0105242_10753114 | Ga0105242_107531142 | 234 |
| 242 | 3300009177 | Ga0105248_10011919 | Ga0105248_100119194 | 234 |
| 243 | 3300009177 | Ga0105248_10137826 | Ga0105248_101378262 | 234 |
| 244 | 3300009177 | Ga0105248_11141528 | Ga0105248_111415281 | 234 |
| 245 | 3300009553 | Ga0105249_10005392 | Ga0105249_100053922 | 234 |
| 246 | 3300013296 | Ga0157374_10007676 | Ga0157374_100076763 | 234 |
| 247 | 3300013296 | Ga0157374_10207361 | Ga0157374_102073611 | 234 |
| 248 | 3300013308 | Ga0157375_10011766 | Ga0157375_100117665 | 234 |
| 249 | 3300013308 | Ga0157375_10175910 | Ga0157375_101759102 | 234 |
| 250 | 3300014325 | Ga0163163_10039373 | Ga0163163_100393734 | 234 |
| 251 | 3300014325 | Ga0163163_10120454 | Ga0163163_101204542 | 234 |
| 252 | 3300014969 | Ga0157376_10005550 | Ga0157376_100055502 | 234 |
| 253 | 3300014969 | Ga0157376_10430180 | Ga0157376_104301802 | 234 |
| 254 | 3300017792 | Ga0163161_10006816 | Ga0163161_100068163 | 234 |
| 255 | 3300025315 | Ga0207697_10001192 | Ga0207697_100011928 | 234 |
| 256 | 3300025315 | Ga0207697_10094932 | Ga0207697_100949321 | 234 |
| 257 | 3300025321 | Ga0207656_10146830 | Ga0207656_101468302 | 234 |
| 258 | 3300025899 | Ga0207642_10047091 | Ga0207642_100470912 | 234 |
| 259 | 3300025901 | Ga0207688_10001657 | Ga0207688_100016578 | 234 |
| 260 | 3300025903 | Ga0207680_10232202 | Ga0207680_102322022 | 234 |
| 261 | 3300025923 | Ga0207681_10008075 | Ga0207681_100080752 | 234 |
| 262 | 3300025923 | Ga0207681_10273611 | Ga0207681_102736111 | 234 |
| 263 | 3300025925 | Ga0207650_10059042 | Ga0207650_100590423 | 234 |
| 264 | 3300025925 | Ga0207650_10077802 | Ga0207650_100778021 | 234 |
| 265 | 3300025926 | Ga0207659_10054761 | Ga0207659_100547612 | 234 |
| 266 | 3300025926 | Ga0207659_10570384 | Ga0207659_105703841 | 234 |
| 267 | 3300025927 | Ga0207687_10065291 | Ga0207687_100652912 | 234 |
| 268 | 3300025931 | Ga0207644_10104618 | Ga0207644_101046181 | 234 |
| 269 | 3300025932 | Ga0207690_10380786 | Ga0207690_103807862 | 234 |
| 270 | 3300025933 | Ga0207706_10186854 | Ga0207706_101868542 | 234 |
| 271 | 3300025934 | Ga0207686_10188022 | Ga0207686_101880222 | 234 |
| 272 | 3300025937 | Ga0207669_10004380 | Ga0207669_100043804 | 234 |
| 273 | 3300025940 | Ga0207691_10058361 | Ga0207691_100583613 | 234 |
| 274 | 3300025940 | Ga0207691_10268287 | Ga0207691_102682872 | 234 |
| 275 | 3300025941 | Ga0207711_10077056 | Ga0207711_100770562 | 234 |
| 276 | 3300025941 | Ga0207711_10175518 | Ga0207711_101755182 | 234 |
| 277 | 3300025942 | Ga0207689_10054112 | Ga0207689_100541123 | 234 |
| 278 | 3300025944 | Ga0207661_10012911 | Ga0207661_100129112 | 234 |
| 279 | 3300025944 | Ga0207661_10693696 | Ga0207661_106936961 | 234 |
| 280 | 3300025960 | Ga0207651_10574170 | Ga0207651_105741702 | 234 |
| 281 | 3300025961 | Ga0207712_10339464 | Ga0207712_103394641 | 234 |
| 282 | 3300025972 | Ga0207668_10254985 | Ga0207668_102549852 | 234 |
| 283 | 3300025972 | Ga0207668_10293485 | Ga0207668_102934852 | 234 |
| 284 | 3300025981 | Ga0207640_10513119 | Ga0207640_105131192 | 234 |
| 285 | 3300026023 | Ga0207677_10029854 | Ga0207677_100298542 | 234 |
| 286 | 3300026067 | Ga0207678_10068105 | Ga0207678_100681052 | 234 |
| 287 | 3300026067 | Ga0207678_10093767 | Ga0207678_100937672 | 234 |
| 288 | 3300026067 | Ga0207678_10703105 | Ga0207678_107031051 | 234 |
| 289 | 3300026088 | Ga0207641_10118241 | Ga0207641_101182412 | 234 |
| 290 | 3300026089 | Ga0207648_10028213 | Ga0207648_100282134 | 234 |
| 291 | 3300026095 | Ga0207676_10117993 | Ga0207676_101179932 | 234 |
| 292 | 3300026116 | Ga0207674_10084373 | Ga0207674_100843732 | 234 |
| 293 | 3300026118 | Ga0207675_100022178 | Ga0207675_1000221783 | 234 |
| 294 | 3300026121 | Ga0207683_10201763 | Ga0207683_102017632 | 234 |
| 295 | 3300026121 | Ga0207683_10220917 | Ga0207683_102209171 | 234 |
| 296 | 3300026121 | Ga0207683_10268713 | Ga0207683_102687131 | 234 |
| 297 | 3300026142 | Ga0207698_10039891 | Ga0207698_100398912 | 234 |
| 298 | 3300027682 | Ga0209971_1027381 | Ga0209971_10273812 | 234 |
| 299 | 3300027907 | Ga0207428_10004122 | Ga0207428_100041222 | 234 |
| 300 | 3300031548 | Ga0307408_100016064 | Ga0307408_1000160642 | 234 |
| 301 | 3300031901 | Ga0307406_10129847 | Ga0307406_101298471 | 234 |
| 302 | 3300031903 | Ga0307407_10316655 | Ga0307407_103166551 | 234 |
| 303 | 3300031911 | Ga0307412_10080206 | Ga0307412_100802062 | 234 |
| 304 | 3300031995 | Ga0307409_100349400 | Ga0307409_1003494001 | 234 |
| 305 | 3300032005 | Ga0307411_10241669 | Ga0307411_102416691 | 234 |
| 306 | 3300035171 | Ga0373946_0276461 | Ga0373946_0276461_85_810 | 234 |
| 307 | 3300035725 | Ga0373947_0015502 | Ga0373947_0015502_3350_4060 | 234 |
| 308 | 3300045051 | Ga0451576_1194671 | Ga0451576_1194671_11_721 | 234 |
| 309 | 3300048904 | Ga0496101_0143833 | Ga0496101_0143833_545_1249 | 234 |
| 310 | 3300048905 | Ga0496102_0042682 | Ga0496102_0042682_730_1440 | 234 |
| 311 | 3300048907 | Ga0496104_0010994 | Ga0496104_0010994_6642_7346 | 234 |
| 312 | 3300048907 | Ga0496104_0032261 | Ga0496104_0032261_3349_4074 | 234 |
| 313 | 3300048908 | Ga0496105_0023298 | Ga0496105_0023298_1996_2721 | 234 |
| 314 | 3300048908 | Ga0496105_0326134 | Ga0496105_0326134_436_1146 | 234 |
| 315 | 3300048909 | Ga0496106_0035343 | Ga0496106_0035343_188_892 | 234 |
| 316 | 3300048910 | Ga0496107_0029675 | Ga0496107_0029675_1602_2327 | 234 |
| 317 | 3300048911 | Ga0496108_0006443 | Ga0496108_0006443_6490_7194 | 234 |
| 318 | 3300048911 | Ga0496108_0049980 | Ga0496108_0049980_1834_2544 | 234 |
| 319 | 3300048911 | Ga0496108_0056656 | Ga0496108_0056656_1281_1991 | 234 |
| 320 | 3300048912 | Ga0496109_0284139 | Ga0496109_0284139_101_805 | 234 |
| 321 | 3300048912 | Ga0496109_0609473 | Ga0496109_0609473_203_913 | 234 |
| 322 | 3300048913 | Ga0496110_0000816 | Ga0496110_0000816_2249_2953 | 234 |
| 323 | 3300048913 | Ga0496110_0363151 | Ga0496110_0363151_532_1242 | 234 |
| 324 | 3300048914 | Ga0496111_0001752 | Ga0496111_0001752_9916_10620 | 234 |
| 325 | 3300048915 | Ga0496112_0000213 | Ga0496112_0000213_13395_14099 | 234 |
| 326 | 3300048917 | Ga0496114_0037065 | Ga0496114_0037065_3150_3875 | 234 |
| 327 | 3300049576 | Ga0501040_0018715 | Ga0501040_0018715_3869_4579 | 234 |
| 328 | 3300049588 | Ga0501072_0359813 | Ga0501072_0359813_154_864 | 234 |
| 329 | 3300049592 | Ga0501076_0022769 | Ga0501076_0022769_1099_1809 | 234 |
| 330 | 3300049742 | Ga0501080_0354726 | Ga0501080_0354726_63_782 | 234 |
| 331 | 3300050491 | nmdc:mga00v17_383758_c1 | nmdc:mga00v17_383758_c1_37_750 | 234 |
| 332 | 3300050491 | nmdc:mga00v17_68436_c1 | nmdc:mga00v17_68436_c1_41_811 | 234 |
| 333 | 3300050493 | nmdc:mga0k408_11387_c1 | nmdc:mga0k408_11387_c1_3130_3900 | 234 |
| 334 | 3300050493 | nmdc:mga0k408_259444_c1 | nmdc:mga0k408_259444_c1_43_765 | 234 |
| 335 | 3300050493 | nmdc:mga0k408_7268_c1 | nmdc:mga0k408_7268_c1_3770_4480 | 234 |
| 336 | 3300050494 | nmdc:mga06z11_310129_c1 | nmdc:mga06z11_310129_c1_85_855 | 234 |
| 337 | 3300050494 | nmdc:mga06z11_55326_c1 | nmdc:mga06z11_55326_c1_343_1116 | 234 |
| 338 | 3300050495 | nmdc:mga04h51_10983_c1 | nmdc:mga04h51_10983_c1_291_1013 | 234 |
| 339 | 3300050496 | nmdc:mga07m45_15727_c1 | nmdc:mga07m45_15727_c1_1346_2116 | 234 |
| 340 | 3300050507 | nmdc:mga05p37_4420_c1 | nmdc:mga05p37_4420_c1_5779_6489 | 234 |
| 341 | 3300050507 | nmdc:mga05p37_625_c2 | nmdc:mga05p37_625_c2_12490_13305 | 234 |
| 342 | 3300050507 | nmdc:mga05p37_94334_c1 | nmdc:mga05p37_94334_c1_990_1700 | 234 |
| 343 | 3300050509 | nmdc:mga0qj67_8989_c1 | nmdc:mga0qj67_8989_c1_705_1415 | 234 |
| 344 | 3300050510 | nmdc:mga06r32_209832_c1 | nmdc:mga06r32_209832_c1_1071_1823 | 234 |
| 345 | 3300050510 | nmdc:mga06r32_49581_c1 | nmdc:mga06r32_49581_c1_658_1398 | 234 |
| 346 | 3300050510 | nmdc:mga06r32_65586_c1 | nmdc:mga06r32_65586_c1_232_942 | 234 |
| 347 | 3300050510 | nmdc:mga06r32_892667_c1 | nmdc:mga06r32_892667_c1_28_798 | 234 |
| 348 | 3300050511 | nmdc:mga08y16_112546_c1 | nmdc:mga08y16_112546_c1_401_1111 | 234 |
| 349 | 3300050511 | nmdc:mga08y16_3139_c1 | nmdc:mga08y16_3139_c1_12284_12994 | 234 |
| 350 | 3300050512 | nmdc:mga0n895_2195_c1 | nmdc:mga0n895_2195_c1_12938_13657 | 234 |
| 351 | 3300053103 | Ga0500555_000107 | Ga0500555_000107_6176_6889 | 234 |
| 352 | 3300053153 | Ga0500616_0001026 | Ga0500616_0001026_15895_16608 | 234 |
| 353 | 3300053730 | Ga0500645_000553 | Ga0500645_000553_2178_2891 | 234 |
| 354 | 3300054114 | Ga0501084_0668897 | Ga0501084_0668897_41_751 | 234 |
| 355 | 3300060353 | Ga0501082_0330155 | Ga0501082_0330155_155_874 | 234 |
| 356 | 3300061734 | Ga0530510_0014629 | Ga0530510_0014629_3383_4093 | 234 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2zfu-assembly2.cif.gz_B | structure of the methyltransferase-like domain of nucleomethylin | 0.7468 | 28 | 233 |
| 1wzn-assembly1.cif.gz_A | crystal structure of the sam-dependent methyltransferase from pyrococcus horikoshii ot3 | 0.7295 | 26 | 137 |
| 5wy0-assembly1.cif.gz_A | crystal structure of the methyltranferase domain of human hen1 in complex with adomet | 0.7184 | 31 | 233 |
| 8bii-assembly3.cif.gz_G-2 | o-methyltransferase plu4895 (mutant h229n) in complex with sah | 0.7178 | 29 | 234 |
| 2p7h-assembly1.cif.gz_A | crystal structure of a sam dependent methyl-transferase type 12 family protein (eca1738) from pectobacterium atrosepticum scri1043 at 1.85 a resolution | 0.7176 | 38 | 233 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9VBJ3_147_316_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8954 | 40 | 142 | 3.40.50.150 |
| af_Q80WQ4_26_187_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8696 | 37 | 136 | 3.40.50.150 |
| af_O44410_182_343_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8552 | 34 | 233 | 3.40.50.150 |
| af_Q7K2B0_198_358_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8409 | 34 | 233 | 3.40.50.150 |
| af_A0A0P0XBA9_4_117_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8397 | 72 | 233 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A832UUD1-F1-model_v4 | Class I SAM-dependent methyltransferase | 0.9283 | 9 | 234 |
GO:0008757
GO:0032259 |
| AF-A0A832UUD1-F1-model_v4 | Class I SAM-dependent methyltransferase | 0.8941 | 9 | 234 |
GO:0008757
GO:0032259 |
| AF-A0A016T679-F1-model_v4 | Ribosomal RNA-processing protein 8 (EC 2.1.1.-) | 0.8211 | 34 | 233 |
GO:0000183
GO:0005677 GO:0005730 GO:0006364 GO:0008168 GO:0032259 GO:0033553 GO:0035064 GO:0042149 GO:0046015 |
| AF-A0A3D2J1U9-F1-model_v4 | SAM-dependent methyltransferase | 0.8161 | 88 | 233 |
GO:0008757
GO:0032259 |
| AF-A0A7J4AA14-F1-model_v4 | Methyltransferase domain-containing protein | 0.8043 | 27 | 135 |
GO:0008757
GO:0032259 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar