F420733

General Info

Members Datasets Scaffolds Average Seq Length
357 193 357 101

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100153911|Ga0070680_1001539114
Length 112
Sequence MATPGLAANAYAQMARITDAAAGIKRTAAGIAGTADQGGQTFTDMLKDALGSVRQTGAKSDAQARALASGGNKADLVDVVTAVAETETAVNTLVSVRDKVVAAYQQIMQMPI

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
44 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
45 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
46 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
47 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
48 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
49 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
50 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
66 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
68 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
70 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
71 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
72 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
73 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
74 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
75 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
76 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
77 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
78 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
79 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
80 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
81 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
82 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
83 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
84 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
85 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
86 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
87 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
88 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
89 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
90 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
91 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
94 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
95 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
96 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
97 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
98 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
99 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
100 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
101 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
102 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
103 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
104 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
105 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
106 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
107 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
108 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
109 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
110 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
111 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
112 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
113 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
114 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
115 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
116 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
117 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
118 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
119 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
120 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
121 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
122 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
123 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
124 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
125 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
126 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
127 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
128 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
129 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
130 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
131 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
132 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
133 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
134 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
135 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
136 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
152 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
153 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
154 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
155 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
156 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
157 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
158 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
159 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
160 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
161 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
162 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
163 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
164 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
165 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
166 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
169 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
170 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
171 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
172 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
173 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
174 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
175 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
176 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
177 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
178 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
179 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
180 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
181 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
182 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
183 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
184 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
185 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
186 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
187 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
188 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
189 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
190 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
191 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
192 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
193 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.16
Metatranscriptomes 0.84
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.8
Nodule 0
Rhizoplane 0.56
Rhizosphere 86.27
Stem 0
Stem Tuber 0
Unclassified 3.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10395543 3300005327 Bacteria 1187
2 Ga0070676_11338568 3300005328 Bacteria 548
3 Ga0070680_100065287 3300005336 Bacteria 2982
4 Ga0070680_100153911 3300005336 Bacteria 1931
5 Ga0070660_100144027 3300005339 Bacteria 1913
6 Ga0070687_101113927 3300005343 Bacteria 578
7 Ga0070668_100346437 3300005347 Bacteria 1256
8 Ga0070688_101031524 3300005365 Bacteria 655
9 Ga0070709_10121510 3300005434 Bacteria 1771
10 Ga0070709_11497533 3300005434 Bacteria 548
11 Ga0070714_100364137 3300005435 Bacteria 1360
12 Ga0070713_100428837 3300005436 Bacteria 1239
13 Ga0070713_102106155 3300005436 Bacteria 547
14 Ga0070710_10447418 3300005437 Bacteria 875
15 Ga0070705_100076239 3300005440 Bacteria 2044
16 Ga0070694_100663399 3300005444 Bacteria 845
17 Ga0070708_100583647 3300005445 Bacteria 1054
18 Ga0070681_10043386 3300005458 Bacteria 4506
19 Ga0070681_10048667 3300005458 Bacteria 4236
20 Ga0070679_100216342 3300005530 Bacteria 1878
21 Ga0070697_100002804 3300005536 Bacteria 13422
22 Ga0070686_100559418 3300005544 Bacteria 896
23 Ga0070695_100001945 3300005545 Bacteria 11708
24 Ga0070695_100188462 3300005545 Bacteria 1466
25 Ga0070695_101768717 3300005545 Bacteria 518
26 Ga0070696_100012209 3300005546 Bacteria 5756
27 Ga0070696_100849556 3300005546 Bacteria 754
28 Ga0070665_100973487 3300005548 Bacteria 861
29 Ga0070665_102261502 3300005548 Bacteria 547
30 Ga0070704_100053993 3300005549 Bacteria 2842
31 Ga0070704_100198237 3300005549 Bacteria 1619
32 Ga0068855_101460627 3300005563 Bacteria 703
33 Ga0081538_10035073 3300005981 Bacteria 3303
34 Ga0081540_1000068 3300005983 Bacteria 112697
35 Ga0081539_10060752 3300005985 Bacteria 2073
36 Ga0070717_10088016 3300006028 Bacteria 2617
37 Ga0070717_10178537 3300006028 Bacteria 1850
38 Ga0075365_10002786 3300006038 Bacteria 8739
39 Ga0075365_10323600 3300006038 Bacteria 1086
40 Ga0075368_10494205 3300006042 Bacteria 545
41 Ga0075364_10020609 3300006051 Bacteria 4148
42 Ga0070716_101042438 3300006173 Bacteria 649
43 Ga0070712_100418076 3300006175 Bacteria 1111
44 Ga0075362_10023130 3300006177 Bacteria 2626
45 Ga0075362_10186649 3300006177 Bacteria 1006
46 Ga0075367_10211405 3300006178 Bacteria 1213
47 Ga0075366_10390703 3300006195 Bacteria 856
48 Ga0075436_100005213 3300006914 Bacteria 8946
49 Ga0075435_100391715 3300007076 Bacteria 1194
50 Ga0105243_10155014 3300009148 Bacteria 1969
51 Ga0105243_11045757 3300009148 Bacteria 822
52 Ga0105242_11758912 3300009176 Bacteria 657
53 Ga0105249_10006997 3300009553 Bacteria 9843
54 Ga0157378_10157910 3300013297 Bacteria 2118
55 Ga0157372_13308871 3300013307 Bacteria 513
56 Ga0157379_11482327 3300014968 Bacteria 660
57 Ga0163161_10681346 3300017792 Bacteria 854
58 Ga0213873_10292353 3300021358 Bacteria 524
59 Ga0213874_10088145 3300021377 Bacteria 1015
60 Ga0213876_10317428 3300021384 Bacteria 828
61 Ga0224572_1009661 3300024225 Bacteria 1804
62 Ga0224572_1011463 3300024225 Bacteria 1677
63 Ga0228598_1053270 3300024227 Bacteria 803
64 Ga0207685_10210361 3300025905 Bacteria 919
65 Ga0207699_10103008 3300025906 Bacteria 1815
66 Ga0207705_10462398 3300025909 Bacteria 984
67 Ga0207707_10065647 3300025912 Bacteria 3161
68 Ga0207707_10169201 3300025912 Bacteria 1910
69 Ga0207660_10209944 3300025917 Bacteria 1524
70 Ga0207657_10420746 3300025919 Bacteria 1050
71 Ga0207652_10032556 3300025921 Bacteria 4384
72 Ga0207700_10212041 3300025928 Bacteria 1638
73 Ga0207700_11524667 3300025928 Bacteria 593
74 Ga0207664_10567339 3300025929 Bacteria 1019
75 Ga0207686_11786386 3300025934 Bacteria 509
76 Ga0207709_10108039 3300025935 Bacteria 1854
77 Ga0207665_10686984 3300025939 Bacteria 804
78 Ga0207667_11279268 3300025949 Bacteria 711
79 Ga0207712_10022270 3300025961 Bacteria 4170
80 Ga0207683_10895065 3300026121 Bacteria 824
81 Ga0209813_10047100 3300027866 Bacteria 1334
82 Ga0209813_10067719 3300027866 Bacteria 1154
83 Ga0268264_10583992 3300028381 Bacteria 1099
84 Ga0265337_1009820 3300028556 Bacteria 3391
85 Ga0265763_1002551 3300030763 Bacteria 1402
86 Ga0265760_10005992 3300031090 Bacteria 3474
87 Ga0265760_10040731 3300031090 Unclassified 1384
88 Ga0265340_10118676 3300031247 Bacteria 1218
89 Ga0265340_10430528 3300031247 Bacteria 582
90 Ga0307408_100070179 3300031548 Bacteria 2586
91 Ga0265313_10270844 3300031595 Bacteria 688
92 Ga0307406_11818323 3300031901 Bacteria 542
93 Ga0307411_12072334 3300032005 Bacteria 532
94 Ga0307411_12179108 3300032005 Bacteria 519
95 Ga0373928_0133049 3300035084 Bacteria 676
96 Ga0373934_0020106 3300035086 Bacteria 2566
97 Ga0373934_0041466 3300035086 Bacteria 1817
98 Ga0373923_0080029 3300035111 Bacteria 1416
99 Ga0373923_0449969 3300035111 Bacteria 624
100 Ga0373936_0055386 3300035113 Bacteria 1610
101 Ga0373941_0011875 3300035115 Bacteria 2262
102 Ga0373945_0128163 3300035116 Bacteria 1015
103 Ga0373953_0144228 3300035117 Bacteria 1019
104 Ga0373954_0007849 3300035118 Bacteria 4674
105 Ga0373954_0041363 3300035118 Bacteria 2149
106 Ga0373954_0242779 3300035118 Bacteria 886
107 Ga0373956_0005348 3300035119 Bacteria 5138
108 Ga0373956_0088282 3300035119 Bacteria 1428
109 Ga0373956_0435185 3300035119 Bacteria 626
110 Ga0373957_0034400 3300035120 Bacteria 1876
111 Ga0373943_0086952 3300035170 Bacteria 1613
112 Ga0373955_0008083 3300035172 Bacteria 4865
113 Ga0373924_0039127 3300035410 Bacteria 1937
114 Ga0373924_0372304 3300035410 Bacteria 637
115 Ga0373935_0591301 3300035692 Bacteria 811
116 Ga0373933_0001351 3300035724 Bacteria 14455
117 Ga0373933_0357773 3300035724 Bacteria 949
118 Ga0373933_0839827 3300035724 Bacteria 605
119 Ga0373947_0571371 3300035725 Bacteria 770
120 Ga0373937_0004518 3300036401 Bacteria 11814
121 Ga0373937_0029710 3300036401 Bacteria 4951
122 Ga0373937_0792477 3300036401 Bacteria 895
123 Ga0373925_0037613 3300037068 Bacteria 3574
124 Ga0373925_0354702 3300037068 Bacteria 1191
125 Ga0436364_1168080 3300037853 Bacteria 617
126 Ga0436365_0043358 3300039437 Bacteria 2346
127 Ga0436365_1030822 3300039437 Bacteria 618
128 Ga0436365_1745019 3300039437 Bacteria 2083
129 Ga0436360_0488179 3300039438 Bacteria 700
130 Ga0436361_1154916 3300039447 Bacteria 1442
131 Ga0436363_1671504 3300039450 Bacteria 1051
132 Ga0436362_0835176 3300039453 Bacteria 534
133 Ga0439439_0189852 3300041406 Bacteria 594
134 Ga0466966_0418940 3300044684 Bacteria 805
135 Ga0466963_0037383 3300044694 Bacteria 3169
136 Ga0466963_0873600 3300044694 Bacteria 634
137 Ga0466971_0530553 3300044719 Bacteria 583
138 Ga0466959_1049682 3300045049 Bacteria 542
139 Ga0466958_0167552 3300045836 Bacteria 1390
140 Ga0466967_0231005 3300045976 Bacteria 1761
141 Ga0495629_0093680 3300046459 Bacteria 2096
142 Ga0495638_0406222 3300046460 Bacteria 705
143 Ga0495651_0146608 3300046462 Bacteria 1706
144 Ga0495651_0440403 3300046462 Bacteria 844
145 Ga0495651_0745304 3300046462 Bacteria 608
146 Ga0495608_0050304 3300046511 Bacteria 2765
147 Ga0495608_0575351 3300046511 Bacteria 677
148 Ga0495608_0816544 3300046511 Bacteria 550
149 Ga0495628_0240696 3300046516 Bacteria 1354
150 Ga0495628_0432168 3300046516 Bacteria 958
151 Ga0495630_0721725 3300046517 Bacteria 762
152 Ga0495630_0832275 3300046517 Bacteria 704
153 Ga0495648_0464566 3300046524 Bacteria 550
154 Ga0495652_0354098 3300046529 Bacteria 1051
155 Ga0495652_0805091 3300046529 Bacteria 625
156 Ga0495640_0348115 3300046533 Bacteria 915
157 Ga0495640_0481830 3300046533 Bacteria 756
158 Ga0495587_0166077 3300046536 Bacteria 1255
159 Ga0495587_0341404 3300046536 Bacteria 835
160 Ga0495587_0576558 3300046536 Bacteria 620
161 Ga0495667_0148765 3300046559 Bacteria 1508
162 Ga0495634_0639470 3300046642 Bacteria 615
163 Ga0495635_0077498 3300046663 Bacteria 2277
164 Ga0495635_0125063 3300046663 Bacteria 1754
165 Ga0495635_0177818 3300046663 Bacteria 1447
166 Ga0495657_0041194 3300046675 Bacteria 3163
167 Ga0495623_0079267 3300046679 Bacteria 2035
168 Ga0495613_0089361 3300046689 Bacteria 2232
169 Ga0495600_0235773 3300046809 Bacteria 1167
170 Ga0495600_0360584 3300046809 Bacteria 909
171 Ga0495604_0872996 3300047317 Bacteria 563
172 Ga0495674_0059455 3300047319 Bacteria 3338
173 Ga0495674_0627841 3300047319 Bacteria 849
174 Ga0495672_0007287 3300047320 Bacteria 8342
175 Ga0495672_0132333 3300047320 Bacteria 1311
176 Ga0495683_0236434 3300047323 Bacteria 808
177 Ga0495675_0037936 3300047444 Bacteria 3068
178 Ga0495602_0064297 3300048088 Bacteria 3173
179 Ga0496100_0997525 3300048903 Bacteria 659
180 Ga0496101_0730224 3300048904 Bacteria 782
181 Ga0496117_0245782 3300048920 Bacteria 979
182 Ga0496118_0345850 3300048921 Bacteria 794
183 Ga0496121_0024864 3300048924 Bacteria 5710
184 Ga0496121_0436029 3300048924 Bacteria 848
185 Ga0496126_0179011 3300048929 Bacteria 1802
186 Ga0495682_0200239 3300049460 Bacteria 708
187 Ga0501031_0181326 3300049568 Bacteria 1375
188 Ga0501032_0021256 3300049569 Bacteria 4512
189 Ga0501032_0053693 3300049569 Bacteria 2713
190 Ga0501032_0170713 3300049569 Bacteria 1426
191 Ga0501033_0016948 3300049570 Bacteria 5507
192 Ga0501033_0219875 3300049570 Bacteria 1352
193 Ga0501033_0260856 3300049570 Bacteria 1226
194 Ga0501034_0014223 3300049571 Bacteria 8203
195 Ga0501034_0080289 3300049571 Bacteria 3265
196 Ga0501034_0267708 3300049571 Bacteria 1650
197 Ga0501034_0306810 3300049571 Bacteria 1523
198 Ga0501034_0311913 3300049571 Bacteria 1507
199 Ga0501034_0521078 3300049571 Bacteria 1100
200 Ga0501034_0730822 3300049571 Bacteria 886
201 Ga0501034_1228750 3300049571 Bacteria 627
202 Ga0501036_0024915 3300049572 Bacteria 5046
203 Ga0501036_0043358 3300049572 Bacteria 3809
204 Ga0501036_0211714 3300049572 Bacteria 1629
205 Ga0501036_0322081 3300049572 Bacteria 1292
206 Ga0501036_0899577 3300049572 Bacteria 726
207 Ga0501037_0009677 3300049573 Bacteria 7074
208 Ga0501037_0021839 3300049573 Bacteria 4736
209 Ga0501037_0023898 3300049573 Bacteria 4520
210 Ga0501037_0034118 3300049573 Bacteria 3756
211 Ga0501037_0562611 3300049573 Bacteria 768
212 Ga0501038_0083619 3300049574 Bacteria 2686
213 Ga0501038_0116269 3300049574 Bacteria 2210
214 Ga0501038_0153447 3300049574 Bacteria 1876
215 Ga0501038_0325972 3300049574 Bacteria 1200
216 Ga0501039_0012374 3300049575 Bacteria 6511
217 Ga0501039_0263934 3300049575 Bacteria 1353
218 Ga0501039_1168860 3300049575 Bacteria 595
219 Ga0501040_0281903 3300049576 Bacteria 1187
220 Ga0501040_1033731 3300049576 Bacteria 596
221 Ga0501041_0108405 3300049577 Bacteria 1722
222 Ga0501042_0039879 3300049578 Bacteria 3338
223 Ga0501042_0051282 3300049578 Bacteria 2943
224 Ga0501043_0001791 3300049579 Bacteria 18452
225 Ga0501043_0412225 3300049579 Bacteria 1019
226 Ga0501043_0669720 3300049579 Bacteria 760
227 Ga0501046_0069371 3300049580 Bacteria 2742
228 Ga0501046_0153622 3300049580 Bacteria 1735
229 Ga0501046_0156464 3300049580 Bacteria 1716
230 Ga0501046_0651856 3300049580 Bacteria 744
231 Ga0501046_0896149 3300049580 Bacteria 619
232 Ga0501047_0051814 3300049581 Bacteria 3966
233 Ga0501047_0133900 3300049581 Bacteria 2358
234 Ga0501048_0018826 3300049582 Bacteria 5075
235 Ga0501067_0041609 3300049583 Bacteria 2551
236 Ga0501067_0059042 3300049583 Bacteria 2124
237 Ga0501068_0091851 3300049584 Bacteria 1873
238 Ga0501068_0126712 3300049584 Bacteria 1595
239 Ga0501068_0349865 3300049584 Bacteria 949
240 Ga0501068_0371309 3300049584 Bacteria 920
241 Ga0501068_0679710 3300049584 Bacteria 673
242 Ga0501068_0795443 3300049584 Bacteria 620
243 Ga0501069_0029732 3300049585 Bacteria 2999
244 Ga0501069_0058802 3300049585 Bacteria 2145
245 Ga0501069_0068348 3300049585 Bacteria 1988
246 Ga0501069_0387949 3300049585 Bacteria 825
247 Ga0501069_0819432 3300049585 Bacteria 564
248 Ga0501070_0075813 3300049586 Bacteria 2784
249 Ga0501070_0109416 3300049586 Bacteria 2283
250 Ga0501070_0125475 3300049586 Bacteria 2121
251 Ga0501070_0568114 3300049586 Bacteria 906
252 Ga0501070_0624893 3300049586 Bacteria 857
253 Ga0501070_1063041 3300049586 Bacteria 625
254 Ga0501071_0168658 3300049587 Bacteria 1638
255 Ga0501071_0615062 3300049587 Bacteria 835
256 Ga0501071_0869283 3300049587 Bacteria 695
257 Ga0501071_1290441 3300049587 Bacteria 564
258 Ga0501072_0174523 3300049588 Bacteria 1715
259 Ga0501072_0255026 3300049588 Bacteria 1397
260 Ga0501072_0296408 3300049588 Bacteria 1285
261 Ga0501072_0469359 3300049588 Bacteria 996
262 Ga0501072_1149677 3300049588 Bacteria 603
263 Ga0501073_0005090 3300049589 Bacteria 9859
264 Ga0501073_0038850 3300049589 Bacteria 3374
265 Ga0501073_0128849 3300049589 Bacteria 1754
266 Ga0501073_0551818 3300049589 Bacteria 796
267 Ga0501073_0745215 3300049589 Bacteria 675
268 Ga0501073_1217348 3300049589 Bacteria 517
269 Ga0501074_0035056 3300049590 Bacteria 3636
270 Ga0501074_0093124 3300049590 Bacteria 2158
271 Ga0501074_0197148 3300049590 Bacteria 1435
272 Ga0501074_0556981 3300049590 Bacteria 811
273 Ga0501074_0701217 3300049590 Bacteria 714
274 Ga0501075_0005049 3300049591 Bacteria 9017
275 Ga0501075_0271540 3300049591 Bacteria 1292
276 Ga0501075_0532290 3300049591 Bacteria 897
277 Ga0501075_0692801 3300049591 Bacteria 776
278 Ga0501076_0009314 3300049592 Bacteria 7247
279 Ga0501077_0002177 3300049593 Bacteria 11842
280 Ga0501079_0058877 3300049741 Bacteria 2964
281 Ga0501079_0104936 3300049741 Bacteria 2193
282 Ga0501079_0791559 3300049741 Bacteria 746
283 Ga0501079_1211951 3300049741 Bacteria 595
284 Ga0501079_1223826 3300049741 Bacteria 591
285 Ga0501080_0012989 3300049742 Bacteria 7647
286 Ga0501080_0107108 3300049742 Bacteria 2591
287 Ga0501080_0151329 3300049742 Bacteria 2144
288 Ga0501080_0170788 3300049742 Bacteria 2005
289 Ga0501080_0482880 3300049742 Bacteria 1108
290 Ga0501080_0661676 3300049742 Bacteria 923
291 Ga0501080_0745169 3300049742 Bacteria 862
292 Ga0501080_0840287 3300049742 Bacteria 803
293 Ga0501080_0979306 3300049742 Bacteria 734
294 Ga0501081_0037000 3300049743 Bacteria 3330
295 Ga0501081_0133260 3300049743 Bacteria 1777
296 Ga0501081_0228335 3300049743 Bacteria 1355
297 Ga0501081_0801311 3300049743 Bacteria 709
298 Ga0501083_0136146 3300049744 Bacteria 1609
299 Ga0501083_0672241 3300049744 Bacteria 673
300 Ga0501083_0776146 3300049744 Bacteria 623
301 Ga0501083_1050897 3300049744 Bacteria 530
302 Ga0501035_0002286 3300049822 Bacteria 18944
303 Ga0501035_0007147 3300049822 Bacteria 10442
304 Ga0501035_0050687 3300049822 Bacteria 3719
305 Ga0501035_0414772 3300049822 Bacteria 1118
306 Ga0501035_0633263 3300049822 Bacteria 868
307 Ga0501044_0039324 3300049823 Bacteria 4935
308 Ga0501044_0101856 3300049823 Bacteria 2888
309 Ga0501044_0272696 3300049823 Bacteria 1627
310 Ga0501044_0564017 3300049823 Bacteria 1034
311 Ga0501044_0609183 3300049823 Bacteria 984
312 Ga0501044_1073991 3300049823 Bacteria 675
313 Ga0501045_0284568 3300049824 Bacteria 1231
314 Ga0501045_0354878 3300049824 Bacteria 1091
315 Ga0501045_0366554 3300049824 Bacteria 1072
316 nmdc:mga03683_19526_c1 3300050489 Bacteria 2588
317 nmdc:mga03n38_217414_c1 3300050490 Bacteria 996
318 nmdc:mga00v17_431940_c1 3300050491 Bacteria 855
319 nmdc:mga00v17_6540_c1 3300050491 Bacteria 6187
320 nmdc:mga0yw44_139243_c1 3300050492 Bacteria 1576
321 nmdc:mga0yw44_14557_c1 3300050492 Bacteria 4181
322 nmdc:mga0k408_436507_c1 3300050493 Bacteria 778
323 nmdc:mga06z11_20716_c1 3300050494 Bacteria 3043
324 nmdc:mga04h51_127080_c1 3300050495 Bacteria 955
325 nmdc:mga04h51_7388_c1 3300050495 Bacteria 2897
326 nmdc:mga04h51_80924_c1 3300050495 Bacteria 1152
327 nmdc:mga0rr50_1371355_c1 3300050513 Bacteria 599
328 nmdc:mga08x19_23_c1 3300050514 Bacteria 288286
329 Ga0495601_0169702 3300053077 Bacteria 1426
330 Ga0495601_0267484 3300053077 Bacteria 1115
331 Ga0495612_0077288 3300053078 Bacteria 1395
332 Ga0495595_0008241 3300053084 Bacteria 4280
333 Ga0500651_0019389 3300053093 Bacteria 4226
334 Ga0500651_0133507 3300053093 Bacteria 1500
335 Ga0500641_0014864 3300053096 Bacteria 2878
336 Ga0500641_0168575 3300053096 Bacteria 943
337 Ga0500641_0331086 3300053096 Bacteria 617
338 Ga0500556_0253947 3300053104 Bacteria 692
339 Ga0500593_001223 3300053117 Bacteria 9291
340 Ga0500593_008749 3300053117 Bacteria 4171
341 Ga0500595_004526 3300053119 Bacteria 6223
342 Ga0500595_017764 3300053119 Bacteria 2617
343 Ga0500642_0047129 3300053130 Bacteria 1887
344 Ga0500568_0000002 3300053139 Bacteria 880601
345 Ga0500604_0189532 3300053151 Bacteria 706
346 Ga0500622_0301046 3300053156 Bacteria 683
347 Ga0501084_0248604 3300054114 Bacteria 1501
348 Ga0501084_0640618 3300054114 Bacteria 897
349 Ga0501084_0927633 3300054114 Bacteria 732
350 Ga0501084_1299771 3300054114 Bacteria 610
351 Ga0501084_1873984 3300054114 Bacteria 500
352 Ga0590075_117726 3300059424 Bacteria 695
353 Ga0501082_0036920 3300060353 Bacteria 4209
354 Ga0501082_0049324 3300060353 Bacteria 3630
355 Ga0501082_0459759 3300060353 Bacteria 1112
356 Ga0501082_0466837 3300060353 Bacteria 1103
357 Ga0530510_0221243 3300061734 Bacteria 1407

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049571 Ga0501034_0730822 Ga0501034_0730822_546_869 75
2 3300049579 Ga0501043_0669720 Ga0501043_0669720_343_666 75
3 3300049580 Ga0501046_0651856 Ga0501046_0651856_402_725 75
4 3300049569 Ga0501032_0053693 Ga0501032_0053693_2200_2523 76
5 3300049571 Ga0501034_0014223 Ga0501034_0014223_4845_5168 76
6 3300049572 Ga0501036_0024915 Ga0501036_0024915_658_981 76
7 3300049573 Ga0501037_0009677 Ga0501037_0009677_5134_5457 76
8 3300049575 Ga0501039_1168860 Ga0501039_1168860_187_510 76
9 3300049580 Ga0501046_0156464 Ga0501046_0156464_475_798 76
10 3300049581 Ga0501047_0051814 Ga0501047_0051814_637_960 76
11 3300049584 Ga0501068_0091851 Ga0501068_0091851_1381_1704 76
12 3300049586 Ga0501070_0075813 Ga0501070_0075813_1373_1696 76
13 3300049587 Ga0501071_0615062 Ga0501071_0615062_172_495 76
14 3300049588 Ga0501072_1149677 Ga0501072_1149677_150_473 76
15 3300049589 Ga0501073_0745215 Ga0501073_0745215_176_499 76
16 3300049742 Ga0501080_0012989 Ga0501080_0012989_4872_5195 76
17 3300049822 Ga0501035_0050687 Ga0501035_0050687_2603_2926 76
18 3300049823 Ga0501044_0101856 Ga0501044_0101856_2509_2832 76
19 3300049824 Ga0501045_0354878 Ga0501045_0354878_585_908 76
20 3300054114 Ga0501084_1873984 Ga0501084_1873984_149_472 76
21 3300060353 Ga0501082_0466837 Ga0501082_0466837_238_561 76
22 3300049568 Ga0501031_0181326 Ga0501031_0181326_854_1177 82
23 3300049570 Ga0501033_0219875 Ga0501033_0219875_269_592 82
24 3300049571 Ga0501034_0521078 Ga0501034_0521078_176_499 82
25 3300049572 Ga0501036_0899577 Ga0501036_0899577_228_551 82
26 3300049573 Ga0501037_0034118 Ga0501037_0034118_1941_2264 82
27 3300049574 Ga0501038_0153447 Ga0501038_0153447_924_1247 82
28 3300049578 Ga0501042_0051282 Ga0501042_0051282_46_369 82
29 3300049579 Ga0501043_0412225 Ga0501043_0412225_354_677 82
30 3300049580 Ga0501046_0153622 Ga0501046_0153622_579_902 82
31 3300049581 Ga0501047_0133900 Ga0501047_0133900_531_854 82
32 3300049582 Ga0501048_0018826 Ga0501048_0018826_300_623 82
33 3300049583 Ga0501067_0041609 Ga0501067_0041609_795_1118 82
34 3300049584 Ga0501068_0349865 Ga0501068_0349865_21_344 82
35 3300049585 Ga0501069_0387949 Ga0501069_0387949_135_458 82
36 3300049587 Ga0501071_0168658 Ga0501071_0168658_547_870 82
37 3300049588 Ga0501072_0296408 Ga0501072_0296408_834_1157 82
38 3300049589 Ga0501073_0038850 Ga0501073_0038850_2226_2549 82
39 3300049590 Ga0501074_0035056 Ga0501074_0035056_690_1013 82
40 3300049591 Ga0501075_0532290 Ga0501075_0532290_384_707 82
41 3300049741 Ga0501079_0058877 Ga0501079_0058877_492_815 82
42 3300049742 Ga0501080_0151329 Ga0501080_0151329_34_357 82
43 3300049743 Ga0501081_0133260 Ga0501081_0133260_32_355 82
44 3300049744 Ga0501083_0136146 Ga0501083_0136146_176_499 82
45 3300049822 Ga0501035_0633263 Ga0501035_0633263_45_368 82
46 3300049823 Ga0501044_0564017 Ga0501044_0564017_188_511 82
47 3300049824 Ga0501045_0366554 Ga0501045_0366554_171_494 82
48 3300054114 Ga0501084_0248604 Ga0501084_0248604_132_455 82
49 3300060353 Ga0501082_0036920 Ga0501082_0036920_1691_2014 82
50 3300049823 Ga0501044_1073991 Ga0501044_1073991_214_531 88
51 3300006028 Ga0070717_10088016 Ga0070717_100880162 89
52 3300046462 Ga0495651_0440403 Ga0495651_0440403_379_684 89
53 3300049744 Ga0501083_1050897 Ga0501083_1050897_242_511 89
54 3300005436 Ga0070713_100428837 Ga0070713_1004288372 91
55 3300025928 Ga0207700_10212041 Ga0207700_102120412 91
56 3300035115 Ga0373941_0011875 Ga0373941_0011875_898_1221 92
57 3300049569 Ga0501032_0170713 Ga0501032_0170713_268_591 92
58 3300049570 Ga0501033_0260856 Ga0501033_0260856_604_927 92
59 3300049571 Ga0501034_0267708 Ga0501034_0267708_329_652 92
60 3300049571 Ga0501034_1228750 Ga0501034_1228750_82_405 92
61 3300049573 Ga0501037_0023898 Ga0501037_0023898_3735_4058 92
62 3300049573 Ga0501037_0562611 Ga0501037_0562611_318_641 92
63 3300049574 Ga0501038_0083619 Ga0501038_0083619_232_555 92
64 3300049575 Ga0501039_0263934 Ga0501039_0263934_493_816 92
65 3300049576 Ga0501040_0281903 Ga0501040_0281903_563_886 92
66 3300049584 Ga0501068_0371309 Ga0501068_0371309_332_655 92
67 3300049586 Ga0501070_0125475 Ga0501070_0125475_1618_1941 92
68 3300049586 Ga0501070_0568114 Ga0501070_0568114_117_440 92
69 3300049587 Ga0501071_0869283 Ga0501071_0869283_157_480 92
70 3300049588 Ga0501072_0469359 Ga0501072_0469359_239_562 92
71 3300049589 Ga0501073_0005090 Ga0501073_0005090_8984_9307 92
72 3300049590 Ga0501074_0701217 Ga0501074_0701217_236_559 92
73 3300049741 Ga0501079_0791559 Ga0501079_0791559_274_597 92
74 3300049742 Ga0501080_0170788 Ga0501080_0170788_155_478 92
75 3300049742 Ga0501080_0482880 Ga0501080_0482880_489_812 92
76 3300049822 Ga0501035_0414772 Ga0501035_0414772_239_562 92
77 3300049823 Ga0501044_0609183 Ga0501044_0609183_343_666 92
78 3300006042 Ga0075368_10494205 Ga0075368_104942052 93
79 3300028556 Ga0265337_1009820 Ga0265337_10098204 96
80 3300035111 Ga0373923_0449969 Ga0373923_0449969_182_508 96
81 3300035724 Ga0373933_0357773 Ga0373933_0357773_200_526 96
82 3300036401 Ga0373937_0029710 Ga0373937_0029710_361_687 96
83 3300037068 Ga0373925_0354702 Ga0373925_0354702_331_657 96
84 3300046529 Ga0495652_0805091 Ga0495652_0805091_64_390 96
85 3300049589 Ga0501073_0551818 Ga0501073_0551818_412_717 97
86 3300047320 Ga0495672_0132333 Ga0495672_0132333_376_690 99
87 3300049572 Ga0501036_0211714 Ga0501036_0211714_94_399 99
88 3300049585 Ga0501069_0068348 Ga0501069_0068348_1571_1876 99
89 3300049585 Ga0501069_0819432 Ga0501069_0819432_167_472 99
90 3300049586 Ga0501070_0109416 Ga0501070_0109416_1727_2032 99
91 3300049590 Ga0501074_0197148 Ga0501074_0197148_998_1303 99
92 3300049742 Ga0501080_0840287 Ga0501080_0840287_467_772 99
93 3300049822 Ga0501035_0007147 Ga0501035_0007147_9253_9558 99
94 3300054114 Ga0501084_1299771 Ga0501084_1299771_137_442 99
95 3300005545 Ga0070695_101768717 Ga0070695_1017687171 100
96 3300005549 Ga0070704_100198237 Ga0070704_1001982372 100
97 3300013297 Ga0157378_10157910 Ga0157378_101579102 100
98 3300039437 Ga0436365_1030822 Ga0436365_1030822_241_555 100
99 3300044694 Ga0466963_0873600 Ga0466963_0873600_250_567 100
100 3300048924 Ga0496121_0436029 Ga0496121_0436029_85_405 100
101 3300053139 Ga0500568_0000002 Ga0500568_0000002_385480_385800 100
102 3300005536 Ga0070697_100002804 Ga0070697_10000280410 101
103 3300005545 Ga0070695_100001945 Ga0070695_1000019458 101
104 3300006173 Ga0070716_101042438 Ga0070716_1010424382 101
105 3300006178 Ga0075367_10211405 Ga0075367_102114053 101
106 3300006914 Ga0075436_100005213 Ga0075436_1000052135 101
107 3300007076 Ga0075435_100391715 Ga0075435_1003917152 101
108 3300021384 Ga0213876_10317428 Ga0213876_103174282 101
109 3300025905 Ga0207685_10210361 Ga0207685_102103612 101
110 3300025939 Ga0207665_10686984 Ga0207665_106869841 101
111 3300027866 Ga0209813_10047100 Ga0209813_100471003 101
112 3300039437 Ga0436365_1745019 Ga0436365_1745019_583_903 101
113 3300046460 Ga0495638_0406222 Ga0495638_0406222_104_409 101
114 3300046524 Ga0495648_0464566 Ga0495648_0464566_53_358 101
115 3300047323 Ga0495683_0236434 Ga0495683_0236434_275_580 101
116 3300048903 Ga0496100_0997525 Ga0496100_0997525_219_527 101
117 3300048904 Ga0496101_0730224 Ga0496101_0730224_14_319 101
118 3300048920 Ga0496117_0245782 Ga0496117_0245782_505_810 101
119 3300048921 Ga0496118_0345850 Ga0496118_0345850_68_373 101
120 3300048924 Ga0496121_0024864 Ga0496121_0024864_4954_5259 101
121 3300048929 Ga0496126_0179011 Ga0496126_0179011_1102_1407 101
122 3300049460 Ga0495682_0200239 Ga0495682_0200239_303_608 101
123 3300050491 nmdc:mga00v17_431940_c1 nmdc:mga00v17_431940_c1_350_658 101
124 3300050495 nmdc:mga04h51_7388_c1 nmdc:mga04h51_7388_c1_1056_1364 101
125 3300050513 nmdc:mga0rr50_1371355_c1 nmdc:mga0rr50_1371355_c1_34_342 101
126 3300050514 nmdc:mga08x19_23_c1 nmdc:mga08x19_23_c1_259490_259798 101
127 3300053093 Ga0500651_0019389 Ga0500651_0019389_2168_2473 101
128 3300053093 Ga0500651_0133507 Ga0500651_0133507_31_336 101
129 3300053096 Ga0500641_0331086 Ga0500641_0331086_33_338 101
130 3300053104 Ga0500556_0253947 Ga0500556_0253947_67_372 101
131 3300053117 Ga0500593_001223 Ga0500593_001223_440_763 101
132 3300053119 Ga0500595_004526 Ga0500595_004526_2541_2846 101
133 3300053119 Ga0500595_017764 Ga0500595_017764_40_345 101
134 3300053130 Ga0500642_0047129 Ga0500642_0047129_1205_1510 101
135 3300053151 Ga0500604_0189532 Ga0500604_0189532_218_523 101
136 3300053156 Ga0500622_0301046 Ga0500622_0301046_334_639 101
137 3300005347 Ga0070668_100346437 Ga0070668_1003464371 102
138 3300005440 Ga0070705_100076239 Ga0070705_1000762392 102
139 3300005444 Ga0070694_100663399 Ga0070694_1006633992 102
140 3300005445 Ga0070708_100583647 Ga0070708_1005836473 102
141 3300005545 Ga0070695_100188462 Ga0070695_1001884623 102
142 3300005546 Ga0070696_100012209 Ga0070696_1000122094 102
143 3300005549 Ga0070704_100053993 Ga0070704_1000539934 102
144 3300005981 Ga0081538_10035073 Ga0081538_100350734 102
145 3300006038 Ga0075365_10002786 Ga0075365_100027863 102
146 3300006038 Ga0075365_10323600 Ga0075365_103236002 102
147 3300006051 Ga0075364_10020609 Ga0075364_100206095 102
148 3300006177 Ga0075362_10023130 Ga0075362_100231304 102
149 3300006195 Ga0075366_10390703 Ga0075366_103907031 102
150 3300009148 Ga0105243_10155014 Ga0105243_101550144 102
151 3300009553 Ga0105249_10006997 Ga0105249_100069976 102
152 3300013307 Ga0157372_13308871 Ga0157372_133088712 102
153 3300025935 Ga0207709_10108039 Ga0207709_101080394 102
154 3300025961 Ga0207712_10022270 Ga0207712_100222705 102
155 3300031548 Ga0307408_100070179 Ga0307408_1000701794 102
156 3300031901 Ga0307406_11818323 Ga0307406_118183232 102
157 3300032005 Ga0307411_12072334 Ga0307411_120723341 102
158 3300032005 Ga0307411_12179108 Ga0307411_121791081 102
159 3300035119 Ga0373956_0005348 Ga0373956_0005348_1120_1434 102
160 3300047320 Ga0495672_0007287 Ga0495672_0007287_4621_4932 102
161 3300049569 Ga0501032_0021256 Ga0501032_0021256_1547_1858 102
162 3300049570 Ga0501033_0016948 Ga0501033_0016948_3102_3413 102
163 3300049571 Ga0501034_0080289 Ga0501034_0080289_179_490 102
164 3300049571 Ga0501034_0311913 Ga0501034_0311913_774_1085 102
165 3300049572 Ga0501036_0043358 Ga0501036_0043358_383_694 102
166 3300049573 Ga0501037_0021839 Ga0501037_0021839_3119_3430 102
167 3300049574 Ga0501038_0116269 Ga0501038_0116269_1703_2014 102
168 3300049574 Ga0501038_0325972 Ga0501038_0325972_758_1069 102
169 3300049575 Ga0501039_0012374 Ga0501039_0012374_1811_2122 102
170 3300049576 Ga0501040_1033731 Ga0501040_1033731_19_330 102
171 3300049577 Ga0501041_0108405 Ga0501041_0108405_1113_1424 102
172 3300049578 Ga0501042_0039879 Ga0501042_0039879_676_987 102
173 3300049579 Ga0501043_0001791 Ga0501043_0001791_11214_11525 102
174 3300049580 Ga0501046_0069371 Ga0501046_0069371_1382_1693 102
175 3300049583 Ga0501067_0059042 Ga0501067_0059042_617_928 102
176 3300049584 Ga0501068_0126712 Ga0501068_0126712_458_769 102
177 3300049584 Ga0501068_0679710 Ga0501068_0679710_105_416 102
178 3300049585 Ga0501069_0029732 Ga0501069_0029732_136_447 102
179 3300049586 Ga0501070_1063041 Ga0501070_1063041_218_529 102
180 3300049587 Ga0501071_1290441 Ga0501071_1290441_127_438 102
181 3300049590 Ga0501074_0556981 Ga0501074_0556981_182_493 102
182 3300049741 Ga0501079_0104936 Ga0501079_0104936_1142_1453 102
183 3300049741 Ga0501079_1211951 Ga0501079_1211951_167_478 102
184 3300049742 Ga0501080_0107108 Ga0501080_0107108_596_907 102
185 3300049742 Ga0501080_0661676 Ga0501080_0661676_185_496 102
186 3300049743 Ga0501081_0228335 Ga0501081_0228335_676_987 102
187 3300049822 Ga0501035_0002286 Ga0501035_0002286_16563_16874 102
188 3300049823 Ga0501044_0039324 Ga0501044_0039324_3496_3807 102
189 3300049823 Ga0501044_0272696 Ga0501044_0272696_186_497 102
190 3300049824 Ga0501045_0284568 Ga0501045_0284568_739_1050 102
191 3300050489 nmdc:mga03683_19526_c1 nmdc:mga03683_19526_c1_1721_2029 102
192 3300050490 nmdc:mga03n38_217414_c1 nmdc:mga03n38_217414_c1_146_454 102
193 3300050491 nmdc:mga00v17_6540_c1 nmdc:mga00v17_6540_c1_2386_2694 102
194 3300050492 nmdc:mga0yw44_139243_c1 nmdc:mga0yw44_139243_c1_690_998 102
195 3300050492 nmdc:mga0yw44_14557_c1 nmdc:mga0yw44_14557_c1_3843_4151 102
196 3300050493 nmdc:mga0k408_436507_c1 nmdc:mga0k408_436507_c1_74_382 102
197 3300050494 nmdc:mga06z11_20716_c1 nmdc:mga06z11_20716_c1_355_663 102
198 3300050495 nmdc:mga04h51_127080_c1 nmdc:mga04h51_127080_c1_186_494 102
199 3300054114 Ga0501084_0640618 Ga0501084_0640618_402_713 102
200 3300059424 Ga0590075_117726 Ga0590075_117726_172_480 102
201 3300005328 Ga0070676_11338568 Ga0070676_113385681 103
202 3300005434 Ga0070709_10121510 Ga0070709_101215103 103
203 3300005435 Ga0070714_100364137 Ga0070714_1003641373 103
204 3300005436 Ga0070713_102106155 Ga0070713_1021061552 103
205 3300005546 Ga0070696_100849556 Ga0070696_1008495562 103
206 3300005548 Ga0070665_102261502 Ga0070665_1022615022 103
207 3300005985 Ga0081539_10060752 Ga0081539_100607522 103
208 3300006028 Ga0070717_10178537 Ga0070717_101785373 103
209 3300014968 Ga0157379_11482327 Ga0157379_114823271 103
210 3300017792 Ga0163161_10681346 Ga0163161_106813463 103
211 3300025906 Ga0207699_10103008 Ga0207699_101030082 103
212 3300025929 Ga0207664_10567339 Ga0207664_105673393 103
213 3300031247 Ga0265340_10118676 Ga0265340_101186762 103
214 3300035086 Ga0373934_0020106 Ga0373934_0020106_1138_1458 103
215 3300035113 Ga0373936_0055386 Ga0373936_0055386_403_714 103
216 3300035117 Ga0373953_0144228 Ga0373953_0144228_361_681 103
217 3300035118 Ga0373954_0007849 Ga0373954_0007849_3958_4278 103
218 3300035120 Ga0373957_0034400 Ga0373957_0034400_871_1191 103
219 3300035172 Ga0373955_0008083 Ga0373955_0008083_3307_3627 103
220 3300035410 Ga0373924_0039127 Ga0373924_0039127_781_1101 103
221 3300035724 Ga0373933_0001351 Ga0373933_0001351_1403_1723 103
222 3300036401 Ga0373937_0004518 Ga0373937_0004518_1607_1927 103
223 3300046462 Ga0495651_0146608 Ga0495651_0146608_200_520 103
224 3300046462 Ga0495651_0745304 Ga0495651_0745304_207_524 103
225 3300046511 Ga0495608_0575351 Ga0495608_0575351_224_544 103
226 3300046516 Ga0495628_0432168 Ga0495628_0432168_242_559 103
227 3300046529 Ga0495652_0354098 Ga0495652_0354098_624_941 103
228 3300046533 Ga0495640_0481830 Ga0495640_0481830_237_554 103
229 3300046536 Ga0495587_0341404 Ga0495587_0341404_427_747 103
230 3300046536 Ga0495587_0576558 Ga0495587_0576558_202_519 103
231 3300046642 Ga0495634_0639470 Ga0495634_0639470_143_463 103
232 3300046663 Ga0495635_0125063 Ga0495635_0125063_1419_1739 103
233 3300046675 Ga0495657_0041194 Ga0495657_0041194_26_346 103
234 3300046809 Ga0495600_0235773 Ga0495600_0235773_297_617 103
235 3300047317 Ga0495604_0872996 Ga0495604_0872996_146_466 103
236 3300047319 Ga0495674_0627841 Ga0495674_0627841_456_773 103
237 3300047444 Ga0495675_0037936 Ga0495675_0037936_1629_1949 103
238 3300048088 Ga0495602_0064297 Ga0495602_0064297_1677_1997 103
239 3300049571 Ga0501034_0306810 Ga0501034_0306810_196_510 103
240 3300049572 Ga0501036_0322081 Ga0501036_0322081_238_561 103
241 3300049580 Ga0501046_0896149 Ga0501046_0896149_141_464 103
242 3300049584 Ga0501068_0795443 Ga0501068_0795443_169_489 103
243 3300049585 Ga0501069_0058802 Ga0501069_0058802_378_692 103
244 3300049588 Ga0501072_0174523 Ga0501072_0174523_814_1134 103
245 3300049588 Ga0501072_0255026 Ga0501072_0255026_972_1289 103
246 3300049590 Ga0501074_0093124 Ga0501074_0093124_814_1134 103
247 3300049591 Ga0501075_0005049 Ga0501075_0005049_4855_5175 103
248 3300049591 Ga0501075_0692801 Ga0501075_0692801_222_545 103
249 3300049592 Ga0501076_0009314 Ga0501076_0009314_1855_2175 103
250 3300049593 Ga0501077_0002177 Ga0501077_0002177_6500_6820 103
251 3300049741 Ga0501079_1223826 Ga0501079_1223826_74_394 103
252 3300049742 Ga0501080_0979306 Ga0501080_0979306_324_638 103
253 3300049743 Ga0501081_0037000 Ga0501081_0037000_133_453 103
254 3300049743 Ga0501081_0801311 Ga0501081_0801311_219_542 103
255 3300049744 Ga0501083_0672241 Ga0501083_0672241_145_465 103
256 3300049744 Ga0501083_0776146 Ga0501083_0776146_33_347 103
257 3300053077 Ga0495601_0169702 Ga0495601_0169702_347_664 103
258 3300053077 Ga0495601_0267484 Ga0495601_0267484_57_377 103
259 3300053078 Ga0495612_0077288 Ga0495612_0077288_625_942 103
260 3300053084 Ga0495595_0008241 Ga0495595_0008241_2688_3008 103
261 3300054114 Ga0501084_0927633 Ga0501084_0927633_282_596 103
262 3300060353 Ga0501082_0049324 Ga0501082_0049324_2991_3311 103
263 3300060353 Ga0501082_0459759 Ga0501082_0459759_189_503 103
264 3300061734 Ga0530510_0221243 Ga0530510_0221243_94_414 103
265 3300005365 Ga0070688_101031524 Ga0070688_1010315241 104
266 3300005434 Ga0070709_11497533 Ga0070709_114975331 104
267 3300005544 Ga0070686_100559418 Ga0070686_1005594182 104
268 3300006177 Ga0075362_10186649 Ga0075362_101866492 104
269 3300021358 Ga0213873_10292353 Ga0213873_102923532 104
270 3300026121 Ga0207683_10895065 Ga0207683_108950652 104
271 3300027866 Ga0209813_10067719 Ga0209813_100677193 104
272 3300028381 Ga0268264_10583992 Ga0268264_105839923 104
273 3300031090 Ga0265760_10040731 Ga0265760_100407313 104
274 3300035084 Ga0373928_0133049 Ga0373928_0133049_138_455 104
275 3300037853 Ga0436364_1168080 Ga0436364_1168080_253_570 104
276 3300039437 Ga0436365_0043358 Ga0436365_0043358_734_1051 104
277 3300039438 Ga0436360_0488179 Ga0436360_0488179_369_689 104
278 3300039447 Ga0436361_1154916 Ga0436361_1154916_842_1159 104
279 3300039453 Ga0436362_0835176 Ga0436362_0835176_50_367 104
280 3300041406 Ga0439439_0189852 Ga0439439_0189852_73_390 104
281 3300049591 Ga0501075_0271540 Ga0501075_0271540_60_377 104
282 3300049742 Ga0501080_0745169 Ga0501080_0745169_226_543 104
283 3300050495 nmdc:mga04h51_80924_c1 nmdc:mga04h51_80924_c1_269_583 104
284 3300053096 Ga0500641_0014864 Ga0500641_0014864_2144_2467 104
285 3300005327 Ga0070658_10395543 Ga0070658_103955433 105
286 3300005336 Ga0070680_100065287 Ga0070680_1000652874 105
287 3300005336 Ga0070680_100153911 Ga0070680_1001539114 105
288 3300005339 Ga0070660_100144027 Ga0070660_1001440273 105
289 3300005343 Ga0070687_101113927 Ga0070687_1011139271 105
290 3300005437 Ga0070710_10447418 Ga0070710_104474181 105
291 3300005458 Ga0070681_10043386 Ga0070681_100433866 105
292 3300005458 Ga0070681_10048667 Ga0070681_100486675 105
293 3300005530 Ga0070679_100216342 Ga0070679_1002163422 105
294 3300005548 Ga0070665_100973487 Ga0070665_1009734872 105
295 3300005563 Ga0068855_101460627 Ga0068855_1014606272 105
296 3300005983 Ga0081540_1000068 Ga0081540_100006862 105
297 3300006175 Ga0070712_100418076 Ga0070712_1004180761 105
298 3300009148 Ga0105243_11045757 Ga0105243_110457572 105
299 3300009176 Ga0105242_11758912 Ga0105242_117589122 105
300 3300021377 Ga0213874_10088145 Ga0213874_100881452 105
301 3300024225 Ga0224572_1009661 Ga0224572_10096614 105
302 3300024225 Ga0224572_1011463 Ga0224572_10114633 105
303 3300024227 Ga0228598_1053270 Ga0228598_10532702 105
304 3300025909 Ga0207705_10462398 Ga0207705_104623982 105
305 3300025912 Ga0207707_10065647 Ga0207707_100656472 105
306 3300025912 Ga0207707_10169201 Ga0207707_101692013 105
307 3300025917 Ga0207660_10209944 Ga0207660_102099441 105
308 3300025919 Ga0207657_10420746 Ga0207657_104207463 105
309 3300025921 Ga0207652_10032556 Ga0207652_100325563 105
310 3300025928 Ga0207700_11524667 Ga0207700_115246672 105
311 3300025934 Ga0207686_11786386 Ga0207686_117863862 105
312 3300025949 Ga0207667_11279268 Ga0207667_112792682 105
313 3300030763 Ga0265763_1002551 Ga0265763_10025513 105
314 3300031090 Ga0265760_10005992 Ga0265760_100059925 105
315 3300031247 Ga0265340_10430528 Ga0265340_104305282 105
316 3300031595 Ga0265313_10270844 Ga0265313_102708442 105
317 3300035086 Ga0373934_0041466 Ga0373934_0041466_1108_1434 105
318 3300035111 Ga0373923_0080029 Ga0373923_0080029_169_495 105
319 3300035116 Ga0373945_0128163 Ga0373945_0128163_247_573 105
320 3300035118 Ga0373954_0041363 Ga0373954_0041363_1442_1768 105
321 3300035118 Ga0373954_0242779 Ga0373954_0242779_162_488 105
322 3300035119 Ga0373956_0088282 Ga0373956_0088282_855_1181 105
323 3300035119 Ga0373956_0435185 Ga0373956_0435185_175_501 105
324 3300035170 Ga0373943_0086952 Ga0373943_0086952_365_691 105
325 3300035410 Ga0373924_0372304 Ga0373924_0372304_163_489 105
326 3300035692 Ga0373935_0591301 Ga0373935_0591301_469_795 105
327 3300035724 Ga0373933_0839827 Ga0373933_0839827_134_460 105
328 3300035725 Ga0373947_0571371 Ga0373947_0571371_147_473 105
329 3300036401 Ga0373937_0792477 Ga0373937_0792477_342_668 105
330 3300037068 Ga0373925_0037613 Ga0373925_0037613_1982_2308 105
331 3300039450 Ga0436363_1671504 Ga0436363_1671504_485_811 105
332 3300044684 Ga0466966_0418940 Ga0466966_0418940_38_370 105
333 3300044694 Ga0466963_0037383 Ga0466963_0037383_1415_1747 105
334 3300044719 Ga0466971_0530553 Ga0466971_0530553_173_505 105
335 3300045049 Ga0466959_1049682 Ga0466959_1049682_114_452 105
336 3300045836 Ga0466958_0167552 Ga0466958_0167552_970_1302 105
337 3300045976 Ga0466967_0231005 Ga0466967_0231005_71_403 105
338 3300046459 Ga0495629_0093680 Ga0495629_0093680_627_953 105
339 3300046511 Ga0495608_0050304 Ga0495608_0050304_2304_2630 105
340 3300046511 Ga0495608_0816544 Ga0495608_0816544_158_484 105
341 3300046516 Ga0495628_0240696 Ga0495628_0240696_361_687 105
342 3300046517 Ga0495630_0721725 Ga0495630_0721725_59_385 105
343 3300046517 Ga0495630_0832275 Ga0495630_0832275_363_689 105
344 3300046533 Ga0495640_0348115 Ga0495640_0348115_165_491 105
345 3300046536 Ga0495587_0166077 Ga0495587_0166077_109_435 105
346 3300046559 Ga0495667_0148765 Ga0495667_0148765_903_1229 105
347 3300046663 Ga0495635_0077498 Ga0495635_0077498_305_631 105
348 3300046663 Ga0495635_0177818 Ga0495635_0177818_1005_1331 105
349 3300046679 Ga0495623_0079267 Ga0495623_0079267_1624_1950 105
350 3300046689 Ga0495613_0089361 Ga0495613_0089361_1231_1557 105
351 3300046809 Ga0495600_0360584 Ga0495600_0360584_573_899 105
352 3300047319 Ga0495674_0059455 Ga0495674_0059455_2836_3162 105
353 3300049586 Ga0501070_0624893 Ga0501070_0624893_427_750 105
354 3300049589 Ga0501073_0128849 Ga0501073_0128849_453_776 105
355 3300049589 Ga0501073_1217348 Ga0501073_1217348_93_416 105
356 3300053096 Ga0500641_0168575 Ga0500641_0168575_126_452 105
357 3300053117 Ga0500593_008749 Ga0500593_008749_1616_1954 105

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02049

FliE

Flagellar hook-basal body complex protein FliE

23

112

0.93

Feature Viewer

pLDDT pTM Quality
70.15 0.45 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map