F420783

General Info

Members Datasets Scaffolds Average Seq Length
357 211 714 345

Family's Representative Sequence

Representative Sequence 3300006051|Ga0075364_10006676|Ga0075364_100066764
Length 377
Sequence MPPPPSRQVASPPQTACRDPTPAVRLTFVHGEFKVPGGKLVVVDLSVADGRLTNVRVSGDFFLEPDEALAAIDAALTGLPVESDAKTIAAAVTAALPVGTTMFGFSAEAVATTVRRALQRATSWSDYEWEIVRPGPLSPHLHLALDQVLAEEVGDGRRRPTIRFWDWASPAVIIGSFQSVQNEVDPENAERYGFPVARRISGGGAMFIEPAGAVTYSIYAPIDLVQGMSFADSYAFFDEFAVQSLRDLGIEASYVPLNDIASPQGKIGGAAQKRLGNGGVLHHVTMAYDMDGARMAEVLRIGREKLSDKGTKSAAKRVDPLRSQTGLSREEIIEKMIGTFRGLHGLTEGKLTDFELERARELVETKFGTDEWLYRVP

Samples

Sample ID Description Type Environment
1 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
9 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
10 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
11 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
12 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
15 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
29 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
38 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
45 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
46 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
50 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
61 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
64 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
65 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
66 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
67 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
68 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
69 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
70 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
71 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
72 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
73 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
74 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
75 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
76 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
77 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
78 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
79 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
80 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
81 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
82 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
83 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
84 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
85 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
86 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
87 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
88 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
89 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
90 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
91 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
92 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
93 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
94 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
95 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
96 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
97 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
98 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
99 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
100 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
101 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
102 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
116 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
117 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
118 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
119 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
120 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
121 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
122 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
123 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
126 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
127 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
128 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
129 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
130 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
131 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
132 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
133 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
134 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
135 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
136 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
137 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
138 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
139 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
140 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
141 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
142 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
143 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
144 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
145 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
146 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
147 2643221553 Microbacterium sp. Root553 Isolate Unclassified
148 2643221572 Leifsonia sp. Root60 Isolate Unclassified
149 2643221613 Oerskovia sp. Root22 Isolate Unclassified
150 2643221616 Leifsonia sp. Root227 Isolate Unclassified
151 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
152 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
153 2643221649 Leifsonia sp. Root4 Isolate Unclassified
154 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
155 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
156 2643221721 Oerskovia sp. Root918 Isolate Unclassified
157 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
158 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
159 2808606372 Agromyces sp. 23-23 Isolate Unclassified
160 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
161 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
162 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
163 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
164 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
165 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
166 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
167 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
168 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
169 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
170 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
171 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
172 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
173 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
174 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
175 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
176 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
177 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
178 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
179 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
180 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
181 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
182 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
183 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
184 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
185 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
186 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
187 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
188 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
189 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
190 2922554459 Rhodococcus sp. 66b Isolate Unclassified
191 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
192 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
193 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
194 2928153084 Leifsonia sp. 563 Isolate Unclassified
195 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
196 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
197 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
198 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
199 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
200 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
201 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
202 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
203 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
204 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
205 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
206 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere
207 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
208 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere
209 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
210 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere
211 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.39
Metatranscriptomes 0.84
Isolates 18.77

Biome Distribution

Category Percentage (%)
Aerial Root 0.28
Bulb 0
Endosphere 18.77
Nodule 1.4
Rhizoplane 2.52
Rhizosphere 56.02
Stem 0
Stem Tuber 0.28
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075364_10006676 3300006051 Bacteria 6803
2 JGI24740J21852_10043128 3300001979 Bacteria 1347
3 JGI24739J22299_10012849 3300001989 Bacteria 3067
4 JGI24739J22299_10028282 3300001989 Bacteria 1956
5 JGI24737J22298_10023966 3300001990 Bacteria 1934
6 JGI24735J21928_10006352 3300002067 Bacteria 3899
7 JGI25164J39214_1000503 3300002772 Bacteria 19083
8 JGI25165J46597_1000092 3300003214 Bacteria 165407
9 Ga0006562J51391_1020254 3300003578 Bacteria 8180
10 Ga0006562J51391_1020255 3300003578 Bacteria 10030
11 Ga0055539_1000006 3300003752 Bacteria 580055
12 Ga0055533_1000002 3300003756 Bacteria 1196393
13 Ga0055525_1000205 3300003759 Bacteria 67917
14 Ga0055527_1000004 3300003760 Bacteria 570634
15 Ga0055542_1000055 3300003762 Bacteria 171477
16 Ga0055529_1000066 3300003763 Bacteria 170902
17 Ga0055541_1002759 3300003841 Bacteria 3419
18 Ga0065714_10009521 3300005288 Bacteria 2444
19 Ga0070658_10000261 3300005327 Bacteria 46322
20 Ga0070658_10023544 3300005327 Bacteria 4941
21 Ga0070667_100067931 3300005367 Bacteria 3032
22 Ga0070667_100311585 3300005367 Bacteria 1419
23 Ga0070710_10010159 3300005437 Bacteria 4619
24 Ga0070710_10011037 3300005437 Bacteria 4453
25 Ga0070678_100151048 3300005456 Bacteria 1871
26 Ga0070696_100000205 3300005546 Bacteria 35287
27 Ga0070665_100043477 3300005548 Bacteria 4515
28 Ga0070665_100262238 3300005548 Bacteria 1729
29 Ga0068855_100000930 3300005563 Bacteria 36451
30 Ga0068855_100015379 3300005563 Bacteria 9213
31 Ga0068855_100240594 3300005563 Bacteria 2023
32 Ga0068857_100086887 3300005577 Bacteria 2797
33 Ga0068862_100252076 3300005844 Bacteria 1609
34 Ga0081455_10009494 3300005937 Bacteria 9998
35 Ga0075365_10005673 3300006038 Bacteria 6765
36 Ga0075365_10009258 3300006038 Bacteria 5649
37 Ga0075364_10000018 3300006051 Bacteria 55324
38 Ga0075364_10006445 3300006051 Bacteria 6893
39 Ga0075364_10009135 3300006051 Bacteria 5937
40 Ga0075369_10023828 3300006186 Bacteria 2533
41 Ga0079104_1000044 3300006946 Bacteria 185367
42 Ga0111539_10172904 3300009094 Bacteria 2523
43 Ga0105247_10012882 3300009101 Bacteria 5019
44 Ga0105248_10000340 3300009177 Bacteria 55043
45 Ga0105237_10065306 3300009545 Bacteria 3635
46 Ga0105238_10457933 3300009551 Bacteria 1273
47 Ga0157371_10000447 3300013102 Bacteria 50553
48 Ga0157369_10001527 3300013105 Bacteria 28378
49 Ga0157369_10013828 3300013105 Bacteria 9122
50 Ga0157369_10133695 3300013105 Bacteria 2627
51 Ga0157369_10150987 3300013105 Bacteria 2455
52 Ga0163162_10347803 3300013306 Bacteria 1615
53 Ga0197907_10545534 3300020069 Bacteria 1867
54 Ga0209566_100013 3300025225 Bacteria 474033
55 Ga0209674_100001 3300025226 Bacteria 4013750
56 Ga0209672_100011 3300025228 Bacteria 856297
57 Ga0209147_100892 3300025229 Bacteria 13661
58 Ga0209563_100001 3300025230 Bacteria 4013775
59 Ga0207427_100182 3300025231 Bacteria 64661
60 Ga0209437_101207 3300025233 Bacteria 7461
61 Ga0209258_103393 3300025242 Bacteria 3451
62 Ga0209677_100001 3300025253 Bacteria 4013787
63 Ga0209677_102238 3300025253 Bacteria 7501
64 Ga0209148_1000132 3300025254 Bacteria 171529
65 Ga0209233_1000014 3300025261 Bacteria 996641
66 Ga0209455_1000122 3300025272 Bacteria 170954
67 Ga0209455_1001399 3300025272 Bacteria 10952
68 Ga0207692_10011844 3300025898 Bacteria 3728
69 Ga0207647_10014391 3300025904 Bacteria 5454
70 Ga0207647_10022256 3300025904 Bacteria 4214
71 Ga0207705_10000001 3300025909 Bacteria 2061880
72 Ga0207671_10038042 3300025914 Bacteria 3566
73 Ga0207711_10000849 3300025941 Bacteria 29540
74 Ga0207667_10000837 3300025949 Bacteria 39713
75 Ga0207667_10232967 3300025949 Bacteria 1885
76 Ga0207674_10109035 3300026116 Bacteria 2745
77 Ga0207675_100150528 3300026118 Bacteria 2214
78 Ga0207683_10130632 3300026121 Bacteria 2259
79 Ga0209281_1000129 3300027111 Bacteria 194490
80 Ga0268266_10050758 3300028379 Bacteria 3559
81 Ga0268266_10222175 3300028379 Bacteria 1737
82 Ga0268265_10131283 3300028380 Bacteria 2082
83 Ga0307515_10037030 3300028794 Bacteria 7863
84 Ga0307515_10083937 3300028794 Bacteria 4099
85 Ga0307514_10143179 3300031649 Bacteria 1620
86 Ga0307406_10021836 3300031901 Bacteria 3792
87 Ga0395899_0017407 3300037312 Bacteria 5475
88 Ga0395899_0022144 3300037312 Bacteria 4818
89 Ga0395900_0002120 3300037418 Bacteria 22195
90 Ga0395900_0125425 3300037418 Bacteria 2633
91 Ga0395898_0000158 3300037466 Bacteria 172981
92 Ga0395901_0015198 3300038443 Bacteria 7831
93 Ga0395901_0261091 3300038443 Bacteria 1803
94 Ga0451791_0549191 3300041451 Bacteria 1230
95 Ga0466972_0011669 3300044658 Bacteria 4412
96 Ga0466965_0000019 3300044683 Bacteria 63668
97 Ga0466965_0014915 3300044683 Bacteria 3683
98 Ga0466965_0051923 3300044683 Bacteria 2035
99 Ga0466961_0048834 3300044693 Bacteria 2705
100 Ga0466961_0059507 3300044693 Bacteria 2430
101 Ga0466961_0078223 3300044693 Bacteria 2095
102 Ga0466971_0010107 3300044719 Bacteria 4122
103 Ga0466970_0007961 3300044765 Bacteria 5321
104 Ga0466970_0020276 3300044765 Bacteria 3452
105 Ga0466970_0032975 3300044765 Bacteria 2737
106 Ga0466970_0035305 3300044765 Bacteria 2649
107 Ga0466957_0061665 3300044842 Bacteria 2302
108 Ga0466960_0062272 3300044901 Bacteria 1833
109 Ga0466960_0169894 3300044901 Bacteria 1176
110 Ga0466959_0023807 3300045049 Bacteria 4534
111 Ga0466958_0122961 3300045836 Bacteria 1626
112 Ga0495590_0000076 3300046457 Bacteria 68651
113 Ga0495654_0000122 3300046530 Bacteria 86717
114 Ga0495668_0000123 3300046616 Bacteria 115173
115 Ga0495672_0008180 3300047320 Bacteria 7758
116 Ga0495672_0020549 3300047320 Bacteria 4322
117 Ga0495686_0024564 3300047472 Bacteria 3958
118 Ga0495686_0106185 3300047472 Bacteria 1689
119 Ga0496101_0017311 3300048904 Bacteria 4888
120 Ga0496102_0222658 3300048905 Bacteria 1779
121 Ga0496104_0059618 3300048907 Bacteria 3613
122 Ga0496104_0119953 3300048907 Bacteria 2525
123 Ga0496105_0005565 3300048908 Bacteria 9567
124 Ga0496113_0309742 3300048916 Bacteria 1265
125 Ga0496114_0013379 3300048917 Bacteria 6578
126 Ga0496114_0017264 3300048917 Bacteria 5823
127 Ga0496116_0018654 3300048919 Bacteria 5336
128 Ga0496117_0000091 3300048920 Bacteria 203826
129 Ga0496117_0000255 3300048920 Bacteria 100069
130 Ga0496117_0000451 3300048920 Bacteria 68385
131 Ga0496117_0038225 3300048920 Bacteria 3563
132 Ga0496117_0040843 3300048920 Bacteria 3407
133 Ga0496118_0000229 3300048921 Bacteria 98023
134 Ga0496118_0059107 3300048921 Bacteria 2858
135 Ga0496118_0099386 3300048921 Bacteria 1972
136 Ga0496119_0001294 3300048922 Bacteria 30906
137 Ga0496119_0008549 3300048922 Bacteria 8978
138 Ga0496119_0011744 3300048922 Bacteria 7205
139 Ga0496120_0006173 3300048923 Bacteria 9276
140 Ga0496120_0032326 3300048923 Bacteria 3156
141 Ga0496121_0000005 3300048924 Bacteria 1034486
142 Ga0496121_0000046 3300048924 Bacteria 335942
143 Ga0496121_0002138 3300048924 Bacteria 31031
144 Ga0496121_0009681 3300048924 Bacteria 11038
145 Ga0496121_0027623 3300048924 Bacteria 5306
146 Ga0496122_0001668 3300048925 Bacteria 34430
147 Ga0496122_0006095 3300048925 Bacteria 14042
148 Ga0496122_0036877 3300048925 Bacteria 3945
149 Ga0496122_0161967 3300048925 Bacteria 1363
150 Ga0496123_0000363 3300048926 Bacteria 85560
151 Ga0496123_0014270 3300048926 Bacteria 6598
152 Ga0496123_0021923 3300048926 Bacteria 4945
153 Ga0496123_0058846 3300048926 Bacteria 2489
154 Ga0496124_0000301 3300048927 Bacteria 91222
155 Ga0496124_0038728 3300048927 Bacteria 4137
156 Ga0496124_0069104 3300048927 Bacteria 2933
157 Ga0496124_0107438 3300048927 Bacteria 2251
158 Ga0496124_0193973 3300048927 Bacteria 1551
159 Ga0496125_0000107 3300048928 Bacteria 197483
160 Ga0496125_0018970 3300048928 Bacteria 6509
161 Ga0496126_0007904 3300048929 Bacteria 11577
162 Ga0496126_0010709 3300048929 Bacteria 9580
163 Ga0496126_0016273 3300048929 Bacteria 7443
164 Ga0496126_0130527 3300048929 Bacteria 2171
165 Ga0496126_0151886 3300048929 Bacteria 1984
166 Ga0496126_0366456 3300048929 Bacteria 1176
167 Ga0501031_0011211 3300049568 Bacteria 5841
168 Ga0501032_0010835 3300049569 Bacteria 6562
169 Ga0501032_0048636 3300049569 Bacteria 2863
170 Ga0501032_0051041 3300049569 Bacteria 2789
171 Ga0501033_0000552 3300049570 Bacteria 34849
172 Ga0501033_0109979 3300049570 Bacteria 2006
173 Ga0501033_0125350 3300049570 Bacteria 1862
174 Ga0501034_0007839 3300049571 Bacteria 11356
175 Ga0501034_0013473 3300049571 Bacteria 8415
176 Ga0501034_0025362 3300049571 Bacteria 6035
177 Ga0501034_0037902 3300049571 Bacteria 4882
178 Ga0501034_0040696 3300049571 Bacteria 4703
179 Ga0501034_0046178 3300049571 Bacteria 4401
180 Ga0501034_0053505 3300049571 Bacteria 4064
181 Ga0501034_0092636 3300049571 Bacteria 3018
182 Ga0501034_0109212 3300049571 Bacteria 2757
183 Ga0501034_0254975 3300049571 Bacteria 1698
184 Ga0501036_0001327 3300049572 Bacteria 18984
185 Ga0501036_0008662 3300049572 Bacteria 8347
186 Ga0501036_0014485 3300049572 Bacteria 6568
187 Ga0501037_0001812 3300049573 Bacteria 15524
188 Ga0501037_0010710 3300049573 Bacteria 6737
189 Ga0501037_0017450 3300049573 Bacteria 5283
190 Ga0501037_0018007 3300049573 Bacteria 5200
191 Ga0501037_0056995 3300049573 Bacteria 2853
192 Ga0501038_0009102 3300049574 Bacteria 9112
193 Ga0501038_0011055 3300049574 Bacteria 8243
194 Ga0501038_0023914 3300049574 Bacteria 5455
195 Ga0501038_0156712 3300049574 Bacteria 1854
196 Ga0501039_0018821 3300049575 Bacteria 5300
197 Ga0501039_0075231 3300049575 Bacteria 2625
198 Ga0501042_0002490 3300049578 Bacteria 11330
199 Ga0501042_0010594 3300049578 Bacteria 6191
200 Ga0501042_0029715 3300049578 Bacteria 3855
201 Ga0501043_0001451 3300049579 Bacteria 20715
202 Ga0501043_0007255 3300049579 Bacteria 8801
203 Ga0501046_0004573 3300049580 Bacteria 12518
204 Ga0501046_0029222 3300049580 Bacteria 4483
205 Ga0501046_0097699 3300049580 Bacteria 2256
206 Ga0501046_0291893 3300049580 Bacteria 1192
207 Ga0501047_0001493 3300049581 Bacteria 22795
208 Ga0501047_0024908 3300049581 Bacteria 5746
209 Ga0501047_0030146 3300049581 Bacteria 5230
210 Ga0501047_0050042 3300049581 Bacteria 4034
211 Ga0501047_0060960 3300049581 Bacteria 3640
212 Ga0501047_0272869 3300049581 Bacteria 1537
213 Ga0501048_0005781 3300049582 Bacteria 9402
214 Ga0501048_0005986 3300049582 Bacteria 9266
215 Ga0501069_0017126 3300049585 Bacteria 3896
216 Ga0501069_0034341 3300049585 Bacteria 2793
217 Ga0501069_0085402 3300049585 Bacteria 1781
218 Ga0501070_0000317 3300049586 Bacteria 43770
219 Ga0501070_0000620 3300049586 Bacteria 32572
220 Ga0501070_0012834 3300049586 Bacteria 7061
221 Ga0501070_0018927 3300049586 Bacteria 5776
222 Ga0501070_0019723 3300049586 Bacteria 5655
223 Ga0501071_0000631 3300049587 Bacteria 18302
224 Ga0501071_0249362 3300049587 Bacteria 1340
225 Ga0501072_0154309 3300049588 Bacteria 1831
226 Ga0501073_0000025 3300049589 Bacteria 127490
227 Ga0501073_0009182 3300049589 Bacteria 7294
228 Ga0501073_0016785 3300049589 Bacteria 5305
229 Ga0501073_0043587 3300049589 Bacteria 3164
230 Ga0501073_0047551 3300049589 Bacteria 3015
231 Ga0501073_0067567 3300049589 Bacteria 2492
232 Ga0501074_0002198 3300049590 Bacteria 13524
233 Ga0501074_0017757 3300049590 Bacteria 5167
234 Ga0501080_0000339 3300049742 Bacteria 35944
235 Ga0501080_0004262 3300049742 Bacteria 12693
236 Ga0501080_0024103 3300049742 Bacteria 5640
237 Ga0501080_0447658 3300049742 Bacteria 1158
238 Ga0501083_0000051 3300049744 Bacteria 85348
239 Ga0501083_0006437 3300049744 Bacteria 8331
240 Ga0501083_0082687 3300049744 Bacteria 2127
241 Ga0501035_0004510 3300049822 Bacteria 13214
242 Ga0501035_0023191 3300049822 Bacteria 5692
243 Ga0501035_0199138 3300049822 Bacteria 1719
244 Ga0501044_0010081 3300049823 Bacteria 10271
245 Ga0501044_0013737 3300049823 Bacteria 8751
246 Ga0501044_0014045 3300049823 Bacteria 8647
247 Ga0501044_0046546 3300049823 Bacteria 4490
248 Ga0501044_0059477 3300049823 Bacteria 3914
249 Ga0501044_0204025 3300049823 Bacteria 1934
250 Ga0501045_0071688 3300049824 Bacteria 2550
251 Ga0501045_0116687 3300049824 Bacteria 1981
252 nmdc:mga00v17_1470_c1 3300050491 Bacteria 12338
253 nmdc:mga00v17_168_c1 3300050491 Bacteria 38334
254 nmdc:mga00v17_192539_c1 3300050491 Bacteria 1317
255 nmdc:mga00v17_37315_c1 3300050491 Bacteria 2901
256 nmdc:mga00v17_510_c1 3300050491 Bacteria 21768
257 nmdc:mga0yw44_116286_c1 3300050492 Bacteria 1719
258 nmdc:mga0yw44_33344_c1 3300050492 Bacteria 3008
259 nmdc:mga0yw44_649_c1 3300050492 Bacteria 12647
260 nmdc:mga07m45_217190_c1 3300050496 Bacteria 1112
261 nmdc:mga08y16_168743_c1 3300050511 Bacteria 2273
262 Ga0500635_0000059 3300053080 Bacteria 72321
263 Ga0500643_000181 3300053087 Bacteria 61492
264 Ga0500556_0000008 3300053104 Bacteria 304943
265 Ga0500556_0000108 3300053104 Bacteria 74136
266 Ga0500562_004146 3300053108 Bacteria 3655
267 Ga0500593_000842 3300053117 Bacteria 11437
268 Ga0500618_000464 3300053125 Bacteria 26377
269 Ga0500655_018176 3300053133 Bacteria 1305
270 Ga0500559_0000269 3300053136 Bacteria 40462
271 Ga0500559_0000416 3300053136 Bacteria 30508
272 Ga0500559_0000485 3300053136 Bacteria 28086
273 Ga0500559_0095161 3300053136 Bacteria 1367
274 Ga0500568_0000003 3300053139 Bacteria 863587
275 Ga0500568_0000072 3300053139 Bacteria 98290
276 Ga0500568_0000754 3300053139 Bacteria 23062
277 Ga0500568_0001893 3300053139 Bacteria 12869
278 Ga0500573_0001981 3300053140 Bacteria 10020
279 Ga0500573_0006392 3300053140 Bacteria 6374
280 Ga0500573_0015110 3300053140 Bacteria 4373
281 Ga0500573_0018826 3300053140 Bacteria 3943
282 Ga0500573_0130035 3300053140 Bacteria 1395
283 Ga0500577_0027879 3300053142 Bacteria 1939
284 Ga0500616_0000010 3300053153 Bacteria 761410
285 Ga0500616_0000209 3300053153 Bacteria 94705
286 Ga0500616_0002704 3300053153 Bacteria 14399
287 Ga0500616_0139087 3300053153 Bacteria 1137
288 Ga0500627_0016732 3300053158 Bacteria 2867
289 Ga0500645_024030 3300053730 Bacteria 1865
290 Ga0501084_0028269 3300054114 Bacteria 4686
291 2566996580 2565956761 Bacteria 6601618
292 2587861780 2585428094 Bacteria 3604039
293 2643784869 2643221553 Bacteria 3544260
294 2643877333 2643221572 Bacteria 3614809
295 2644084655 2643221613 Bacteria 4622396
296 2644094235 2643221616 Bacteria 4066575
297 2644181555 2643221632 Bacteria 3406696
298 2644197731 2643221635 Bacteria 2632343
299 2644279997 2643221649 Bacteria 3867359
300 2644384388 2643221669 Bacteria 3611286
301 2644455428 2643221681 Bacteria 3707866
302 2644667267 2643221721 Bacteria 4486924
303 2739204924 2738543005 Bacteria 5278128
304 2753300822 2751185788 Bacteria 4541048
305 2808899578 2808606372 Bacteria 4649509
306 2816423795 2816332119 Bacteria 8120218
307 2821127198 2821123053 Bacteria 7836056
308 2835188331 2835188231 Bacteria 3476928
309 2837271531 2837268691 Bacteria 7850704
310 2838740659 2838736955 Bacteria 5760694
311 2841844500 2841840854 Bacteria 5761912
312 2842144432 2842140634 Bacteria 5759631
313 2844844533 2844841374 Bacteria 3917147
314 2844853776 2844852863 Bacteria 3849151
315 2848551797 2848551377 Bacteria 3720646
316 2852643829 2852643534 Bacteria 3013378
317 2857534822 2857531043 Bacteria 6754041
318 2857731642 2857729791 Bacteria 4040535
319 2857736976 2857733635 Bacteria 3532004
320 2857738929 2857737099 Bacteria 3104305
321 2862994279 2862993130 Bacteria 3860849
322 2870625151 2870622029 Bacteria 3643329
323 2883824752 2883821847 Bacteria 5121194
324 2884763683 2884763398 Bacteria 4091164
325 2895661854 2895660088 Bacteria 3782833
326 2904431245 2904430863 Bacteria 3486923
327 2904504639 2904501621 Bacteria 3401437
328 2904539098 2904535858 Bacteria 6308016
329 2908674933 2908674828 Bacteria 3382763
330 2909075752 2909074476 Bacteria 3436050
331 2919041015 2919039151 Bacteria 3391018
332 2919046001 2919042368 Bacteria 3905917
333 2919056490 2919055335 Bacteria 3875751
334 2919444382 2919443155 Bacteria 4072969
335 2919526484 2919523602 Bacteria 3788128
336 2922555765 2922554459 Bacteria 6683962
337 2928106649 2928104781 Bacteria 3877447
338 2928124455 2928121344 Bacteria 3972376
339 2928144343 2928142448 Bacteria 5288925
340 2928155298 2928153084 Bacteria 4020257
341 2928501901 2928500415 Bacteria 3384541
342 2929142316 2929138655 Bacteria 5810547
343 2935892467 2935890801 Bacteria 4593001
344 2939659920 2939657138 Bacteria 3740283
345 2939661805 2939660829 Bacteria 3784848
346 2964327722 2964326757 Bacteria 3290868
347 2966922473 2966921586 Bacteria 3092803
348 2966927360 2966924647 Bacteria 3268643
349 2984552890 2984551494 Bacteria 3877562
350 2995729192 2995726249 Bacteria 3470435
351 3003001113 3002998708 Bacteria 11715108
352 8054358028 8054357960 Bacteria 2867777
353 8055037468 8055034563 Bacteria 3562128
354 8055039717 8055037949 Bacteria 3337834
355 8056040589 8056037122 Bacteria 3854319
356 8056582713 8056579771 Bacteria 5840325
357 8057346740 8057345674 Bacteria 4160394
358 Ga0075364_10006676
359 JGI24740J21852_10043128
360 JGI24739J22299_10012849
361 JGI24739J22299_10028282
362 JGI24737J22298_10023966
363 JGI24735J21928_10006352
364 JGI25164J39214_1000503
365 JGI25165J46597_1000092
366 Ga0006562J51391_1020254
367 Ga0006562J51391_1020255
368 Ga0055539_1000006
369 Ga0055533_1000002
370 Ga0055525_1000205
371 Ga0055527_1000004
372 Ga0055542_1000055
373 Ga0055529_1000066
374 Ga0055541_1002759
375 Ga0065714_10009521
376 Ga0070658_10000261
377 Ga0070658_10023544
378 Ga0070667_100067931
379 Ga0070667_100311585
380 Ga0070710_10010159
381 Ga0070710_10011037
382 Ga0070678_100151048
383 Ga0070696_100000205
384 Ga0070665_100043477
385 Ga0070665_100262238
386 Ga0068855_100000930
387 Ga0068855_100015379
388 Ga0068855_100240594
389 Ga0068857_100086887
390 Ga0068862_100252076
391 Ga0081455_10009494
392 Ga0075365_10005673
393 Ga0075365_10009258
394 Ga0075364_10000018
395 Ga0075364_10006445
396 Ga0075364_10009135
397 Ga0075369_10023828
398 Ga0079104_1000044
399 Ga0111539_10172904
400 Ga0105247_10012882
401 Ga0105248_10000340
402 Ga0105237_10065306
403 Ga0105238_10457933
404 Ga0157371_10000447
405 Ga0157369_10001527
406 Ga0157369_10013828
407 Ga0157369_10133695
408 Ga0157369_10150987
409 Ga0163162_10347803
410 Ga0197907_10545534
411 Ga0209566_100013
412 Ga0209674_100001
413 Ga0209672_100011
414 Ga0209147_100892
415 Ga0209563_100001
416 Ga0207427_100182
417 Ga0209437_101207
418 Ga0209258_103393
419 Ga0209677_100001
420 Ga0209677_102238
421 Ga0209148_1000132
422 Ga0209233_1000014
423 Ga0209455_1000122
424 Ga0209455_1001399
425 Ga0207692_10011844
426 Ga0207647_10014391
427 Ga0207647_10022256
428 Ga0207705_10000001
429 Ga0207671_10038042
430 Ga0207711_10000849
431 Ga0207667_10000837
432 Ga0207667_10232967
433 Ga0207674_10109035
434 Ga0207675_100150528
435 Ga0207683_10130632
436 Ga0209281_1000129
437 Ga0268266_10050758
438 Ga0268266_10222175
439 Ga0268265_10131283
440 Ga0307515_10037030
441 Ga0307515_10083937
442 Ga0307514_10143179
443 Ga0307406_10021836
444 Ga0395899_0017407
445 Ga0395899_0022144
446 Ga0395900_0002120
447 Ga0395900_0125425
448 Ga0395898_0000158
449 Ga0395901_0015198
450 Ga0395901_0261091
451 Ga0451791_0549191
452 Ga0466972_0011669
453 Ga0466965_0000019
454 Ga0466965_0014915
455 Ga0466965_0051923
456 Ga0466961_0048834
457 Ga0466961_0059507
458 Ga0466961_0078223
459 Ga0466971_0010107
460 Ga0466970_0007961
461 Ga0466970_0020276
462 Ga0466970_0032975
463 Ga0466970_0035305
464 Ga0466957_0061665
465 Ga0466960_0062272
466 Ga0466960_0169894
467 Ga0466959_0023807
468 Ga0466958_0122961
469 Ga0495590_0000076
470 Ga0495654_0000122
471 Ga0495668_0000123
472 Ga0495672_0008180
473 Ga0495672_0020549
474 Ga0495686_0024564
475 Ga0495686_0106185
476 Ga0496101_0017311
477 Ga0496102_0222658
478 Ga0496104_0059618
479 Ga0496104_0119953
480 Ga0496105_0005565
481 Ga0496113_0309742
482 Ga0496114_0013379
483 Ga0496114_0017264
484 Ga0496116_0018654
485 Ga0496117_0000091
486 Ga0496117_0000255
487 Ga0496117_0000451
488 Ga0496117_0038225
489 Ga0496117_0040843
490 Ga0496118_0000229
491 Ga0496118_0059107
492 Ga0496118_0099386
493 Ga0496119_0001294
494 Ga0496119_0008549
495 Ga0496119_0011744
496 Ga0496120_0006173
497 Ga0496120_0032326
498 Ga0496121_0000005
499 Ga0496121_0000046
500 Ga0496121_0002138
501 Ga0496121_0009681
502 Ga0496121_0027623
503 Ga0496122_0001668
504 Ga0496122_0006095
505 Ga0496122_0036877
506 Ga0496122_0161967
507 Ga0496123_0000363
508 Ga0496123_0014270
509 Ga0496123_0021923
510 Ga0496123_0058846
511 Ga0496124_0000301
512 Ga0496124_0038728
513 Ga0496124_0069104
514 Ga0496124_0107438
515 Ga0496124_0193973
516 Ga0496125_0000107
517 Ga0496125_0018970
518 Ga0496126_0007904
519 Ga0496126_0010709
520 Ga0496126_0016273
521 Ga0496126_0130527
522 Ga0496126_0151886
523 Ga0496126_0366456
524 Ga0501031_0011211
525 Ga0501032_0010835
526 Ga0501032_0048636
527 Ga0501032_0051041
528 Ga0501033_0000552
529 Ga0501033_0109979
530 Ga0501033_0125350
531 Ga0501034_0007839
532 Ga0501034_0013473
533 Ga0501034_0025362
534 Ga0501034_0037902
535 Ga0501034_0040696
536 Ga0501034_0046178
537 Ga0501034_0053505
538 Ga0501034_0092636
539 Ga0501034_0109212
540 Ga0501034_0254975
541 Ga0501036_0001327
542 Ga0501036_0008662
543 Ga0501036_0014485
544 Ga0501037_0001812
545 Ga0501037_0010710
546 Ga0501037_0017450
547 Ga0501037_0018007
548 Ga0501037_0056995
549 Ga0501038_0009102
550 Ga0501038_0011055
551 Ga0501038_0023914
552 Ga0501038_0156712
553 Ga0501039_0018821
554 Ga0501039_0075231
555 Ga0501042_0002490
556 Ga0501042_0010594
557 Ga0501042_0029715
558 Ga0501043_0001451
559 Ga0501043_0007255
560 Ga0501046_0004573
561 Ga0501046_0029222
562 Ga0501046_0097699
563 Ga0501046_0291893
564 Ga0501047_0001493
565 Ga0501047_0024908
566 Ga0501047_0030146
567 Ga0501047_0050042
568 Ga0501047_0060960
569 Ga0501047_0272869
570 Ga0501048_0005781
571 Ga0501048_0005986
572 Ga0501069_0017126
573 Ga0501069_0034341
574 Ga0501069_0085402
575 Ga0501070_0000317
576 Ga0501070_0000620
577 Ga0501070_0012834
578 Ga0501070_0018927
579 Ga0501070_0019723
580 Ga0501071_0000631
581 Ga0501071_0249362
582 Ga0501072_0154309
583 Ga0501073_0000025
584 Ga0501073_0009182
585 Ga0501073_0016785
586 Ga0501073_0043587
587 Ga0501073_0047551
588 Ga0501073_0067567
589 Ga0501074_0002198
590 Ga0501074_0017757
591 Ga0501080_0000339
592 Ga0501080_0004262
593 Ga0501080_0024103
594 Ga0501080_0447658
595 Ga0501083_0000051
596 Ga0501083_0006437
597 Ga0501083_0082687
598 Ga0501035_0004510
599 Ga0501035_0023191
600 Ga0501035_0199138
601 Ga0501044_0010081
602 Ga0501044_0013737
603 Ga0501044_0014045
604 Ga0501044_0046546
605 Ga0501044_0059477
606 Ga0501044_0204025
607 Ga0501045_0071688
608 Ga0501045_0116687
609 nmdc:mga00v17_1470_c1
610 nmdc:mga00v17_168_c1
611 nmdc:mga00v17_192539_c1
612 nmdc:mga00v17_37315_c1
613 nmdc:mga00v17_510_c1
614 nmdc:mga0yw44_116286_c1
615 nmdc:mga0yw44_33344_c1
616 nmdc:mga0yw44_649_c1
617 nmdc:mga07m45_217190_c1
618 nmdc:mga08y16_168743_c1
619 Ga0500635_0000059
620 Ga0500643_000181
621 Ga0500556_0000008
622 Ga0500556_0000108
623 Ga0500562_004146
624 Ga0500593_000842
625 Ga0500618_000464
626 Ga0500655_018176
627 Ga0500559_0000269
628 Ga0500559_0000416
629 Ga0500559_0000485
630 Ga0500559_0095161
631 Ga0500568_0000003
632 Ga0500568_0000072
633 Ga0500568_0000754
634 Ga0500568_0001893
635 Ga0500573_0001981
636 Ga0500573_0006392
637 Ga0500573_0015110
638 Ga0500573_0018826
639 Ga0500573_0130035
640 Ga0500577_0027879
641 Ga0500616_0000010
642 Ga0500616_0000209
643 Ga0500616_0002704
644 Ga0500616_0139087
645 Ga0500627_0016732
646 Ga0500645_024030
647 Ga0501084_0028269
648 2566996580
649 2587861780
650 2643784869
651 2643877333
652 2644084655
653 2644094235
654 2644181555
655 2644197731
656 2644279997
657 2644384388
658 2644455428
659 2644667267
660 2739204924
661 2753300822
662 2808899578
663 2816423795
664 2821127198
665 2835188331
666 2837271531
667 2838740659
668 2841844500
669 2842144432
670 2844844533
671 2844853776
672 2848551797
673 2852643829
674 2857534822
675 2857731642
676 2857736976
677 2857738929
678 2862994279
679 2870625151
680 2883824752
681 2884763683
682 2895661854
683 2904431245
684 2904504639
685 2904539098
686 2908674933
687 2909075752
688 2919041015
689 2919046001
690 2919056490
691 2919444382
692 2919526484
693 2922555765
694 2928106649
695 2928124455
696 2928144343
697 2928155298
698 2928501901
699 2929142316
700 2935892467
701 2939659920
702 2939661805
703 2964327722
704 2966922473
705 2966927360
706 2984552890
707 2995729192
708 3003001113
709 8054358028
710 8055037468
711 8055039717
712 8056040589
713 8056582713
714 8057346740

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21948

LplA-B_cat

Lipoyl protein ligase A/B catalytic domain

138

341

0.96

PF03099

BPL_LplA_LipB

Biotin/lipoate A/B protein ligase family

174

291

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3r07-assembly1.cif.gz_A structural analysis of an archaeal lipoylation system. a bi-partite lipoate protein ligase and its e2 lipoyl domain from thermoplasma acidophilum 0.8741 100 324
6jom-assembly1.cif.gz_A crystal structure of lipoate protein ligase from mycoplasma hyopneumoniae 0.8454 102 323
2aru-assembly1.cif.gz_A crystal structure of lipoate-protein ligase a bound with atp 0.8328 100 324
2c8m-assembly4.cif.gz_D structure of protein ta0514, putative lipoate protein ligase from t. acidophilum with bound lipoic acid 0.8292 100 324
2c7i-assembly2.cif.gz_B structure of protein ta0514, putative lipoate protein ligase from t. acidophilum. 0.824 100 326
ID Description Score Start End Superfamily
3r07A00 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8741 100 324 3.30.930.10
af_Q2FZN7_2_241_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8621 102 324 3.30.930.10
af_Q2FY37_5_276_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8311 101 326 3.30.930.10
1vqzA02 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;CO dehydrogenase flavoprotein, C-terminal domain 0.8292 1 86 3.30.390.50
af_Q54KY1_54_299_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8263 100 323 3.30.930.10
ID Description Score Start End GO Terms
AF-A0A4S1ECE8-F1-model_v4 Biotin--protein ligase 1 2 90 GO:0016874
AF-A0A4R3LPN1-F1-model_v4 Lipoate--protein ligase 0.9944 2 90
AF-A0A8B5XI26-F1-model_v4 Biotin--protein ligase 0.9895 2 90 GO:0016874
AF-M1L2C3-F1-model_v4 Lipoate--protein ligase 0.9878 1 90
AF-A0A0D0RY12-F1-model_v4 Lipoate-protein ligase A 0.9873 2 90 GO:0016874

Map