F420941

General Info

Members Datasets Scaffolds Average Seq Length
357 243 714 214

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0279773|Ga0466967_0279773_756_1403
Length 215
Sequence VSIVMITLTFDNGPDPEVTPMVLRALAARDILATFFVVGEQLARSREPAERAHAAGHWIGNHTYTHAKPLGRVDAATARAEIERTQELLGELAHPDRLFRPPGGGGALGPHLLNPAAAELLRAGAYTCVLWNAVPGDWKHPDNWVERALTLCAEHEHTLLVLHDLPSGAMRQLERFLDAGLEFTQDFPPACVPLRRGEGSLVEYVDPLQDADGVA

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
118 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
119 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
120 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
121 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
124 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
125 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
126 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
127 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
128 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
129 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
130 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
131 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
132 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
133 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
134 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
136 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
137 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
138 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
139 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
140 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
141 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
142 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
143 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
144 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
145 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
146 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
147 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
148 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
149 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
154 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
155 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
156 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
157 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
158 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
159 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
160 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
161 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
162 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
163 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
164 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
165 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
166 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
167 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
168 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
169 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
170 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
171 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
172 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
173 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
174 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
175 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
176 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
177 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
178 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
179 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
180 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
181 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
182 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
183 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
184 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
185 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
186 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
187 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
188 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
189 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
190 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
191 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
192 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
193 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
194 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
195 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
196 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
197 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
202 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
214 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
215 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
216 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
219 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
220 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
221 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
222 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
223 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
224 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
225 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
226 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
227 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
228 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
229 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
230 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
231 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
232 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
233 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
234 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
235 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
236 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
237 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
238 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
239 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
240 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
241 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
242 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
243 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0
Isolates 0.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.12
Nodule 0
Rhizoplane 1.12
Rhizosphere 95.8
Stem 0
Stem Tuber 0
Unclassified 6.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0279773 3300045976 Bacteria 1601
2 JGI25404J52841_10000309 3300003659 Bacteria 6427
3 Ga0065707_10002472 3300005295 Bacteria 4857
4 Ga0070690_100000131 3300005330 Bacteria 38893
5 Ga0070690_100153472 3300005330 Bacteria 1573
6 Ga0068869_100000392 3300005334 Bacteria 23853
7 Ga0070680_100055201 3300005336 Bacteria 3246
8 Ga0068868_100000656 3300005338 Bacteria 23322
9 Ga0068868_100164509 3300005338 Bacteria 1834
10 Ga0070689_100006489 3300005340 Bacteria 8103
11 Ga0070691_10000200 3300005341 Bacteria 20142
12 Ga0070687_100000175 3300005343 Bacteria 22196
13 Ga0070692_10001132 3300005345 Bacteria 9346
14 Ga0070675_100076173 3300005354 Bacteria 2790
15 Ga0070673_100076069 3300005364 Bacteria 2710
16 Ga0070703_10016169 3300005406 Bacteria 2140
17 Ga0070709_10261364 3300005434 Bacteria 1251
18 Ga0070714_100005976 3300005435 Bacteria 9346
19 Ga0070714_100113968 3300005435 Bacteria 2398
20 Ga0070713_100068993 3300005436 Bacteria 2980
21 Ga0070710_10007458 3300005437 Bacteria 5296
22 Ga0070710_10014101 3300005437 Bacteria 4015
23 Ga0070701_10000676 3300005438 Bacteria 12013
24 Ga0070711_100155170 3300005439 Bacteria 1730
25 Ga0070705_100003918 3300005440 Bacteria 7277
26 Ga0070705_100195854 3300005440 Bacteria 1381
27 Ga0070705_100350218 3300005440 Bacteria 1076
28 Ga0070705_100376226 3300005440 Bacteria 1044
29 Ga0070700_100000587 3300005441 Bacteria 18243
30 Ga0070694_100000136 3300005444 Bacteria 36787
31 Ga0070694_100046100 3300005444 Bacteria 2925
32 Ga0070708_100126490 3300005445 Bacteria 2363
33 Ga0070708_100301781 3300005445 Bacteria 1508
34 Ga0070681_10161790 3300005458 Bacteria 2162
35 Ga0068867_100001154 3300005459 Bacteria 18064
36 Ga0070706_100241751 3300005467 Bacteria 1686
37 Ga0070699_100061911 3300005518 Bacteria 3243
38 Ga0070699_100123423 3300005518 Bacteria 2279
39 Ga0070679_100009411 3300005530 Bacteria 9240
40 Ga0070679_100225076 3300005530 Bacteria 1836
41 Ga0068853_100048952 3300005539 Bacteria 3631
42 Ga0070686_100000285 3300005544 Bacteria 34108
43 Ga0070695_100000705 3300005545 Bacteria 17853
44 Ga0070695_100024830 3300005545 Bacteria 3696
45 Ga0070696_100007742 3300005546 Bacteria 7169
46 Ga0070696_100025633 3300005546 Bacteria 4009
47 Ga0070696_100038288 3300005546 Bacteria 3309
48 Ga0070696_100235513 3300005546 Bacteria 1379
49 Ga0070696_100561483 3300005546 Bacteria 916
50 Ga0070693_100000278 3300005547 Bacteria 24050
51 Ga0070693_100417474 3300005547 Bacteria 934
52 Ga0070704_100000103 3300005549 Bacteria 29844
53 Ga0068854_100001266 3300005578 Bacteria 15179
54 Ga0068856_100025824 3300005614 Bacteria 5728
55 Ga0070702_100000039 3300005615 Bacteria 35203
56 Ga0068859_100000420 3300005617 Bacteria 42401
57 Ga0068859_100586757 3300005617 Bacteria 1208
58 Ga0068864_100106000 3300005618 Bacteria 2499
59 Ga0068866_10001352 3300005718 Bacteria 10601
60 Ga0068861_100000399 3300005719 Bacteria 25138
61 Ga0068870_10411875 3300005840 Bacteria 882
62 Ga0068858_100005769 3300005842 Bacteria 12097
63 Ga0068860_100000280 3300005843 Bacteria 72849
64 Ga0068860_100002528 3300005843 Bacteria 19155
65 Ga0068860_100546763 3300005843 Bacteria 1160
66 Ga0068862_100005981 3300005844 Bacteria 10130
67 Ga0081540_1000022 3300005983 Bacteria 161205
68 Ga0081539_10000668 3300005985 Bacteria 68754
69 Ga0070717_10004059 3300006028 Bacteria 10551
70 Ga0070717_10005841 3300006028 Bacteria 9018
71 Ga0075364_10150563 3300006051 Bacteria 1568
72 Ga0070715_10000713 3300006163 Bacteria 8928
73 Ga0070715_10035063 3300006163 Bacteria 2061
74 Ga0070715_10269273 3300006163 Bacteria 898
75 Ga0070716_100004538 3300006173 Bacteria 6652
76 Ga0070716_100082603 3300006173 Bacteria 1922
77 Ga0070716_100288930 3300006173 Bacteria 1135
78 Ga0097621_100000754 3300006237 Bacteria 22721
79 Ga0075428_100015471 3300006844 Bacteria 8460
80 Ga0075428_100016740 3300006844 Bacteria 8096
81 Ga0075431_100318683 3300006847 Bacteria 1568
82 Ga0075433_10011246 3300006852 Bacteria 7205
83 Ga0075434_100006963 3300006871 Bacteria 10421
84 Ga0075434_100209619 3300006871 Unclassified 1969
85 Ga0075434_100818580 3300006871 Bacteria 947
86 Ga0075429_100001365 3300006880 Bacteria 19968
87 Ga0075429_100262074 3300006880 Bacteria 1513
88 Ga0068865_100001524 3300006881 Bacteria 13518
89 Ga0075436_100002990 3300006914 Bacteria 11576
90 Ga0075436_100007888 3300006914 Bacteria 7286
91 Ga0075436_100016663 3300006914 Bacteria 5030
92 Ga0075436_100050512 3300006914 Bacteria 2870
93 Ga0075436_100144389 3300006914 Bacteria 1673
94 Ga0075436_100210915 3300006914 Bacteria 1377
95 Ga0097620_100000420 3300006931 Bacteria 42401
96 Ga0097620_100586821 3300006931 Bacteria 1208
97 Ga0075435_100007468 3300007076 Bacteria 7793
98 Ga0105240_10000301 3300009093 Bacteria 96340
99 Ga0111539_10026623 3300009094 Bacteria 7069
100 Ga0111539_10153421 3300009094 Bacteria 2696
101 Ga0105245_10012764 3300009098 Bacteria 7317
102 Ga0114129_10002987 3300009147 Bacteria 23703
103 Ga0114129_10018404 3300009147 Bacteria 9950
104 Ga0114129_10488221 3300009147 Bacteria 1610
105 Ga0114129_10768750 3300009147 Bacteria 1232
106 Ga0114129_10797761 3300009147 Bacteria 1205
107 Ga0105243_10002912 3300009148 Bacteria 14169
108 Ga0105243_10736709 3300009148 Unclassified 965
109 Ga0105242_10000248 3300009176 Bacteria 42523
110 Ga0105248_10243032 3300009177 Bacteria 2026
111 Ga0105248_11093655 3300009177 Bacteria 901
112 Ga0105249_10054817 3300009553 Bacteria 3646
113 Ga0105239_10000769 3300010375 Bacteria 45350
114 Ga0105239_10199942 3300010375 Bacteria 2239
115 Ga0157378_10000387 3300013297 Bacteria 43542
116 Ga0157379_10157461 3300014968 Bacteria 2049
117 Ga0157376_10012006 3300014969 Bacteria 6410
118 Ga0207692_10001254 3300025898 Bacteria 9420
119 Ga0207692_10085221 3300025898 Bacteria 1699
120 Ga0207685_10039162 3300025905 Bacteria 1757
121 Ga0207699_10004416 3300025906 Bacteria 6728
122 Ga0207699_10112606 3300025906 Bacteria 1747
123 Ga0207643_10026415 3300025908 Bacteria 3214
124 Ga0207684_10386493 3300025910 Bacteria 1203
125 Ga0207695_10000399 3300025913 Bacteria 97109
126 Ga0207693_10016777 3300025915 Bacteria 5846
127 Ga0207663_10006458 3300025916 Bacteria 5998
128 Ga0207663_10014805 3300025916 Bacteria 4285
129 Ga0207663_10152771 3300025916 Bacteria 1621
130 Ga0207663_10526341 3300025916 Unclassified 921
131 Ga0207660_10043670 3300025917 Bacteria 3150
132 Ga0207662_10000095 3300025918 Bacteria 41923
133 Ga0207652_10167007 3300025921 Bacteria 1973
134 Ga0207652_10191043 3300025921 Bacteria 1842
135 Ga0207646_10335616 3300025922 Bacteria 1366
136 Ga0207646_11003041 3300025922 Bacteria 738
137 Ga0207687_10003242 3300025927 Bacteria 11024
138 Ga0207700_10045495 3300025928 Bacteria 3239
139 Ga0207700_10051313 3300025928 Bacteria 3078
140 Ga0207664_10010661 3300025929 Bacteria 6498
141 Ga0207686_10001874 3300025934 Bacteria 11669
142 Ga0207709_10001439 3300025935 Bacteria 16614
143 Ga0207670_10002023 3300025936 Bacteria 10646
144 Ga0207704_10000623 3300025938 Bacteria 15673
145 Ga0207665_10001457 3300025939 Bacteria 15930
146 Ga0207665_10203310 3300025939 Bacteria 1444
147 Ga0207689_10000977 3300025942 Bacteria 27402
148 Ga0207667_10054429 3300025949 Bacteria 4209
149 Ga0207651_10493308 3300025960 Bacteria 1057
150 Ga0207712_10013536 3300025961 Bacteria 5231
151 Ga0207640_10019295 3300025981 Bacteria 4026
152 Ga0207677_10017944 3300026023 Bacteria 4236
153 Ga0207677_10191257 3300026023 Bacteria 1619
154 Ga0207703_10012439 3300026035 Bacteria 6635
155 Ga0207703_10018478 3300026035 Bacteria 5444
156 Ga0207639_10188587 3300026041 Bacteria 1759
157 Ga0207708_10000551 3300026075 Bacteria 28958
158 Ga0207702_10064024 3300026078 Bacteria 3146
159 Ga0207641_10188923 3300026088 Bacteria 1892
160 Ga0207641_10713205 3300026088 Unclassified 988
161 Ga0207648_10000513 3300026089 Bacteria 43298
162 Ga0207676_10042430 3300026095 Bacteria 3499
163 Ga0207675_100001063 3300026118 Bacteria 27254
164 Ga0209968_1035278 3300027526 Unclassified 844
165 Ga0209999_1007845 3300027543 Bacteria 1919
166 Ga0209971_1011206 3300027682 Bacteria 2124
167 Ga0209966_1005739 3300027695 Unclassified 2137
168 Ga0209998_10049550 3300027717 Unclassified 970
169 Ga0207428_10011126 3300027907 Bacteria 7987
170 Ga0268265_10009410 3300028380 Bacteria 6598
171 Ga0268264_10000038 3300028381 Bacteria 383623
172 Ga0268264_10005879 3300028381 Bacteria 10384
173 Ga0268264_10463231 3300028381 Bacteria 1230
174 Ga0265339_10118292 3300031249 Bacteria 1364
175 Ga0307509_10099206 3300031507 Bacteria 2955
176 Ga0307508_10278892 3300031616 Bacteria 1265
177 Ga0265314_10122335 3300031711 Bacteria 1636
178 Ga0307516_10001965 3300031730 Bacteria 28151
179 Ga0307412_10122698 3300031911 Bacteria 1873
180 Ga0373930_0006580 3300034816 Bacteria 1972
181 Ga0373950_0011708 3300034818 Bacteria 1437
182 Ga0373958_0007258 3300034819 Bacteria 1759
183 Ga0373938_0014840 3300034957 Bacteria 1501
184 Ga0373926_0002148 3300035083 Bacteria 6207
185 Ga0373926_0041865 3300035083 Bacteria 1638
186 Ga0373929_0017929 3300035085 Bacteria 1402
187 Ga0373940_0002387 3300035088 Bacteria 3642
188 Ga0373944_0082730 3300035089 Bacteria 1062
189 Ga0373949_0112324 3300035090 Unclassified 757
190 Ga0373949_0126405 3300035090 Bacteria 722
191 Ga0373951_0136159 3300035091 Bacteria 679
192 Ga0373952_0005208 3300035092 Bacteria 2372
193 Ga0373923_0129741 3300035111 Bacteria 1132
194 Ga0373936_0019842 3300035113 Bacteria 2607
195 Ga0373939_0009966 3300035114 Bacteria 2365
196 Ga0373939_0232134 3300035114 Bacteria 711
197 Ga0373941_0000748 3300035115 Bacteria 6656
198 Ga0373941_0005268 3300035115 Bacteria 3033
199 Ga0373945_0137428 3300035116 Bacteria 983
200 Ga0373957_0003144 3300035120 Bacteria 4828
201 Ga0373960_0022592 3300035121 Unclassified 1686
202 Ga0373943_0137007 3300035170 Bacteria 1315
203 Ga0373946_0038218 3300035171 Bacteria 1954
204 Ga0373955_0019767 3300035172 Bacteria 3372
205 Ga0373942_0033340 3300035207 Bacteria 1372
206 Ga0373962_0006211 3300035242 Bacteria 2890
207 Ga0373931_0001918 3300035691 Bacteria 9111
208 Ga0373931_0180895 3300035691 Bacteria 1248
209 Ga0373931_0518570 3300035691 Bacteria 771
210 Ga0373935_0085315 3300035692 Bacteria 2058
211 Ga0373935_0290697 3300035692 Unclassified 1153
212 Ga0373927_0008733 3300035695 Bacteria 6806
213 Ga0373947_0023835 3300035725 Bacteria 3562
214 Ga0373947_0027205 3300035725 Bacteria 3346
215 Ga0373937_0114069 3300036401 Bacteria 2515
216 Ga0373937_0492514 3300036401 Bacteria 1164
217 Ga0373925_0012851 3300037068 Bacteria 6065
218 Ga0373925_0040428 3300037068 Bacteria 3452
219 Ga0395901_0299618 3300038443 Bacteria 1667
220 Ga0436365_1046752 3300039437 Bacteria 5704
221 Ga0439453_0002530 3300041408 Bacteria 2533
222 Ga0439441_000926 3300042001 Bacteria 3561
223 Ga0439441_004020 3300042001 Bacteria 2205
224 Ga0439443_006887 3300042003 Bacteria 1568
225 Ga0439435_0000065 3300042436 Bacteria 12662
226 Ga0439435_0000074 3300042436 Bacteria 11894
227 Ga0439444_0007271 3300042437 Bacteria 1697
228 Ga0439460_0001166 3300042461 Bacteria 6165
229 Ga0451577_0063848 3300042876 Bacteria 3284
230 Ga0451577_0251558 3300042876 Bacteria 1600
231 Ga0466963_0051914 3300044694 Bacteria 2719
232 Ga0466963_0248840 3300044694 Bacteria 1247
233 Ga0466963_0408202 3300044694 Bacteria 958
234 Ga0466964_0083168 3300044706 Archaea 1378
235 Ga0451576_0018030 3300045051 Bacteria 7745
236 Ga0451576_0020308 3300045051 Bacteria 7235
237 Ga0466967_0008390 3300045976 Bacteria 7562
238 Ga0466967_0049707 3300045976 Bacteria 3668
239 Ga0466967_0196093 3300045976 Bacteria 1910
240 Ga0495592_0151528 3300046454 Bacteria 1603
241 Ga0495603_0212013 3300046455 Bacteria 1118
242 Ga0495629_0052986 3300046459 Bacteria 2839
243 Ga0495580_0032507 3300046472 Bacteria 3765
244 Ga0495582_0036167 3300046473 Bacteria 2716
245 Ga0495639_0054710 3300046475 Bacteria 1819
246 Ga0495584_0053485 3300046491 Bacteria 2032
247 Ga0495607_0255697 3300046501 Bacteria 841
248 Ga0495608_0251629 3300046511 Unclassified 1101
249 Ga0495618_0035933 3300046514 Unclassified 3109
250 Ga0495628_0024251 3300046516 Bacteria 4967
251 Ga0495642_0150964 3300046528 Bacteria 1005
252 Ga0495665_0181887 3300046531 Bacteria 1092
253 Ga0495640_0078383 3300046533 Bacteria 2201
254 Ga0495586_0009170 3300046535 Bacteria 5265
255 Ga0495587_0020566 3300046536 Bacteria 4072
256 Ga0495598_0011120 3300046537 Bacteria 2174
257 Ga0495598_0021000 3300046537 Bacteria 1731
258 Ga0495598_0267173 3300046537 Bacteria 638
259 Ga0495645_0014720 3300046543 Bacteria 5555
260 Ga0495667_0206664 3300046559 Bacteria 1255
261 Ga0495634_0042936 3300046642 Bacteria 3065
262 Ga0495588_0171628 3300046674 Bacteria 1146
263 Ga0495599_0058823 3300046678 Bacteria 2404
264 Ga0495623_0063930 3300046679 Unclassified 2303
265 Ga0495646_0114547 3300046680 Bacteria 1532
266 Ga0495647_0001740 3300046681 Bacteria 6749
267 Ga0495658_0013614 3300046683 Bacteria 4143
268 Ga0495669_0016515 3300046684 Bacteria 3162
269 Ga0495600_0035280 3300046809 Bacteria 3247
270 Ga0495604_0087311 3300047317 Bacteria 2323
271 Ga0495674_0256261 3300047319 Unclassified 1438
272 Ga0495676_0197121 3300047321 Bacteria 1401
273 Ga0495680_0087919 3300047322 Unclassified 2336
274 Ga0495677_0071436 3300047445 Bacteria 1294
275 Ga0495684_0030688 3300047471 Bacteria 4127
276 Ga0496100_0167574 3300048903 Unclassified 1579
277 Ga0496103_0236605 3300048906 Unclassified 1175
278 Ga0496106_0521883 3300048909 Unclassified 954
279 Ga0496106_0544508 3300048909 Bacteria 931
280 Ga0496126_0021133 3300048929 Bacteria 6364
281 Ga0501033_0047329 3300049570 Bacteria 3198
282 Ga0501036_0066904 3300049572 Bacteria 3040
283 Ga0501036_0482707 3300049572 Bacteria 1032
284 Ga0501037_0324110 3300049573 Bacteria 1066
285 Ga0501038_0223943 3300049574 Bacteria 1500
286 Ga0501038_0304046 3300049574 Bacteria 1251
287 Ga0501038_0415397 3300049574 Bacteria 1039
288 Ga0501039_0209462 3300049575 Bacteria 1533
289 Ga0501039_0309750 3300049575 Bacteria 1241
290 Ga0501040_0020631 3300049576 Bacteria 4393
291 Ga0501040_0042554 3300049576 Bacteria 3094
292 Ga0501040_0419201 3300049576 Bacteria 962
293 Ga0501041_0020118 3300049577 Bacteria 3987
294 Ga0501041_0036373 3300049577 Bacteria 2983
295 Ga0501041_0127864 3300049577 Bacteria 1582
296 Ga0501042_0189784 3300049578 Unclassified 1482
297 Ga0501042_0351495 3300049578 Bacteria 1066
298 Ga0501042_0640950 3300049578 Bacteria 772
299 Ga0501043_0097663 3300049579 Bacteria 2309
300 Ga0501043_0525632 3300049579 Unclassified 881
301 Ga0501046_0033764 3300049580 Bacteria 4132
302 Ga0501046_0193731 3300049580 Bacteria 1515
303 Ga0501046_0332795 3300049580 Bacteria 1105
304 Ga0501048_0034523 3300049582 Bacteria 3648
305 Ga0501048_0063031 3300049582 Bacteria 2623
306 Ga0501067_0117379 3300049583 Bacteria 1480
307 Ga0501069_0097485 3300049585 Bacteria 1667
308 Ga0501071_0117406 3300049587 Bacteria 1970
309 Ga0501072_0048275 3300049588 Bacteria 3352
310 Ga0501072_0296814 3300049588 Bacteria 1284
311 Ga0501074_0610589 3300049590 Bacteria 771
312 Ga0501075_0033716 3300049591 Bacteria 3809
313 Ga0501075_0101507 3300049591 Bacteria 2185
314 Ga0501076_0007316 3300049592 Bacteria 8032
315 Ga0501077_0169654 3300049593 Unclassified 1386
316 Ga0501079_0016354 3300049741 Bacteria 5668
317 Ga0501079_0154303 3300049741 Bacteria 1790
318 Ga0501079_0247421 3300049741 Bacteria 1393
319 Ga0501081_0028436 3300049743 Bacteria 3773
320 Ga0501081_0255313 3300049743 Unclassified 1280
321 Ga0501081_0462507 3300049743 Bacteria 943
322 Ga0501045_0018219 3300049824 Bacteria 4992
323 Ga0501045_0094331 3300049824 Bacteria 2213
324 nmdc:mga00v17_211394_c1 3300050491 Bacteria 1255
325 nmdc:mga05p37_1084565_c1 3300050507 Unclassified 840
326 nmdc:mga05p37_1935_c1 3300050507 Bacteria 24113
327 nmdc:mga05p37_456439_c1 3300050507 Bacteria 1478
328 nmdc:mga05p37_653324_c1 3300050507 Bacteria 1177
329 nmdc:mga05p37_901390_c1 3300050507 Bacteria 953
330 nmdc:mga09592_1903_c1 3300050508 Bacteria 16783
331 nmdc:mga09592_267846_c1 3300050508 Bacteria 1482
332 nmdc:mga0qj67_130361_c1 3300050509 Bacteria 2037
333 nmdc:mga06r32_297831_c1 3300050510 Bacteria 1599
334 nmdc:mga06r32_68331_c1 3300050510 Bacteria 3433
335 nmdc:mga08y16_10187_c1 3300050511 Bacteria 9872
336 nmdc:mga08y16_306601_c1 3300050511 Bacteria 1636
337 nmdc:mga0n895_13013_c1 3300050512 Bacteria 7485
338 nmdc:mga0n895_434052_c1 3300050512 Bacteria 1327
339 nmdc:mga0rr50_3348_c1 3300050513 Bacteria 9209
340 nmdc:mga08x19_20710_c1 3300050514 Bacteria 4052
341 nmdc:mga08x19_236727_c1 3300050514 Bacteria 1258
342 nmdc:mga08x19_4374_c1 3300050514 Bacteria 8380
343 nmdc:mga08x19_4462_c1 3300050514 Bacteria 8292
344 nmdc:mga08x19_591763_c1 3300050514 Bacteria 786
345 nmdc:mga0a205_14700_c1 3300050515 Bacteria 7303
346 Ga0495601_0135628 3300053077 Bacteria 1604
347 Ga0495612_0052899 3300053078 Bacteria 1671
348 Ga0495595_0012988 3300053084 Bacteria 3513
349 Ga0500568_0049424 3300053139 Bacteria 1660
350 Ga0500616_0128528 3300053153 Bacteria 1200
351 Ga0501084_0032421 3300054114 Bacteria 4371
352 Ga0501084_0329819 3300054114 Bacteria 1289
353 Ga0501082_0025768 3300060353 Bacteria 5067
354 Ga0501082_0151663 3300060353 Bacteria 2013
355 Ga0530510_0001026 3300061734 Bacteria 18491
356 2753765889 2751185897 Bacteria 5322941
357 2902407844 2902405164 Bacteria 6784948
358 Ga0466967_0279773
359 JGI25404J52841_10000309
360 Ga0065707_10002472
361 Ga0070690_100000131
362 Ga0070690_100153472
363 Ga0068869_100000392
364 Ga0070680_100055201
365 Ga0068868_100000656
366 Ga0068868_100164509
367 Ga0070689_100006489
368 Ga0070691_10000200
369 Ga0070687_100000175
370 Ga0070692_10001132
371 Ga0070675_100076173
372 Ga0070673_100076069
373 Ga0070703_10016169
374 Ga0070709_10261364
375 Ga0070714_100005976
376 Ga0070714_100113968
377 Ga0070713_100068993
378 Ga0070710_10007458
379 Ga0070710_10014101
380 Ga0070701_10000676
381 Ga0070711_100155170
382 Ga0070705_100003918
383 Ga0070705_100195854
384 Ga0070705_100350218
385 Ga0070705_100376226
386 Ga0070700_100000587
387 Ga0070694_100000136
388 Ga0070694_100046100
389 Ga0070708_100126490
390 Ga0070708_100301781
391 Ga0070681_10161790
392 Ga0068867_100001154
393 Ga0070706_100241751
394 Ga0070699_100061911
395 Ga0070699_100123423
396 Ga0070679_100009411
397 Ga0070679_100225076
398 Ga0068853_100048952
399 Ga0070686_100000285
400 Ga0070695_100000705
401 Ga0070695_100024830
402 Ga0070696_100007742
403 Ga0070696_100025633
404 Ga0070696_100038288
405 Ga0070696_100235513
406 Ga0070696_100561483
407 Ga0070693_100000278
408 Ga0070693_100417474
409 Ga0070704_100000103
410 Ga0068854_100001266
411 Ga0068856_100025824
412 Ga0070702_100000039
413 Ga0068859_100000420
414 Ga0068859_100586757
415 Ga0068864_100106000
416 Ga0068866_10001352
417 Ga0068861_100000399
418 Ga0068870_10411875
419 Ga0068858_100005769
420 Ga0068860_100000280
421 Ga0068860_100002528
422 Ga0068860_100546763
423 Ga0068862_100005981
424 Ga0081540_1000022
425 Ga0081539_10000668
426 Ga0070717_10004059
427 Ga0070717_10005841
428 Ga0075364_10150563
429 Ga0070715_10000713
430 Ga0070715_10035063
431 Ga0070715_10269273
432 Ga0070716_100004538
433 Ga0070716_100082603
434 Ga0070716_100288930
435 Ga0097621_100000754
436 Ga0075428_100015471
437 Ga0075428_100016740
438 Ga0075431_100318683
439 Ga0075433_10011246
440 Ga0075434_100006963
441 Ga0075434_100209619
442 Ga0075434_100818580
443 Ga0075429_100001365
444 Ga0075429_100262074
445 Ga0068865_100001524
446 Ga0075436_100002990
447 Ga0075436_100007888
448 Ga0075436_100016663
449 Ga0075436_100050512
450 Ga0075436_100144389
451 Ga0075436_100210915
452 Ga0097620_100000420
453 Ga0097620_100586821
454 Ga0075435_100007468
455 Ga0105240_10000301
456 Ga0111539_10026623
457 Ga0111539_10153421
458 Ga0105245_10012764
459 Ga0114129_10002987
460 Ga0114129_10018404
461 Ga0114129_10488221
462 Ga0114129_10768750
463 Ga0114129_10797761
464 Ga0105243_10002912
465 Ga0105243_10736709
466 Ga0105242_10000248
467 Ga0105248_10243032
468 Ga0105248_11093655
469 Ga0105249_10054817
470 Ga0105239_10000769
471 Ga0105239_10199942
472 Ga0157378_10000387
473 Ga0157379_10157461
474 Ga0157376_10012006
475 Ga0207692_10001254
476 Ga0207692_10085221
477 Ga0207685_10039162
478 Ga0207699_10004416
479 Ga0207699_10112606
480 Ga0207643_10026415
481 Ga0207684_10386493
482 Ga0207695_10000399
483 Ga0207693_10016777
484 Ga0207663_10006458
485 Ga0207663_10014805
486 Ga0207663_10152771
487 Ga0207663_10526341
488 Ga0207660_10043670
489 Ga0207662_10000095
490 Ga0207652_10167007
491 Ga0207652_10191043
492 Ga0207646_10335616
493 Ga0207646_11003041
494 Ga0207687_10003242
495 Ga0207700_10045495
496 Ga0207700_10051313
497 Ga0207664_10010661
498 Ga0207686_10001874
499 Ga0207709_10001439
500 Ga0207670_10002023
501 Ga0207704_10000623
502 Ga0207665_10001457
503 Ga0207665_10203310
504 Ga0207689_10000977
505 Ga0207667_10054429
506 Ga0207651_10493308
507 Ga0207712_10013536
508 Ga0207640_10019295
509 Ga0207677_10017944
510 Ga0207677_10191257
511 Ga0207703_10012439
512 Ga0207703_10018478
513 Ga0207639_10188587
514 Ga0207708_10000551
515 Ga0207702_10064024
516 Ga0207641_10188923
517 Ga0207641_10713205
518 Ga0207648_10000513
519 Ga0207676_10042430
520 Ga0207675_100001063
521 Ga0209968_1035278
522 Ga0209999_1007845
523 Ga0209971_1011206
524 Ga0209966_1005739
525 Ga0209998_10049550
526 Ga0207428_10011126
527 Ga0268265_10009410
528 Ga0268264_10000038
529 Ga0268264_10005879
530 Ga0268264_10463231
531 Ga0265339_10118292
532 Ga0307509_10099206
533 Ga0307508_10278892
534 Ga0265314_10122335
535 Ga0307516_10001965
536 Ga0307412_10122698
537 Ga0373930_0006580
538 Ga0373950_0011708
539 Ga0373958_0007258
540 Ga0373938_0014840
541 Ga0373926_0002148
542 Ga0373926_0041865
543 Ga0373929_0017929
544 Ga0373940_0002387
545 Ga0373944_0082730
546 Ga0373949_0112324
547 Ga0373949_0126405
548 Ga0373951_0136159
549 Ga0373952_0005208
550 Ga0373923_0129741
551 Ga0373936_0019842
552 Ga0373939_0009966
553 Ga0373939_0232134
554 Ga0373941_0000748
555 Ga0373941_0005268
556 Ga0373945_0137428
557 Ga0373957_0003144
558 Ga0373960_0022592
559 Ga0373943_0137007
560 Ga0373946_0038218
561 Ga0373955_0019767
562 Ga0373942_0033340
563 Ga0373962_0006211
564 Ga0373931_0001918
565 Ga0373931_0180895
566 Ga0373931_0518570
567 Ga0373935_0085315
568 Ga0373935_0290697
569 Ga0373927_0008733
570 Ga0373947_0023835
571 Ga0373947_0027205
572 Ga0373937_0114069
573 Ga0373937_0492514
574 Ga0373925_0012851
575 Ga0373925_0040428
576 Ga0395901_0299618
577 Ga0436365_1046752
578 Ga0439453_0002530
579 Ga0439441_000926
580 Ga0439441_004020
581 Ga0439443_006887
582 Ga0439435_0000065
583 Ga0439435_0000074
584 Ga0439444_0007271
585 Ga0439460_0001166
586 Ga0451577_0063848
587 Ga0451577_0251558
588 Ga0466963_0051914
589 Ga0466963_0248840
590 Ga0466963_0408202
591 Ga0466964_0083168
592 Ga0451576_0018030
593 Ga0451576_0020308
594 Ga0466967_0008390
595 Ga0466967_0049707
596 Ga0466967_0196093
597 Ga0495592_0151528
598 Ga0495603_0212013
599 Ga0495629_0052986
600 Ga0495580_0032507
601 Ga0495582_0036167
602 Ga0495639_0054710
603 Ga0495584_0053485
604 Ga0495607_0255697
605 Ga0495608_0251629
606 Ga0495618_0035933
607 Ga0495628_0024251
608 Ga0495642_0150964
609 Ga0495665_0181887
610 Ga0495640_0078383
611 Ga0495586_0009170
612 Ga0495587_0020566
613 Ga0495598_0011120
614 Ga0495598_0021000
615 Ga0495598_0267173
616 Ga0495645_0014720
617 Ga0495667_0206664
618 Ga0495634_0042936
619 Ga0495588_0171628
620 Ga0495599_0058823
621 Ga0495623_0063930
622 Ga0495646_0114547
623 Ga0495647_0001740
624 Ga0495658_0013614
625 Ga0495669_0016515
626 Ga0495600_0035280
627 Ga0495604_0087311
628 Ga0495674_0256261
629 Ga0495676_0197121
630 Ga0495680_0087919
631 Ga0495677_0071436
632 Ga0495684_0030688
633 Ga0496100_0167574
634 Ga0496103_0236605
635 Ga0496106_0521883
636 Ga0496106_0544508
637 Ga0496126_0021133
638 Ga0501033_0047329
639 Ga0501036_0066904
640 Ga0501036_0482707
641 Ga0501037_0324110
642 Ga0501038_0223943
643 Ga0501038_0304046
644 Ga0501038_0415397
645 Ga0501039_0209462
646 Ga0501039_0309750
647 Ga0501040_0020631
648 Ga0501040_0042554
649 Ga0501040_0419201
650 Ga0501041_0020118
651 Ga0501041_0036373
652 Ga0501041_0127864
653 Ga0501042_0189784
654 Ga0501042_0351495
655 Ga0501042_0640950
656 Ga0501043_0097663
657 Ga0501043_0525632
658 Ga0501046_0033764
659 Ga0501046_0193731
660 Ga0501046_0332795
661 Ga0501048_0034523
662 Ga0501048_0063031
663 Ga0501067_0117379
664 Ga0501069_0097485
665 Ga0501071_0117406
666 Ga0501072_0048275
667 Ga0501072_0296814
668 Ga0501074_0610589
669 Ga0501075_0033716
670 Ga0501075_0101507
671 Ga0501076_0007316
672 Ga0501077_0169654
673 Ga0501079_0016354
674 Ga0501079_0154303
675 Ga0501079_0247421
676 Ga0501081_0028436
677 Ga0501081_0255313
678 Ga0501081_0462507
679 Ga0501045_0018219
680 Ga0501045_0094331
681 nmdc:mga00v17_211394_c1
682 nmdc:mga05p37_1084565_c1
683 nmdc:mga05p37_1935_c1
684 nmdc:mga05p37_456439_c1
685 nmdc:mga05p37_653324_c1
686 nmdc:mga05p37_901390_c1
687 nmdc:mga09592_1903_c1
688 nmdc:mga09592_267846_c1
689 nmdc:mga0qj67_130361_c1
690 nmdc:mga06r32_297831_c1
691 nmdc:mga06r32_68331_c1
692 nmdc:mga08y16_10187_c1
693 nmdc:mga08y16_306601_c1
694 nmdc:mga0n895_13013_c1
695 nmdc:mga0n895_434052_c1
696 nmdc:mga0rr50_3348_c1
697 nmdc:mga08x19_20710_c1
698 nmdc:mga08x19_236727_c1
699 nmdc:mga08x19_4374_c1
700 nmdc:mga08x19_4462_c1
701 nmdc:mga08x19_591763_c1
702 nmdc:mga0a205_14700_c1
703 Ga0495601_0135628
704 Ga0495612_0052899
705 Ga0495595_0012988
706 Ga0500568_0049424
707 Ga0500616_0128528
708 Ga0501084_0032421
709 Ga0501084_0329819
710 Ga0501082_0025768
711 Ga0501082_0151663
712 Ga0530510_0001026
713 2753765889
714 2902407844

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01522

Polysacc_deac_1

Polysaccharide deacetylase

2

121

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hpa-assembly1.cif.gz_A crystal structure of a ba3943 mutant,a ce4 family pseudoenzyme 0.8795 3 190
7y51-assembly1.cif.gz_A-2 acetylxylan esterase from caldanaerobacter subterraneus subsp. tengcongensis tte0866 delta100 mutant 0.8606 4 191
6hm9-assembly1.cif.gz_A crystal structure of a ba3943 mutant,a ce4 family pseudoenzyme with restored enzymatic activity. 0.8575 3 190
7bkf-assembly1.cif.gz_A crystal structure of wt ba3943, a ce4 family pseudoenzyme from bacillus anthracis 0.8553 3 190
5lgc-assembly1.cif.gz_A t48 deacetylase with substrate 0.8441 3 191
ID Description Score Start End Superfamily
4l1gD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8478 5 191 3.20.20.370
5lgcA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8441 3 191 3.20.20.370
4m1bB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.841 4 190 3.20.20.370
2cc0B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8397 1 199 3.20.20.370
af_O53444_35_232_3.20.20.370 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8216 3 192 3.20.20.370
ID Description Score Start End GO Terms
AF-A0A5M6IY05-F1-model_v4 Chitooligosaccharide deacetylase (Nodulation protein B) 0.991 1 215 GO:0005975
GO:0016810
AF-A0A536XYW7-F1-model_v4 Polysaccharide deacetylase family protein 0.9863 5 216 GO:0005975
GO:0016020
GO:0016810
AF-A0A537A9R4-F1-model_v4 Polysaccharide deacetylase family protein 0.9842 1 216 GO:0005975
GO:0016810
AF-A0A7Y9JME6-F1-model_v4 Peptidoglycan/xylan/chitin deacetylase (PgdA/CDA1 family) 0.9823 4 216 GO:0005975
GO:0016810
AF-A0A5M6IY05-F1-model_v4 Chitooligosaccharide deacetylase (Nodulation protein B) 0.982 1 215 GO:0005975
GO:0016810

Map