F420657

General Info

Members Datasets Scaffolds Average Seq Length
356 193 356 238

Family's Representative Sequence

Representative Sequence 3300050495|nmdc:mga04h51_32151_c1|nmdc:mga04h51_32151_c1_74_946
Length 290
Sequence LAWNLPVVLAPLIATTLRPASWAYPGAEAPGLPGQNRNARIRRDARDSDNIPPMSGNAATPLKTGEYAERGDYHRQPDQAWDYLPTFLAKLEYVRGYLSALAPGTRVLDAGCGEGILVEEFAGRLAIEGVDPNYVSAHVRRASLLELPYGGGVFERVLCLDVLEHLTYEEQPRALAELHRVLAPSGELLVSSPNLAHLQSRVHFLLTGRLIRTASEIKHPGDRPIAEYLRLFERAGFVVVERRGIFPTVPVLTAWIRRRPAERAWLHRLLTRLIPVPGLAFLNLIRLRRA

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
122 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
127 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
128 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
129 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
130 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
131 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
132 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
133 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
138 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
139 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
140 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
141 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
142 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
143 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
144 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
145 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
146 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
147 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
148 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
154 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
166 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
167 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
168 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
169 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
170 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
171 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
172 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
173 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
174 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
175 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
176 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
183 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
184 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
185 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
186 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
187 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
188 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
189 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
190 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
191 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
192 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
193 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.24
Nodule 0
Rhizoplane 8.71
Rhizosphere 80.06
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10001426 3300005290 Bacteria 6615
2 Ga0065712_10148379 3300005290 Unclassified 1389
3 Ga0065715_10089094 3300005293 Bacteria 14501
4 Ga0065715_10157753 3300005293 Bacteria 1647
5 Ga0070683_100006066 3300005329 Bacteria 10132
6 Ga0070683_100009991 3300005329 Bacteria 8137
7 Ga0070683_100914841 3300005329 Bacteria 842
8 Ga0070670_100017474 3300005331 Bacteria 6153
9 Ga0070670_100020809 3300005331 Bacteria 5641
10 Ga0068869_100298508 3300005334 Bacteria 1300
11 Ga0068868_100597702 3300005338 Bacteria 977
12 Ga0070689_100218040 3300005340 Bacteria 1564
13 Ga0070668_100058776 3300005347 Bacteria 2975
14 Ga0070669_100000591 3300005353 Bacteria 26963
15 Ga0070675_100037009 3300005354 Bacteria 3973
16 Ga0070675_100194819 3300005354 Bacteria 1757
17 Ga0070671_100024766 3300005355 Bacteria 4915
18 Ga0070671_100179125 3300005355 Bacteria 1794
19 Ga0070674_100006875 3300005356 Bacteria 6667
20 Ga0070673_100005521 3300005364 Bacteria 8101
21 Ga0070673_100675026 3300005364 Unclassified 947
22 Ga0070688_100083639 3300005365 Bacteria 2071
23 Ga0070659_100185280 3300005366 Bacteria 1709
24 Ga0070659_100274989 3300005366 Bacteria 1400
25 Ga0070667_100191584 3300005367 Unclassified 1811
26 Ga0070667_100342002 3300005367 Unclassified 1353
27 Ga0070701_10110488 3300005438 Bacteria 1535
28 Ga0070711_100046400 3300005439 Unclassified 2960
29 Ga0070663_100048041 3300005455 Bacteria 3025
30 Ga0070663_100059271 3300005455 Bacteria 2751
31 Ga0070663_100068398 3300005455 Bacteria 2578
32 Ga0070663_100124514 3300005455 Bacteria 1951
33 Ga0070663_100777988 3300005455 Bacteria 819
34 Ga0070678_100167810 3300005456 Bacteria 1784
35 Ga0070678_100240950 3300005456 Bacteria 1512
36 Ga0070678_100301478 3300005456 Unclassified 1362
37 Ga0070678_100816791 3300005456 Bacteria 847
38 Ga0070662_100137546 3300005457 Bacteria 1890
39 Ga0070662_100319426 3300005457 Bacteria 1266
40 Ga0070662_100419144 3300005457 Bacteria 1107
41 Ga0070662_100521203 3300005457 Bacteria 993
42 Ga0068867_100186380 3300005459 Bacteria 1653
43 Ga0070685_10090468 3300005466 Bacteria 1851
44 Ga0070685_10096314 3300005466 Bacteria 1800
45 Ga0070685_10305040 3300005466 Bacteria 1074
46 Ga0070679_100224453 3300005530 Bacteria 1839
47 Ga0070684_100000794 3300005535 Bacteria 21947
48 Ga0070684_100058079 3300005535 Bacteria 3380
49 Ga0070684_100190455 3300005535 Bacteria 1866
50 Ga0070672_100004257 3300005543 Bacteria 9357
51 Ga0070672_100021194 3300005543 Unclassified 4751
52 Ga0070672_100118059 3300005543 Bacteria 2169
53 Ga0070672_100238479 3300005543 Unclassified 1529
54 Ga0070686_100189997 3300005544 Bacteria 1465
55 Ga0070696_100261301 3300005546 Bacteria 1313
56 Ga0070665_100173543 3300005548 Bacteria 2157
57 Ga0070665_100483603 3300005548 Bacteria 1249
58 Ga0070664_100099364 3300005564 Unclassified 2529
59 Ga0070664_100285785 3300005564 Bacteria 1488
60 Ga0068857_100011444 3300005577 Bacteria 7720
61 Ga0068857_100246983 3300005577 Bacteria 1635
62 Ga0068854_100102538 3300005578 Bacteria 2147
63 Ga0070702_100140405 3300005615 Bacteria 1538
64 Ga0068852_100031548 3300005616 Bacteria 4375
65 Ga0068859_100438330 3300005617 Bacteria 1403
66 Ga0068864_100003748 3300005618 Bacteria 12551
67 Ga0068866_10146413 3300005718 Unclassified 1362
68 Ga0068861_100042493 3300005719 Unclassified 3407
69 Ga0068870_10149361 3300005840 Bacteria 1375
70 Ga0068863_100080040 3300005841 Bacteria 3095
71 Ga0068863_100181637 3300005841 Bacteria 2020
72 Ga0068858_100037953 3300005842 Bacteria 4468
73 Ga0068858_100780323 3300005842 Unclassified 932
74 Ga0068860_100096141 3300005843 Bacteria 2824
75 Ga0068860_100451431 3300005843 Bacteria 1278
76 Ga0068862_100075382 3300005844 Bacteria 2918
77 Ga0068862_100156555 3300005844 Bacteria 2031
78 Ga0068862_100377822 3300005844 Bacteria 1321
79 Ga0075368_10007991 3300006042 Bacteria 3752
80 Ga0075368_10075548 3300006042 Bacteria 1366
81 Ga0075363_100017770 3300006048 Bacteria 3532
82 Ga0075364_10023220 3300006051 Bacteria 3925
83 Ga0075364_10180484 3300006051 Bacteria 1428
84 Ga0075364_10180814 3300006051 Unclassified 1427
85 Ga0075362_10000172 3300006177 Bacteria 17809
86 Ga0075367_10001714 3300006178 Bacteria 9599
87 Ga0075367_10118580 3300006178 Bacteria 1629
88 Ga0075367_10124036 3300006178 Unclassified 1593
89 Ga0075366_10010371 3300006195 Bacteria 5231
90 Ga0075366_10019756 3300006195 Bacteria 3904
91 Ga0075366_10040428 3300006195 Bacteria 2758
92 Ga0075366_10040638 3300006195 Bacteria 2751
93 Ga0097621_100112057 3300006237 Unclassified 2306
94 Ga0097621_100122902 3300006237 Unclassified 2203
95 Ga0097621_100123938 3300006237 Bacteria 2194
96 Ga0075370_10019409 3300006353 Bacteria 3702
97 Ga0075370_10023058 3300006353 Bacteria 3424
98 Ga0075370_10200358 3300006353 Unclassified 1177
99 Ga0068871_100457489 3300006358 Bacteria 1145
100 Ga0075428_100052367 3300006844 Unclassified 4474
101 Ga0075428_100082046 3300006844 Bacteria 3518
102 Ga0075428_100309227 3300006844 Bacteria 1699
103 Ga0075430_100214823 3300006846 Bacteria 1596
104 Ga0075430_100649257 3300006846 Unclassified 870
105 Ga0075431_100046933 3300006847 Unclassified 4454
106 Ga0075431_100104348 3300006847 Bacteria 2925
107 Ga0075431_100588037 3300006847 Bacteria 1098
108 Ga0075433_10065901 3300006852 Unclassified 3177
109 Ga0075434_100036651 3300006871 Bacteria 4852
110 Ga0068865_100046035 3300006881 Unclassified 2992
111 Ga0068865_100077126 3300006881 Unclassified 2380
112 Ga0097620_100230264 3300006931 Unclassified 1941
113 Ga0097620_100438378 3300006931 Bacteria 1403
114 Ga0097620_100928278 3300006931 Bacteria 954
115 Ga0075435_100007573 3300007076 Bacteria 7754
116 Ga0105240_10060893 3300009093 Bacteria 4705
117 Ga0111539_10007621 3300009094 Bacteria 13832
118 Ga0111539_10034317 3300009094 Bacteria 6154
119 Ga0111539_10052174 3300009094 Bacteria 4868
120 Ga0105245_10051387 3300009098 Unclassified 3695
121 Ga0114129_10003376 3300009147 Bacteria 22429
122 Ga0114129_10063604 3300009147 Bacteria 5152
123 Ga0105243_10086638 3300009148 Unclassified 2569
124 Ga0105243_10133631 3300009148 Unclassified 2108
125 Ga0105242_10208677 3300009176 Unclassified 1739
126 Ga0105242_10753114 3300009176 Bacteria 959
127 Ga0105248_10011919 3300009177 Bacteria 9587
128 Ga0105248_10030443 3300009177 Bacteria 6025
129 Ga0105248_10137826 3300009177 Unclassified 2753
130 Ga0105248_11141528 3300009177 Bacteria 881
131 Ga0105249_10005392 3300009553 Bacteria 11041
132 Ga0105249_10047632 3300009553 Bacteria 3906
133 Ga0105246_10237183 3300011119 Bacteria 1440
134 Ga0157374_10007676 3300013296 Bacteria 9210
135 Ga0157374_10207361 3300013296 Bacteria 1921
136 Ga0157375_10011766 3300013308 Bacteria 7737
137 Ga0157375_10175910 3300013308 Bacteria 2290
138 Ga0163163_10000071 3300014325 Bacteria 112778
139 Ga0163163_10039373 3300014325 Unclassified 4613
140 Ga0163163_10050297 3300014325 Bacteria 4104
141 Ga0163163_10120454 3300014325 Bacteria 2658
142 Ga0157376_10005550 3300014969 Bacteria 8822
143 Ga0157376_10171589 3300014969 Bacteria 1976
144 Ga0157376_10430180 3300014969 Bacteria 1283
145 Ga0163161_10006816 3300017792 Bacteria 7899
146 Ga0207697_10001192 3300025315 Bacteria 14265
147 Ga0207697_10094932 3300025315 Unclassified 1267
148 Ga0207656_10146830 3300025321 Bacteria 1114
149 Ga0207682_10023014 3300025893 Bacteria 2459
150 Ga0207642_10047091 3300025899 Unclassified 1926
151 Ga0207688_10001657 3300025901 Bacteria 11775
152 Ga0207680_10232202 3300025903 Bacteria 1268
153 Ga0207643_10141035 3300025908 Bacteria 1440
154 Ga0207695_10144431 3300025913 Bacteria 2325
155 Ga0207663_10091444 3300025916 Unclassified 2020
156 Ga0207681_10008075 3300025923 Bacteria 6440
157 Ga0207681_10078292 3300025923 Bacteria 2326
158 Ga0207681_10273611 3300025923 Unclassified 1327
159 Ga0207650_10004419 3300025925 Bacteria 9604
160 Ga0207650_10059042 3300025925 Bacteria 2858
161 Ga0207650_10077802 3300025925 Bacteria 2508
162 Ga0207659_10022055 3300025926 Bacteria 4237
163 Ga0207659_10035620 3300025926 Bacteria 3442
164 Ga0207659_10054761 3300025926 Bacteria 2850
165 Ga0207659_10570384 3300025926 Bacteria 963
166 Ga0207687_10065291 3300025927 Unclassified 2584
167 Ga0207700_10043891 3300025928 Bacteria 3287
168 Ga0207644_10104618 3300025931 Bacteria 2131
169 Ga0207690_10380786 3300025932 Bacteria 1121
170 Ga0207706_10048109 3300025933 Bacteria 3772
171 Ga0207706_10186854 3300025933 Bacteria 1819
172 Ga0207686_10188022 3300025934 Unclassified 1470
173 Ga0207709_10455884 3300025935 Bacteria 989
174 Ga0207670_10060210 3300025936 Bacteria 2586
175 Ga0207669_10004380 3300025937 Bacteria 6210
176 Ga0207691_10009602 3300025940 Bacteria 9285
177 Ga0207691_10018514 3300025940 Bacteria 6600
178 Ga0207691_10058361 3300025940 Bacteria 3510
179 Ga0207691_10268287 3300025940 Unclassified 1470
180 Ga0207711_10077056 3300025941 Unclassified 2905
181 Ga0207711_10175518 3300025941 Unclassified 1946
182 Ga0207711_10187316 3300025941 Bacteria 1884
183 Ga0207689_10054112 3300025942 Bacteria 3306
184 Ga0207661_10012911 3300025944 Bacteria 6091
185 Ga0207661_10573852 3300025944 Bacteria 1034
186 Ga0207661_10693696 3300025944 Bacteria 936
187 Ga0207679_10013518 3300025945 Bacteria 5351
188 Ga0207679_10429572 3300025945 Bacteria 1167
189 Ga0207651_10045802 3300025960 Bacteria 2936
190 Ga0207651_10574170 3300025960 Unclassified 983
191 Ga0207712_10167266 3300025961 Bacteria 1715
192 Ga0207712_10339464 3300025961 Bacteria 1245
193 Ga0207668_10045042 3300025972 Bacteria 3006
194 Ga0207668_10186661 3300025972 Bacteria 1640
195 Ga0207668_10254985 3300025972 Bacteria 1427
196 Ga0207668_10293485 3300025972 Unclassified 1339
197 Ga0207640_10080928 3300025981 Bacteria 2219
198 Ga0207640_10513119 3300025981 Bacteria 1000
199 Ga0207658_10202314 3300025986 Bacteria 1659
200 Ga0207677_10029854 3300026023 Unclassified 3471
201 Ga0207677_10103814 3300026023 Bacteria 2099
202 Ga0207677_10172005 3300026023 Bacteria 1695
203 Ga0207703_10220450 3300026035 Bacteria 1696
204 Ga0207678_10042956 3300026067 Bacteria 3913
205 Ga0207678_10062582 3300026067 Bacteria 3198
206 Ga0207678_10068105 3300026067 Bacteria 3055
207 Ga0207678_10093767 3300026067 Unclassified 2565
208 Ga0207678_10703105 3300026067 Bacteria 890
209 Ga0207641_10118241 3300026088 Unclassified 2361
210 Ga0207648_10028213 3300026089 Bacteria 4978
211 Ga0207648_10075461 3300026089 Bacteria 2939
212 Ga0207676_10017916 3300026095 Bacteria 5139
213 Ga0207676_10117993 3300026095 Unclassified 2233
214 Ga0207674_10017837 3300026116 Bacteria 7737
215 Ga0207674_10084373 3300026116 Bacteria 3175
216 Ga0207675_100022178 3300026118 Bacteria 5912
217 Ga0207683_10091622 3300026121 Bacteria 2708
218 Ga0207683_10201763 3300026121 Unclassified 1808
219 Ga0207683_10220917 3300026121 Bacteria 1726
220 Ga0207683_10265299 3300026121 Bacteria 1568
221 Ga0207683_10268713 3300026121 Bacteria 1558
222 Ga0207698_10039891 3300026142 Unclassified 3482
223 Ga0209971_1027381 3300027682 Bacteria 1364
224 Ga0207428_10004122 3300027907 Bacteria 13931
225 Ga0207428_10021671 3300027907 Bacteria 5437
226 Ga0207428_10032055 3300027907 Bacteria 4327
227 Ga0268266_10138814 3300028379 Bacteria 2180
228 Ga0268266_10434785 3300028379 Bacteria 1245
229 Ga0268265_10072277 3300028380 Bacteria 2690
230 Ga0307408_100016064 3300031548 Bacteria 4991
231 Ga0307408_100447506 3300031548 Unclassified 1120
232 Ga0307406_10129847 3300031901 Unclassified 1767
233 Ga0307407_10316655 3300031903 Unclassified 1093
234 Ga0307412_10080206 3300031911 Unclassified 2254
235 Ga0307409_100349400 3300031995 Bacteria 1395
236 Ga0307416_100705693 3300032002 Unclassified 1098
237 Ga0307411_10241669 3300032005 Unclassified 1414
238 Ga0373934_0017983 3300035086 Bacteria 2702
239 Ga0373934_0189481 3300035086 Bacteria 846
240 Ga0373956_0006502 3300035119 Bacteria 4684
241 Ga0373957_0232250 3300035120 Bacteria 774
242 Ga0373946_0276461 3300035171 Bacteria 825
243 Ga0373955_0001722 3300035172 Bacteria 9366
244 Ga0373955_0164766 3300035172 Unclassified 1310
245 Ga0373933_0014341 3300035724 Bacteria 4406
246 Ga0373947_0015502 3300035725 Bacteria 4378
247 Ga0373947_0159285 3300035725 Bacteria 1459
248 Ga0373937_0002816 3300036401 Bacteria 14530
249 Ga0373937_0009769 3300036401 Bacteria 8365
250 Ga0373937_0102218 3300036401 Bacteria 2661
251 Ga0373937_0482721 3300036401 Unclassified 1177
252 Ga0373925_0005688 3300037068 Bacteria 9267
253 Ga0373925_0305117 3300037068 Bacteria 1286
254 Ga0395905_0315761 3300037471 Unclassified 1452
255 Ga0450920_001817 3300042122 Bacteria 3578
256 Ga0450894_001967 3300042131 Bacteria 2835
257 Ga0450898_002120 3300042134 Bacteria 2737
258 Ga0450908_003328 3300042184 Unclassified 3125
259 Ga0450908_009422 3300042184 Bacteria 1813
260 Ga0450918_007598 3300042531 Bacteria 1915
261 Ga0453683_0156941 3300044673 Bacteria 1439
262 Ga0451576_1194671 3300045051 Unclassified 794
263 Ga0495638_0012848 3300046460 Bacteria 5722
264 Ga0495651_0084759 3300046462 Bacteria 2387
265 Ga0495613_0108219 3300046689 Bacteria 2005
266 Ga0495680_0063257 3300047322 Unclassified 2842
267 Ga0495680_0381494 3300047322 Unclassified 976
268 Ga0496101_0089408 3300048904 Bacteria 2289
269 Ga0496101_0143833 3300048904 Bacteria 1820
270 Ga0496102_0042682 3300048905 Bacteria 4110
271 Ga0496102_0189604 3300048905 Bacteria 1937
272 Ga0496104_0010994 3300048907 Bacteria 8098
273 Ga0496104_0032261 3300048907 Bacteria 4874
274 Ga0496104_0091142 3300048907 Bacteria 2913
275 Ga0496105_0023298 3300048908 Bacteria 5019
276 Ga0496105_0035576 3300048908 Bacteria 4099
277 Ga0496105_0326134 3300048908 Bacteria 1230
278 Ga0496106_0035343 3300048909 Bacteria 3737
279 Ga0496106_0163999 3300048909 Bacteria 1758
280 Ga0496107_0029675 3300048910 Unclassified 3893
281 Ga0496108_0006443 3300048911 Bacteria 9514
282 Ga0496108_0049980 3300048911 Bacteria 3499
283 Ga0496108_0056656 3300048911 Bacteria 3294
284 Ga0496108_0105465 3300048911 Bacteria 2406
285 Ga0496109_0036296 3300048912 Bacteria 4448
286 Ga0496109_0284139 3300048912 Bacteria 1559
287 Ga0496109_0609473 3300048912 Bacteria 1028
288 Ga0496110_0000816 3300048913 Bacteria 21833
289 Ga0496110_0034547 3300048913 Bacteria 4380
290 Ga0496110_0350436 3300048913 Bacteria 1345
291 Ga0496110_0363151 3300048913 Bacteria 1319
292 Ga0496111_0001752 3300048914 Bacteria 12708
293 Ga0496112_0000213 3300048915 Bacteria 37294
294 Ga0496112_0030034 3300048915 Bacteria 5259
295 Ga0496112_0062483 3300048915 Bacteria 3673
296 Ga0496113_0004934 3300048916 Bacteria 8262
297 Ga0496114_0037065 3300048917 Bacteria 4032
298 Ga0496114_0276933 3300048917 Bacteria 1479
299 Ga0501034_0010143 3300049571 Bacteria 9829
300 Ga0501040_0018715 3300049576 Bacteria 4600
301 Ga0501041_0550488 3300049577 Unclassified 735
302 Ga0501042_0681891 3300049578 Unclassified 747
303 Ga0501072_0359813 3300049588 Bacteria 1155
304 Ga0501073_0436588 3300049589 Bacteria 905
305 Ga0501076_0022769 3300049592 Bacteria 4818
306 Ga0501079_0764974 3300049741 Unclassified 760
307 Ga0501080_0354726 3300049742 Bacteria 1324
308 nmdc:mga03683_650_c1 3300050489 Bacteria 9969
309 nmdc:mga03n38_263971_c1 3300050490 Unclassified 914
310 nmdc:mga00v17_2930_c1 3300050491 Bacteria 8751
311 nmdc:mga00v17_383758_c1 3300050491 Bacteria 913
312 nmdc:mga00v17_68436_c1 3300050491 Bacteria 2195
313 nmdc:mga0k408_11387_c1 3300050493 Bacteria 4843
314 nmdc:mga0k408_241842_c1 3300050493 Bacteria 1078
315 nmdc:mga0k408_259444_c1 3300050493 Bacteria 1038
316 nmdc:mga0k408_400915_c1 3300050493 Unclassified 816
317 nmdc:mga0k408_6654_c1 3300050493 Bacteria 6163
318 nmdc:mga0k408_7268_c1 3300050493 Bacteria 5918
319 nmdc:mga06z11_101861_c1 3300050494 Unclassified 1577
320 nmdc:mga06z11_310129_c1 3300050494 Archaea 940
321 nmdc:mga06z11_31891_c1 3300050494 Bacteria 2565
322 nmdc:mga06z11_3976_c1 3300050494 Bacteria 5765
323 nmdc:mga06z11_55326_c1 3300050494 Bacteria 2048
324 nmdc:mga04h51_10983_c1 3300050495 Bacteria 2503
325 nmdc:mga04h51_32151_c1 3300050495 Unclassified 1662
326 nmdc:mga07m45_15727_c1 3300050496 Bacteria 4042
327 nmdc:mga07m45_29063_c1 3300050496 Bacteria 3054
328 nmdc:mga05p37_11149_c1 3300050507 Bacteria 10681
329 nmdc:mga05p37_4420_c1 3300050507 Bacteria 16424
330 nmdc:mga05p37_625_c2 3300050507 Bacteria 19945
331 nmdc:mga05p37_94334_c1 3300050507 Bacteria 3687
332 nmdc:mga0qj67_575340_c1 3300050509 Unclassified 902
333 nmdc:mga0qj67_8989_c1 3300050509 Bacteria 7411
334 nmdc:mga06r32_209832_c1 3300050510 Unclassified 1935
335 nmdc:mga06r32_49581_c1 3300050510 Bacteria 4015
336 nmdc:mga06r32_65586_c1 3300050510 Bacteria 3503
337 nmdc:mga06r32_892667_c1 3300050510 Bacteria 846
338 nmdc:mga08y16_112546_c1 3300050511 Bacteria 2833
339 nmdc:mga08y16_1617_c1 3300050511 Bacteria 22810
340 nmdc:mga08y16_3139_c1 3300050511 Bacteria 17106
341 nmdc:mga0n895_2195_c1 3300050512 Bacteria 15101
342 nmdc:mga0n895_8924_c1 3300050512 Bacteria 8736
343 nmdc:mga0a205_150419_c1 3300050515 Unclassified 2228
344 nmdc:mga0a205_437468_c1 3300050515 Bacteria 1169
345 Ga0495595_0119927 3300053084 Bacteria 1281
346 Ga0495619_0030965 3300053085 Bacteria 3465
347 Ga0495619_0147478 3300053085 Bacteria 1622
348 Ga0500555_000107 3300053103 Bacteria 39405
349 Ga0500616_0001026 3300053153 Bacteria 29622
350 Ga0500645_000553 3300053730 Bacteria 24693
351 Ga0501084_0668897 3300054114 Bacteria 876
352 Ga0590071_000557 3300059421 Bacteria 10786
353 Ga0590075_002743 3300059424 Bacteria 4218
354 Ga0590077_000276 3300059426 Bacteria 14588
355 Ga0501082_0330155 3300060353 Bacteria 1329
356 Ga0530510_0014629 3300061734 Bacteria 5539

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005290 Ga0065712_10148379 Ga0065712_101483792 229
2 3300005293 Ga0065715_10089094 Ga0065715_100890948 229
3 3300005331 Ga0070670_100020809 Ga0070670_1000208092 229
4 3300005334 Ga0068869_100298508 Ga0068869_1002985082 229
5 3300005340 Ga0070689_100218040 Ga0070689_1002180402 229
6 3300005347 Ga0070668_100058776 Ga0070668_1000587763 229
7 3300005354 Ga0070675_100037009 Ga0070675_1000370092 229
8 3300005364 Ga0070673_100005521 Ga0070673_1000055212 229
9 3300005367 Ga0070667_100342002 Ga0070667_1003420022 229
10 3300005457 Ga0070662_100137546 Ga0070662_1001375462 229
11 3300005459 Ga0068867_100186380 Ga0068867_1001863801 229
12 3300005466 Ga0070685_10090468 Ga0070685_100904682 229
13 3300005543 Ga0070672_100004257 Ga0070672_1000042577 229
14 3300005546 Ga0070696_100261301 Ga0070696_1002613012 229
15 3300005615 Ga0070702_100140405 Ga0070702_1001404051 229
16 3300005618 Ga0068864_100003748 Ga0068864_1000037486 229
17 3300005840 Ga0068870_10149361 Ga0068870_101493612 229
18 3300005844 Ga0068862_100156555 Ga0068862_1001565552 229
19 3300009177 Ga0105248_10030443 Ga0105248_100304432 229
20 3300009553 Ga0105249_10047632 Ga0105249_100476323 229
21 3300011119 Ga0105246_10237183 Ga0105246_102371832 229
22 3300025908 Ga0207643_10141035 Ga0207643_101410352 229
23 3300025923 Ga0207681_10078292 Ga0207681_100782922 229
24 3300025926 Ga0207659_10022055 Ga0207659_100220553 229
25 3300025933 Ga0207706_10048109 Ga0207706_100481092 229
26 3300025935 Ga0207709_10455884 Ga0207709_104558842 229
27 3300025936 Ga0207670_10060210 Ga0207670_100602102 229
28 3300025940 Ga0207691_10009602 Ga0207691_100096023 229
29 3300025941 Ga0207711_10187316 Ga0207711_101873163 229
30 3300025960 Ga0207651_10045802 Ga0207651_100458022 229
31 3300025961 Ga0207712_10167266 Ga0207712_101672662 229
32 3300025972 Ga0207668_10045042 Ga0207668_100450423 229
33 3300025986 Ga0207658_10202314 Ga0207658_102023142 229
34 3300026023 Ga0207677_10103814 Ga0207677_101038143 229
35 3300026035 Ga0207703_10220450 Ga0207703_102204502 229
36 3300026089 Ga0207648_10075461 Ga0207648_100754614 229
37 3300026095 Ga0207676_10017916 Ga0207676_100179163 229
38 3300026121 Ga0207683_10091622 Ga0207683_100916222 229
39 3300028379 Ga0268266_10434785 Ga0268266_104347851 229
40 3300028380 Ga0268265_10072277 Ga0268265_100722774 229
41 3300048904 Ga0496101_0089408 Ga0496101_0089408_798_1505 229
42 3300048905 Ga0496102_0189604 Ga0496102_0189604_721_1428 229
43 3300048907 Ga0496104_0091142 Ga0496104_0091142_514_1221 229
44 3300048908 Ga0496105_0035576 Ga0496105_0035576_439_1146 229
45 3300048909 Ga0496106_0163999 Ga0496106_0163999_229_936 229
46 3300048911 Ga0496108_0105465 Ga0496108_0105465_1053_1760 229
47 3300048912 Ga0496109_0036296 Ga0496109_0036296_2957_3664 229
48 3300048913 Ga0496110_0034547 Ga0496110_0034547_2982_3689 229
49 3300048915 Ga0496112_0062483 Ga0496112_0062483_692_1399 229
50 3300048916 Ga0496113_0004934 Ga0496113_0004934_2427_3134 229
51 3300005338 Ga0068868_100597702 Ga0068868_1005977021 230
52 3300005355 Ga0070671_100024766 Ga0070671_1000247664 230
53 3300005455 Ga0070663_100048041 Ga0070663_1000480412 230
54 3300005455 Ga0070663_100124514 Ga0070663_1001245143 230
55 3300005456 Ga0070678_100167810 Ga0070678_1001678102 230
56 3300005548 Ga0070665_100173543 Ga0070665_1001735432 230
57 3300005841 Ga0068863_100080040 Ga0068863_1000800402 230
58 3300006195 Ga0075366_10040638 Ga0075366_100406384 230
59 3300009094 Ga0111539_10052174 Ga0111539_100521742 230
60 3300014325 Ga0163163_10050297 Ga0163163_100502972 230
61 3300025893 Ga0207682_10023014 Ga0207682_100230142 230
62 3300025926 Ga0207659_10035620 Ga0207659_100356202 230
63 3300025940 Ga0207691_10018514 Ga0207691_100185143 230
64 3300025981 Ga0207640_10080928 Ga0207640_100809282 230
65 3300026023 Ga0207677_10172005 Ga0207677_101720052 230
66 3300026067 Ga0207678_10042956 Ga0207678_100429563 230
67 3300026067 Ga0207678_10062582 Ga0207678_100625823 230
68 3300026121 Ga0207683_10265299 Ga0207683_102652993 230
69 3300027907 Ga0207428_10021671 Ga0207428_100216713 230
70 3300028379 Ga0268266_10138814 Ga0268266_101388142 230
71 3300032002 Ga0307416_100705693 Ga0307416_1007056932 230
72 3300042122 Ga0450920_001817 Ga0450920_001817_2671_3372 230
73 3300042131 Ga0450894_001967 Ga0450894_001967_891_1592 230
74 3300042184 Ga0450908_003328 Ga0450908_003328_791_1492 230
75 3300048913 Ga0496110_0350436 Ga0496110_0350436_528_1229 230
76 3300049578 Ga0501042_0681891 Ga0501042_0681891_15_713 230
77 3300050493 nmdc:mga0k408_400915_c1 nmdc:mga0k408_400915_c1_50_751 230
78 3300050507 nmdc:mga05p37_11149_c1 nmdc:mga05p37_11149_c1_9944_10642 230
79 3300050511 nmdc:mga08y16_1617_c1 nmdc:mga08y16_1617_c1_95_793 230
80 3300050515 nmdc:mga0a205_437468_c1 nmdc:mga0a205_437468_c1_14_712 230
81 3300046689 Ga0495613_0108219 Ga0495613_0108219_14_718 231
82 3300005329 Ga0070683_100009991 Ga0070683_1000099915 232
83 3300005439 Ga0070711_100046400 Ga0070711_1000464002 232
84 3300005456 Ga0070678_100816791 Ga0070678_1008167911 232
85 3300005535 Ga0070684_100058079 Ga0070684_1000580793 232
86 3300005564 Ga0070664_100099364 Ga0070664_1000993643 232
87 3300005564 Ga0070664_100285785 Ga0070664_1002857852 232
88 3300005577 Ga0068857_100011444 Ga0068857_1000114447 232
89 3300005843 Ga0068860_100451431 Ga0068860_1004514312 232
90 3300006042 Ga0075368_10007991 Ga0075368_100079913 232
91 3300006048 Ga0075363_100017770 Ga0075363_1000177703 232
92 3300006051 Ga0075364_10023220 Ga0075364_100232201 232
93 3300006177 Ga0075362_10000172 Ga0075362_100001728 232
94 3300006178 Ga0075367_10001714 Ga0075367_100017142 232
95 3300006178 Ga0075367_10124036 Ga0075367_101240362 232
96 3300006195 Ga0075366_10019756 Ga0075366_100197565 232
97 3300006195 Ga0075366_10040428 Ga0075366_100404283 232
98 3300006237 Ga0097621_100123938 Ga0097621_1001239383 232
99 3300006353 Ga0075370_10019409 Ga0075370_100194092 232
100 3300006353 Ga0075370_10023058 Ga0075370_100230583 232
101 3300006844 Ga0075428_100082046 Ga0075428_1000820462 232
102 3300006846 Ga0075430_100214823 Ga0075430_1002148232 232
103 3300006847 Ga0075431_100104348 Ga0075431_1001043484 232
104 3300006852 Ga0075433_10065901 Ga0075433_100659013 232
105 3300006871 Ga0075434_100036651 Ga0075434_1000366515 232
106 3300007076 Ga0075435_100007573 Ga0075435_1000075735 232
107 3300009093 Ga0105240_10060893 Ga0105240_100608933 232
108 3300009148 Ga0105243_10133631 Ga0105243_101336312 232
109 3300014325 Ga0163163_10000071 Ga0163163_1000007132 232
110 3300014969 Ga0157376_10171589 Ga0157376_101715892 232
111 3300025913 Ga0207695_10144431 Ga0207695_101444312 232
112 3300025916 Ga0207663_10091444 Ga0207663_100914443 232
113 3300025925 Ga0207650_10004419 Ga0207650_100044197 232
114 3300025928 Ga0207700_10043891 Ga0207700_100438911 232
115 3300025944 Ga0207661_10573852 Ga0207661_105738522 232
116 3300025945 Ga0207679_10013518 Ga0207679_100135183 232
117 3300025945 Ga0207679_10429572 Ga0207679_104295722 232
118 3300025972 Ga0207668_10186661 Ga0207668_101866612 232
119 3300026116 Ga0207674_10017837 Ga0207674_100178377 232
120 3300027907 Ga0207428_10032055 Ga0207428_100320554 232
121 3300035086 Ga0373934_0017983 Ga0373934_0017983_1541_2251 232
122 3300035086 Ga0373934_0189481 Ga0373934_0189481_115_819 232
123 3300035119 Ga0373956_0006502 Ga0373956_0006502_823_1533 232
124 3300035120 Ga0373957_0232250 Ga0373957_0232250_17_721 232
125 3300035172 Ga0373955_0001722 Ga0373955_0001722_7159_7869 232
126 3300035172 Ga0373955_0164766 Ga0373955_0164766_169_873 232
127 3300035724 Ga0373933_0014341 Ga0373933_0014341_1627_2337 232
128 3300035725 Ga0373947_0159285 Ga0373947_0159285_117_827 232
129 3300036401 Ga0373937_0002816 Ga0373937_0002816_5623_6327 232
130 3300036401 Ga0373937_0009769 Ga0373937_0009769_2378_3088 232
131 3300036401 Ga0373937_0102218 Ga0373937_0102218_17_724 232
132 3300036401 Ga0373937_0482721 Ga0373937_0482721_186_896 232
133 3300037068 Ga0373925_0005688 Ga0373925_0005688_8092_8796 232
134 3300037068 Ga0373925_0305117 Ga0373925_0305117_221_928 232
135 3300037471 Ga0395905_0315761 Ga0395905_0315761_734_1441 232
136 3300044673 Ga0453683_0156941 Ga0453683_0156941_193_903 232
137 3300046462 Ga0495651_0084759 Ga0495651_0084759_1520_2230 232
138 3300047322 Ga0495680_0063257 Ga0495680_0063257_2001_2711 232
139 3300047322 Ga0495680_0381494 Ga0495680_0381494_124_834 232
140 3300048915 Ga0496112_0030034 Ga0496112_0030034_4503_5216 232
141 3300048917 Ga0496114_0276933 Ga0496114_0276933_162_872 232
142 3300049571 Ga0501034_0010143 Ga0501034_0010143_5918_6625 232
143 3300049589 Ga0501073_0436588 Ga0501073_0436588_114_821 232
144 3300050489 nmdc:mga03683_650_c1 nmdc:mga03683_650_c1_3744_4451 232
145 3300050490 nmdc:mga03n38_263971_c1 nmdc:mga03n38_263971_c1_194_901 232
146 3300050491 nmdc:mga00v17_2930_c1 nmdc:mga00v17_2930_c1_3058_3765 232
147 3300050493 nmdc:mga0k408_241842_c1 nmdc:mga0k408_241842_c1_151_858 232
148 3300050493 nmdc:mga0k408_6654_c1 nmdc:mga0k408_6654_c1_5114_5821 232
149 3300050494 nmdc:mga06z11_101861_c1 nmdc:mga06z11_101861_c1_268_975 232
150 3300050494 nmdc:mga06z11_31891_c1 nmdc:mga06z11_31891_c1_882_1589 232
151 3300050494 nmdc:mga06z11_3976_c1 nmdc:mga06z11_3976_c1_4218_4925 232
152 3300050496 nmdc:mga07m45_29063_c1 nmdc:mga07m45_29063_c1_1287_1994 232
153 3300050512 nmdc:mga0n895_8924_c1 nmdc:mga0n895_8924_c1_5600_6304 232
154 3300050515 nmdc:mga0a205_150419_c1 nmdc:mga0a205_150419_c1_944_1648 232
155 3300053084 Ga0495595_0119927 Ga0495595_0119927_281_988 232
156 3300053085 Ga0495619_0030965 Ga0495619_0030965_774_1481 232
157 3300053085 Ga0495619_0147478 Ga0495619_0147478_568_1278 232
158 3300006846 Ga0075430_100649257 Ga0075430_1006492572 233
159 3300031548 Ga0307408_100447506 Ga0307408_1004475062 233
160 3300042134 Ga0450898_002120 Ga0450898_002120_390_1100 233
161 3300042184 Ga0450908_009422 Ga0450908_009422_622_1332 233
162 3300042531 Ga0450918_007598 Ga0450918_007598_32_742 233
163 3300046460 Ga0495638_0012848 Ga0495638_0012848_483_1199 233
164 3300049577 Ga0501041_0550488 Ga0501041_0550488_13_720 233
165 3300049741 Ga0501079_0764974 Ga0501079_0764974_22_729 233
166 3300050495 nmdc:mga04h51_32151_c1 nmdc:mga04h51_32151_c1_74_946 233
167 3300050509 nmdc:mga0qj67_575340_c1 nmdc:mga0qj67_575340_c1_177_884 233
168 3300059421 Ga0590071_000557 Ga0590071_000557_4894_5601 233
169 3300059424 Ga0590075_002743 Ga0590075_002743_2634_3341 233
170 3300059426 Ga0590077_000276 Ga0590077_000276_8250_8957 233
171 3300005290 Ga0065712_10001426 Ga0065712_100014262 234
172 3300005293 Ga0065715_10157753 Ga0065715_101577531 234
173 3300005329 Ga0070683_100006066 Ga0070683_1000060663 234
174 3300005329 Ga0070683_100914841 Ga0070683_1009148411 234
175 3300005331 Ga0070670_100017474 Ga0070670_1000174746 234
176 3300005353 Ga0070669_100000591 Ga0070669_10000059110 234
177 3300005354 Ga0070675_100194819 Ga0070675_1001948192 234
178 3300005355 Ga0070671_100179125 Ga0070671_1001791252 234
179 3300005356 Ga0070674_100006875 Ga0070674_1000068753 234
180 3300005364 Ga0070673_100675026 Ga0070673_1006750262 234
181 3300005365 Ga0070688_100083639 Ga0070688_1000836392 234
182 3300005366 Ga0070659_100185280 Ga0070659_1001852802 234
183 3300005366 Ga0070659_100274989 Ga0070659_1002749892 234
184 3300005367 Ga0070667_100191584 Ga0070667_1001915842 234
185 3300005438 Ga0070701_10110488 Ga0070701_101104881 234
186 3300005455 Ga0070663_100059271 Ga0070663_1000592712 234
187 3300005455 Ga0070663_100068398 Ga0070663_1000683982 234
188 3300005455 Ga0070663_100777988 Ga0070663_1007779881 234
189 3300005456 Ga0070678_100240950 Ga0070678_1002409501 234
190 3300005456 Ga0070678_100301478 Ga0070678_1003014782 234
191 3300005457 Ga0070662_100319426 Ga0070662_1003194262 234
192 3300005457 Ga0070662_100419144 Ga0070662_1004191442 234
193 3300005457 Ga0070662_100521203 Ga0070662_1005212031 234
194 3300005466 Ga0070685_10096314 Ga0070685_100963142 234
195 3300005466 Ga0070685_10305040 Ga0070685_103050402 234
196 3300005530 Ga0070679_100224453 Ga0070679_1002244532 234
197 3300005535 Ga0070684_100000794 Ga0070684_1000007942 234
198 3300005535 Ga0070684_100190455 Ga0070684_1001904552 234
199 3300005543 Ga0070672_100021194 Ga0070672_1000211943 234
200 3300005543 Ga0070672_100118059 Ga0070672_1001180592 234
201 3300005543 Ga0070672_100238479 Ga0070672_1002384792 234
202 3300005544 Ga0070686_100189997 Ga0070686_1001899971 234
203 3300005548 Ga0070665_100483603 Ga0070665_1004836032 234
204 3300005577 Ga0068857_100246983 Ga0068857_1002469832 234
205 3300005578 Ga0068854_100102538 Ga0068854_1001025383 234
206 3300005616 Ga0068852_100031548 Ga0068852_1000315482 234
207 3300005617 Ga0068859_100438330 Ga0068859_1004383301 234
208 3300005718 Ga0068866_10146413 Ga0068866_101464132 234
209 3300005719 Ga0068861_100042493 Ga0068861_1000424932 234
210 3300005841 Ga0068863_100181637 Ga0068863_1001816372 234
211 3300005842 Ga0068858_100037953 Ga0068858_1000379534 234
212 3300005842 Ga0068858_100780323 Ga0068858_1007803232 234
213 3300005843 Ga0068860_100096141 Ga0068860_1000961412 234
214 3300005844 Ga0068862_100075382 Ga0068862_1000753822 234
215 3300005844 Ga0068862_100377822 Ga0068862_1003778222 234
216 3300006042 Ga0075368_10075548 Ga0075368_100755482 234
217 3300006051 Ga0075364_10180484 Ga0075364_101804842 234
218 3300006051 Ga0075364_10180814 Ga0075364_101808142 234
219 3300006178 Ga0075367_10118580 Ga0075367_101185802 234
220 3300006195 Ga0075366_10010371 Ga0075366_100103714 234
221 3300006237 Ga0097621_100112057 Ga0097621_1001120572 234
222 3300006237 Ga0097621_100122902 Ga0097621_1001229022 234
223 3300006353 Ga0075370_10200358 Ga0075370_102003582 234
224 3300006358 Ga0068871_100457489 Ga0068871_1004574891 234
225 3300006844 Ga0075428_100052367 Ga0075428_1000523672 234
226 3300006844 Ga0075428_100309227 Ga0075428_1003092272 234
227 3300006847 Ga0075431_100046933 Ga0075431_1000469332 234
228 3300006847 Ga0075431_100588037 Ga0075431_1005880371 234
229 3300006881 Ga0068865_100046035 Ga0068865_1000460353 234
230 3300006881 Ga0068865_100077126 Ga0068865_1000771263 234
231 3300006931 Ga0097620_100230264 Ga0097620_1002302642 234
232 3300006931 Ga0097620_100438378 Ga0097620_1004383781 234
233 3300006931 Ga0097620_100928278 Ga0097620_1009282782 234
234 3300009094 Ga0111539_10007621 Ga0111539_100076215 234
235 3300009094 Ga0111539_10034317 Ga0111539_100343173 234
236 3300009098 Ga0105245_10051387 Ga0105245_100513872 234
237 3300009147 Ga0114129_10003376 Ga0114129_1000337617 234
238 3300009147 Ga0114129_10063604 Ga0114129_100636042 234
239 3300009148 Ga0105243_10086638 Ga0105243_100866383 234
240 3300009176 Ga0105242_10208677 Ga0105242_102086772 234
241 3300009176 Ga0105242_10753114 Ga0105242_107531142 234
242 3300009177 Ga0105248_10011919 Ga0105248_100119194 234
243 3300009177 Ga0105248_10137826 Ga0105248_101378262 234
244 3300009177 Ga0105248_11141528 Ga0105248_111415281 234
245 3300009553 Ga0105249_10005392 Ga0105249_100053922 234
246 3300013296 Ga0157374_10007676 Ga0157374_100076763 234
247 3300013296 Ga0157374_10207361 Ga0157374_102073611 234
248 3300013308 Ga0157375_10011766 Ga0157375_100117665 234
249 3300013308 Ga0157375_10175910 Ga0157375_101759102 234
250 3300014325 Ga0163163_10039373 Ga0163163_100393734 234
251 3300014325 Ga0163163_10120454 Ga0163163_101204542 234
252 3300014969 Ga0157376_10005550 Ga0157376_100055502 234
253 3300014969 Ga0157376_10430180 Ga0157376_104301802 234
254 3300017792 Ga0163161_10006816 Ga0163161_100068163 234
255 3300025315 Ga0207697_10001192 Ga0207697_100011928 234
256 3300025315 Ga0207697_10094932 Ga0207697_100949321 234
257 3300025321 Ga0207656_10146830 Ga0207656_101468302 234
258 3300025899 Ga0207642_10047091 Ga0207642_100470912 234
259 3300025901 Ga0207688_10001657 Ga0207688_100016578 234
260 3300025903 Ga0207680_10232202 Ga0207680_102322022 234
261 3300025923 Ga0207681_10008075 Ga0207681_100080752 234
262 3300025923 Ga0207681_10273611 Ga0207681_102736111 234
263 3300025925 Ga0207650_10059042 Ga0207650_100590423 234
264 3300025925 Ga0207650_10077802 Ga0207650_100778021 234
265 3300025926 Ga0207659_10054761 Ga0207659_100547612 234
266 3300025926 Ga0207659_10570384 Ga0207659_105703841 234
267 3300025927 Ga0207687_10065291 Ga0207687_100652912 234
268 3300025931 Ga0207644_10104618 Ga0207644_101046181 234
269 3300025932 Ga0207690_10380786 Ga0207690_103807862 234
270 3300025933 Ga0207706_10186854 Ga0207706_101868542 234
271 3300025934 Ga0207686_10188022 Ga0207686_101880222 234
272 3300025937 Ga0207669_10004380 Ga0207669_100043804 234
273 3300025940 Ga0207691_10058361 Ga0207691_100583613 234
274 3300025940 Ga0207691_10268287 Ga0207691_102682872 234
275 3300025941 Ga0207711_10077056 Ga0207711_100770562 234
276 3300025941 Ga0207711_10175518 Ga0207711_101755182 234
277 3300025942 Ga0207689_10054112 Ga0207689_100541123 234
278 3300025944 Ga0207661_10012911 Ga0207661_100129112 234
279 3300025944 Ga0207661_10693696 Ga0207661_106936961 234
280 3300025960 Ga0207651_10574170 Ga0207651_105741702 234
281 3300025961 Ga0207712_10339464 Ga0207712_103394641 234
282 3300025972 Ga0207668_10254985 Ga0207668_102549852 234
283 3300025972 Ga0207668_10293485 Ga0207668_102934852 234
284 3300025981 Ga0207640_10513119 Ga0207640_105131192 234
285 3300026023 Ga0207677_10029854 Ga0207677_100298542 234
286 3300026067 Ga0207678_10068105 Ga0207678_100681052 234
287 3300026067 Ga0207678_10093767 Ga0207678_100937672 234
288 3300026067 Ga0207678_10703105 Ga0207678_107031051 234
289 3300026088 Ga0207641_10118241 Ga0207641_101182412 234
290 3300026089 Ga0207648_10028213 Ga0207648_100282134 234
291 3300026095 Ga0207676_10117993 Ga0207676_101179932 234
292 3300026116 Ga0207674_10084373 Ga0207674_100843732 234
293 3300026118 Ga0207675_100022178 Ga0207675_1000221783 234
294 3300026121 Ga0207683_10201763 Ga0207683_102017632 234
295 3300026121 Ga0207683_10220917 Ga0207683_102209171 234
296 3300026121 Ga0207683_10268713 Ga0207683_102687131 234
297 3300026142 Ga0207698_10039891 Ga0207698_100398912 234
298 3300027682 Ga0209971_1027381 Ga0209971_10273812 234
299 3300027907 Ga0207428_10004122 Ga0207428_100041222 234
300 3300031548 Ga0307408_100016064 Ga0307408_1000160642 234
301 3300031901 Ga0307406_10129847 Ga0307406_101298471 234
302 3300031903 Ga0307407_10316655 Ga0307407_103166551 234
303 3300031911 Ga0307412_10080206 Ga0307412_100802062 234
304 3300031995 Ga0307409_100349400 Ga0307409_1003494001 234
305 3300032005 Ga0307411_10241669 Ga0307411_102416691 234
306 3300035171 Ga0373946_0276461 Ga0373946_0276461_85_810 234
307 3300035725 Ga0373947_0015502 Ga0373947_0015502_3350_4060 234
308 3300045051 Ga0451576_1194671 Ga0451576_1194671_11_721 234
309 3300048904 Ga0496101_0143833 Ga0496101_0143833_545_1249 234
310 3300048905 Ga0496102_0042682 Ga0496102_0042682_730_1440 234
311 3300048907 Ga0496104_0010994 Ga0496104_0010994_6642_7346 234
312 3300048907 Ga0496104_0032261 Ga0496104_0032261_3349_4074 234
313 3300048908 Ga0496105_0023298 Ga0496105_0023298_1996_2721 234
314 3300048908 Ga0496105_0326134 Ga0496105_0326134_436_1146 234
315 3300048909 Ga0496106_0035343 Ga0496106_0035343_188_892 234
316 3300048910 Ga0496107_0029675 Ga0496107_0029675_1602_2327 234
317 3300048911 Ga0496108_0006443 Ga0496108_0006443_6490_7194 234
318 3300048911 Ga0496108_0049980 Ga0496108_0049980_1834_2544 234
319 3300048911 Ga0496108_0056656 Ga0496108_0056656_1281_1991 234
320 3300048912 Ga0496109_0284139 Ga0496109_0284139_101_805 234
321 3300048912 Ga0496109_0609473 Ga0496109_0609473_203_913 234
322 3300048913 Ga0496110_0000816 Ga0496110_0000816_2249_2953 234
323 3300048913 Ga0496110_0363151 Ga0496110_0363151_532_1242 234
324 3300048914 Ga0496111_0001752 Ga0496111_0001752_9916_10620 234
325 3300048915 Ga0496112_0000213 Ga0496112_0000213_13395_14099 234
326 3300048917 Ga0496114_0037065 Ga0496114_0037065_3150_3875 234
327 3300049576 Ga0501040_0018715 Ga0501040_0018715_3869_4579 234
328 3300049588 Ga0501072_0359813 Ga0501072_0359813_154_864 234
329 3300049592 Ga0501076_0022769 Ga0501076_0022769_1099_1809 234
330 3300049742 Ga0501080_0354726 Ga0501080_0354726_63_782 234
331 3300050491 nmdc:mga00v17_383758_c1 nmdc:mga00v17_383758_c1_37_750 234
332 3300050491 nmdc:mga00v17_68436_c1 nmdc:mga00v17_68436_c1_41_811 234
333 3300050493 nmdc:mga0k408_11387_c1 nmdc:mga0k408_11387_c1_3130_3900 234
334 3300050493 nmdc:mga0k408_259444_c1 nmdc:mga0k408_259444_c1_43_765 234
335 3300050493 nmdc:mga0k408_7268_c1 nmdc:mga0k408_7268_c1_3770_4480 234
336 3300050494 nmdc:mga06z11_310129_c1 nmdc:mga06z11_310129_c1_85_855 234
337 3300050494 nmdc:mga06z11_55326_c1 nmdc:mga06z11_55326_c1_343_1116 234
338 3300050495 nmdc:mga04h51_10983_c1 nmdc:mga04h51_10983_c1_291_1013 234
339 3300050496 nmdc:mga07m45_15727_c1 nmdc:mga07m45_15727_c1_1346_2116 234
340 3300050507 nmdc:mga05p37_4420_c1 nmdc:mga05p37_4420_c1_5779_6489 234
341 3300050507 nmdc:mga05p37_625_c2 nmdc:mga05p37_625_c2_12490_13305 234
342 3300050507 nmdc:mga05p37_94334_c1 nmdc:mga05p37_94334_c1_990_1700 234
343 3300050509 nmdc:mga0qj67_8989_c1 nmdc:mga0qj67_8989_c1_705_1415 234
344 3300050510 nmdc:mga06r32_209832_c1 nmdc:mga06r32_209832_c1_1071_1823 234
345 3300050510 nmdc:mga06r32_49581_c1 nmdc:mga06r32_49581_c1_658_1398 234
346 3300050510 nmdc:mga06r32_65586_c1 nmdc:mga06r32_65586_c1_232_942 234
347 3300050510 nmdc:mga06r32_892667_c1 nmdc:mga06r32_892667_c1_28_798 234
348 3300050511 nmdc:mga08y16_112546_c1 nmdc:mga08y16_112546_c1_401_1111 234
349 3300050511 nmdc:mga08y16_3139_c1 nmdc:mga08y16_3139_c1_12284_12994 234
350 3300050512 nmdc:mga0n895_2195_c1 nmdc:mga0n895_2195_c1_12938_13657 234
351 3300053103 Ga0500555_000107 Ga0500555_000107_6176_6889 234
352 3300053153 Ga0500616_0001026 Ga0500616_0001026_15895_16608 234
353 3300053730 Ga0500645_000553 Ga0500645_000553_2178_2891 234
354 3300054114 Ga0501084_0668897 Ga0501084_0668897_41_751 234
355 3300060353 Ga0501082_0330155 Ga0501082_0330155_155_874 234
356 3300061734 Ga0530510_0014629 Ga0530510_0014629_3383_4093 234

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

108

190

0.92

PF13649

Methyltransf_25

Methyltransferase domain

107

186

0.91

PF13489

Methyltransf_23

Methyltransferase domain

73

242

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zfu-assembly2.cif.gz_B structure of the methyltransferase-like domain of nucleomethylin 0.7468 28 233
1wzn-assembly1.cif.gz_A crystal structure of the sam-dependent methyltransferase from pyrococcus horikoshii ot3 0.7295 26 137
5wy0-assembly1.cif.gz_A crystal structure of the methyltranferase domain of human hen1 in complex with adomet 0.7184 31 233
8bii-assembly3.cif.gz_G-2 o-methyltransferase plu4895 (mutant h229n) in complex with sah 0.7178 29 234
2p7h-assembly1.cif.gz_A crystal structure of a sam dependent methyl-transferase type 12 family protein (eca1738) from pectobacterium atrosepticum scri1043 at 1.85 a resolution 0.7176 38 233
ID Description Score Start End Superfamily
af_Q9VBJ3_147_316_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8954 40 142 3.40.50.150
af_Q80WQ4_26_187_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8696 37 136 3.40.50.150
af_O44410_182_343_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8552 34 233 3.40.50.150
af_Q7K2B0_198_358_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8409 34 233 3.40.50.150
af_A0A0P0XBA9_4_117_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8397 72 233 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A832UUD1-F1-model_v4 Class I SAM-dependent methyltransferase 0.9283 9 234 GO:0008757
GO:0032259
AF-A0A832UUD1-F1-model_v4 Class I SAM-dependent methyltransferase 0.8941 9 234 GO:0008757
GO:0032259
AF-A0A016T679-F1-model_v4 Ribosomal RNA-processing protein 8 (EC 2.1.1.-) 0.8211 34 233 GO:0000183
GO:0005677
GO:0005730
GO:0006364
GO:0008168
GO:0032259
GO:0033553
GO:0035064
GO:0042149
GO:0046015
AF-A0A3D2J1U9-F1-model_v4 SAM-dependent methyltransferase 0.8161 88 233 GO:0008757
GO:0032259
AF-A0A7J4AA14-F1-model_v4 Methyltransferase domain-containing protein 0.8043 27 135 GO:0008757
GO:0032259

Feature Viewer

pLDDT pTM Quality
87.14 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map