F421973

General Info

Members Datasets Scaffolds Average Seq Length
360 130 357 284

Family's Representative Sequence

Representative Sequence 3300046507|Ga0495606_0010767|Ga0495606_0010767_943_1998
Length 351
Sequence MHTTLIDAATLSQHLEDPNWVILDCRHDLMNPNAGSDSFAIGHIAGAQFANVDTDLSGAKIGPDGKFQGRHPLPGRAALIETLRGWGIDDDTQVVAYDAHGGMFAARVWWLLRWVGHPAVAVLDGGLVAWQAQGLPMVTHAERRTPGEISDHPSLVTTVSADDVAANLATQERTVVDARAADRYRGENETIDPVGGHIPGAKNRFFKDNLTAEGRFKSAEELKADFAPLFDSAPKAIMQCGSGVTACHNLLALEIAGLPGAALYPGSWTPPAPSPSETKPCSPGPPCGGGRRRSAPGHPASSRRFPVQAPASRRPRRPTGLRSTQRPAARRRRWTNRYWRTRPTAIRTSYR

Samples

Sample ID Description Type Environment
1 2818991436 Collimonas arenae 515 Isolate Unclassified
2 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
3 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
9 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
17 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
18 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
19 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
20 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
21 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
22 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
23 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
24 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
25 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
26 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
27 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
28 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
29 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
30 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
31 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
32 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
33 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
34 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
35 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
36 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
37 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
40 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
41 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
42 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
43 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
44 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
45 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
46 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
47 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
48 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
49 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
50 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
51 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
52 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
53 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
54 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
55 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
56 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
57 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
58 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
59 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
60 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
61 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
62 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
63 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
64 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
65 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
66 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
67 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
68 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
69 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
70 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
71 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
72 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
73 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
74 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
75 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
76 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
77 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
78 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
79 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
80 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
81 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
82 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
83 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
84 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
85 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
86 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
87 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
88 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
89 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
90 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
91 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
92 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
93 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
94 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
95 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
96 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
97 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
98 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
99 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
100 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
101 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
102 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
103 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
104 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
105 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
106 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
107 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
108 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
109 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
110 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
111 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
112 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
113 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
114 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
115 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
116 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
117 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
118 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
119 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
120 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
121 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
122 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
123 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
124 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
125 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
126 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
127 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
128 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
129 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
130 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.17
Metatranscriptomes 0
Isolates 0.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.56
Nodule 0.83
Rhizoplane 1.67
Rhizosphere 76.11
Stem 0
Stem Tuber 0
Unclassified 5.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25150J39212_1000697 3300002774 Bacteria 12152
2 JGI25151J46595_10060944 3300003187 Bacteria 1204
3 rootL2_10017396 3300003322 Bacteria 4819
4 JGI25160J50197_1003026 3300003354 Bacteria 7663
5 JGI25161J50226_1001224 3300003374 Bacteria 8352
6 JGI25161J50226_1001691 3300003374 Bacteria 6312
7 Ga0055529_1000027 3300003763 Bacteria 292744
8 Ga0055526_1000135 3300003771 Bacteria 65528
9 Ga0055526_1027721 3300003771 Bacteria 1740
10 Ga0055524_1000022 3300003775 Bacteria 224103
11 Ga0055524_1002418 3300003775 Bacteria 9633
12 Ga0055524_1006411 3300003775 Bacteria 5105
13 Ga0055524_1007914 3300003775 Bacteria 4466
14 Ga0055530_10002326 3300003791 Bacteria 12415
15 Ga0055530_10023358 3300003791 Bacteria 1779
16 Ga0055530_10023410 3300003791 Bacteria 1775
17 Ga0055531_10009938 3300003794 Bacteria 4803
18 Ga0055543_1002286 3300004625 Bacteria 6470
19 Ga0065165_1000321 3300005262 Bacteria 78264
20 Ga0065165_1006082 3300005262 Bacteria 6470
21 Ga0099826_10000006 3300006948 Bacteria 432260
22 Ga0105244_10015180 3300009036 Bacteria 4424
23 Ga0182008_10023968 3300014497 Bacteria 3110
24 Ga0182006_1000030 3300015261 Bacteria 242894
25 Ga0182006_1000150 3300015261 Bacteria 74692
26 Ga0182007_10000157 3300015262 Bacteria 46516
27 Ga0182005_1000021 3300015265 Bacteria 272185
28 Ga0163161_10147379 3300017792 Bacteria 1786
29 Ga0213872_10000186 3300021361 Bacteria 55142
30 Ga0213872_10000857 3300021361 Bacteria 22035
31 Ga0213872_10008868 3300021361 Bacteria 4844
32 Ga0213872_10075787 3300021361 Bacteria 1514
33 Ga0209436_100866 3300025208 Bacteria 12086
34 Ga0209436_100960 3300025208 Bacteria 11279
35 Ga0209436_118017 3300025208 Bacteria 1016
36 Ga0207425_1000013 3300025245 Bacteria 497384
37 Ga0207425_1000517 3300025245 Bacteria 23589
38 Ga0207425_1000893 3300025245 Bacteria 14486
39 Ga0209646_1000148 3300025246 Bacteria 101083
40 Ga0209129_1000102 3300025258 Bacteria 161712
41 Ga0209129_1003303 3300025258 Bacteria 7123
42 Ga0209565_1001502 3300025263 Bacteria 10164
43 Ga0209565_1001846 3300025263 Bacteria 8494
44 Ga0209565_1003257 3300025263 Bacteria 5349
45 Ga0209565_1010600 3300025263 Bacteria 2279
46 Ga0209455_1000033 3300025272 Bacteria 504606
47 Ga0209130_1000149 3300025284 Bacteria 108821
48 Ga0209130_1003582 3300025284 Bacteria 6484
49 Ga0209130_1006632 3300025284 Bacteria 3722
50 Ga0209130_1008584 3300025284 Bacteria 3001
51 Ga0209025_1007625 3300025294 Bacteria 8008
52 Ga0209564_1000028 3300025295 Bacteria 510986
53 Ga0209564_1000088 3300025295 Bacteria 250268
54 Ga0209564_1000493 3300025295 Bacteria 65593
55 Ga0209564_1021842 3300025295 Bacteria 2285
56 Ga0209564_1023924 3300025295 Bacteria 2103
57 Ga0209758_1000031 3300025297 Bacteria 497252
58 Ga0209758_1000278 3300025297 Bacteria 102052
59 Ga0209050_1000078 3300025298 Bacteria 278409
60 Ga0209050_1001071 3300025298 Bacteria 33572
61 Ga0209050_1007966 3300025298 Bacteria 5794
62 Ga0209256_1000035 3300025299 Bacteria 386754
63 Ga0209256_1000303 3300025299 Bacteria 86575
64 Ga0209256_1000881 3300025299 Bacteria 37099
65 Ga0209256_1003419 3300025299 Bacteria 11168
66 Ga0207426_1002264 3300025302 Bacteria 12725
67 Ga0209257_1002042 3300025304 Bacteria 21502
68 Ga0207655_1014489 3300025728 Bacteria 4451
69 Ga0209281_1007021 3300027111 Bacteria 2858
70 Ga0209282_1000003 3300027666 Bacteria 856377
71 Ga0307515_10136652 3300028794 Bacteria 2660
72 Ga0307408_100000376 3300031548 Bacteria 40776
73 Ga0307408_100019301 3300031548 Bacteria 4589
74 Ga0307518_10172752 3300031838 Bacteria 1471
75 Ga0307406_10216480 3300031901 Bacteria 1421
76 Ga0395899_0000085 3300037312 Bacteria 159118
77 Ga0395899_0003013 3300037312 Bacteria 13445
78 Ga0395905_0074476 3300037471 Bacteria 3182
79 Ga0395905_0134789 3300037471 Bacteria 2323
80 Ga0395901_0148531 3300038443 Bacteria 2463
81 Ga0395901_0301177 3300038443 Bacteria 1662
82 Ga0436361_0035193 3300039447 Bacteria 6298
83 Ga0436361_0529851 3300039447 Bacteria 13369
84 Ga0436361_0900144 3300039447 Bacteria 143515
85 Ga0436361_1192773 3300039447 Bacteria 5076
86 Ga0450904_001178 3300042139 Bacteria 3956
87 Ga0466972_0000595 3300044658 Bacteria 17597
88 Ga0466972_0003892 3300044658 Bacteria 7440
89 Ga0466965_0030658 3300044683 Bacteria 2621
90 Ga0466964_0005655 3300044706 Bacteria 4647
91 Ga0466968_0011001 3300044735 Bacteria 3517
92 Ga0495617_000011 3300046452 Bacteria 301936
93 Ga0495617_002691 3300046452 Bacteria 6893
94 Ga0495627_000006 3300046453 Bacteria 581750
95 Ga0495627_071550 3300046453 Bacteria 1012
96 Ga0495590_0000022 3300046457 Bacteria 205122
97 Ga0495590_0010677 3300046457 Bacteria 3442
98 Ga0495638_0000506 3300046460 Bacteria 46048
99 Ga0495638_0014634 3300046460 Bacteria 5293
100 Ga0495638_0024694 3300046460 Bacteria 3914
101 Ga0495638_0040062 3300046460 Bacteria 2970
102 Ga0495638_0057912 3300046460 Bacteria 2402
103 Ga0495638_0108618 3300046460 Bacteria 1650
104 Ga0495638_0180247 3300046460 Bacteria 1206
105 Ga0495653_0000029 3300046463 Bacteria 145049
106 Ga0495650_0000146 3300046471 Bacteria 163598
107 Ga0495650_0000481 3300046471 Bacteria 61012
108 Ga0495650_0000633 3300046471 Bacteria 47224
109 Ga0495650_0001829 3300046471 Bacteria 19055
110 Ga0495650_0004239 3300046471 Bacteria 9923
111 Ga0495650_0005897 3300046471 Bacteria 7788
112 Ga0495605_0001477 3300046474 Bacteria 15349
113 Ga0495605_0075072 3300046474 Bacteria 1590
114 Ga0495639_0009058 3300046475 Bacteria 4269
115 Ga0495584_0000013 3300046491 Bacteria 185735
116 Ga0495584_0000356 3300046491 Bacteria 31754
117 Ga0495584_0000572 3300046491 Bacteria 24869
118 Ga0495584_0018373 3300046491 Bacteria 3553
119 Ga0495584_0018536 3300046491 Bacteria 3537
120 Ga0495584_0080726 3300046491 Bacteria 1636
121 Ga0495585_0000216 3300046492 Bacteria 59838
122 Ga0495585_0003107 3300046492 Bacteria 11403
123 Ga0495585_0004013 3300046492 Bacteria 9690
124 Ga0495585_0006564 3300046492 Bacteria 7195
125 Ga0495585_0007256 3300046492 Bacteria 6804
126 Ga0495585_0007922 3300046492 Bacteria 6459
127 Ga0495585_0038422 3300046492 Bacteria 2694
128 Ga0495585_0070930 3300046492 Bacteria 1899
129 Ga0495585_0075281 3300046492 Bacteria 1835
130 Ga0495585_0102297 3300046492 Bacteria 1531
131 Ga0495585_0164164 3300046492 Bacteria 1151
132 Ga0495594_0001911 3300046499 Bacteria 10850
133 Ga0495594_0118520 3300046499 Bacteria 1495
134 Ga0495596_0000648 3300046500 Bacteria 21862
135 Ga0495596_0007248 3300046500 Bacteria 5017
136 Ga0495607_0002399 3300046501 Bacteria 15284
137 Ga0495607_0021560 3300046501 Bacteria 4052
138 Ga0495607_0039193 3300046501 Bacteria 2832
139 Ga0495607_0051562 3300046501 Bacteria 2389
140 Ga0495583_0000063 3300046506 Bacteria 194362
141 Ga0495583_0000116 3300046506 Bacteria 135355
142 Ga0495583_0000294 3300046506 Bacteria 79051
143 Ga0495583_0000486 3300046506 Bacteria 57980
144 Ga0495583_0001417 3300046506 Bacteria 24447
145 Ga0495583_0108052 3300046506 Bacteria 1181
146 Ga0495606_0000004 3300046507 Bacteria 406209
147 Ga0495606_0000127 3300046507 Bacteria 129676
148 Ga0495606_0001258 3300046507 Bacteria 35384
149 Ga0495606_0001705 3300046507 Bacteria 28358
150 Ga0495606_0002825 3300046507 Bacteria 19286
151 Ga0495606_0004060 3300046507 Bacteria 14901
152 Ga0495606_0005993 3300046507 Bacteria 11393
153 Ga0495606_0007474 3300046507 Bacteria 9762
154 Ga0495606_0010767 3300046507 Bacteria 7538
155 Ga0495606_0037664 3300046507 Bacteria 3282
156 Ga0495606_0082138 3300046507 Bacteria 2001
157 Ga0495606_0161575 3300046507 Bacteria 1306
158 Ga0495610_0000007 3300046512 Bacteria 820919
159 Ga0495610_0001968 3300046512 Bacteria 17644
160 Ga0495610_0002543 3300046512 Bacteria 15188
161 Ga0495610_0004712 3300046512 Bacteria 9956
162 Ga0495610_0034091 3300046512 Bacteria 2625
163 Ga0495616_0000185 3300046513 Bacteria 52467
164 Ga0495616_0013798 3300046513 Bacteria 4544
165 Ga0495616_0042051 3300046513 Bacteria 2328
166 Ga0495616_0049338 3300046513 Bacteria 2110
167 Ga0495616_0052340 3300046513 Bacteria 2033
168 Ga0495620_0031734 3300046515 Bacteria 2416
169 Ga0495631_0006178 3300046518 Bacteria 6208
170 Ga0495631_0007277 3300046518 Bacteria 5639
171 Ga0495631_0017684 3300046518 Bacteria 3367
172 Ga0495631_0075711 3300046518 Bacteria 1452
173 Ga0495631_0127604 3300046518 Bacteria 1093
174 Ga0495637_0000283 3300046520 Bacteria 39761
175 Ga0495637_0002104 3300046520 Bacteria 11196
176 Ga0495637_0025452 3300046520 Bacteria 2666
177 Ga0495643_0000158 3300046522 Bacteria 110592
178 Ga0495643_0000450 3300046522 Bacteria 52786
179 Ga0495643_0001352 3300046522 Bacteria 22995
180 Ga0495643_0035365 3300046522 Bacteria 2751
181 Ga0495643_0065429 3300046522 Bacteria 1919
182 Ga0495644_0012046 3300046523 Bacteria 3323
183 Ga0495644_0019815 3300046523 Bacteria 2568
184 Ga0495644_0110392 3300046523 Bacteria 1043
185 Ga0495648_0000004 3300046524 Bacteria 373639
186 Ga0495648_0002431 3300046524 Bacteria 17249
187 Ga0495648_0008069 3300046524 Bacteria 8327
188 Ga0495648_0012500 3300046524 Bacteria 6328
189 Ga0495648_0012891 3300046524 Bacteria 6208
190 Ga0495648_0015325 3300046524 Bacteria 5572
191 Ga0495648_0047522 3300046524 Bacteria 2651
192 Ga0495663_0006339 3300046525 Bacteria 3268
193 Ga0495663_0039868 3300046525 Bacteria 1424
194 Ga0495666_0074977 3300046526 Bacteria 1604
195 Ga0495666_0149600 3300046526 Bacteria 1086
196 Ga0495642_0006215 3300046528 Bacteria 4584
197 Ga0495642_0008432 3300046528 Bacteria 3945
198 Ga0495642_0031725 3300046528 Bacteria 2119
199 Ga0495654_0000025 3300046530 Bacteria 236572
200 Ga0495654_0003324 3300046530 Bacteria 9905
201 Ga0495654_0052696 3300046530 Bacteria 1980
202 Ga0495586_0105344 3300046535 Bacteria 1568
203 Ga0495609_0000804 3300046538 Bacteria 23453
204 Ga0495609_0001986 3300046538 Bacteria 12932
205 Ga0495609_0002075 3300046538 Bacteria 12608
206 Ga0495609_0002394 3300046538 Bacteria 11545
207 Ga0495609_0006360 3300046538 Bacteria 6030
208 Ga0495609_0010443 3300046538 Bacteria 4450
209 Ga0495609_0028971 3300046538 Bacteria 2523
210 Ga0495609_0038351 3300046538 Bacteria 2160
211 Ga0495609_0070065 3300046538 Bacteria 1541
212 Ga0495597_0000373 3300046542 Bacteria 39413
213 Ga0495597_0001051 3300046542 Bacteria 21095
214 Ga0495597_0005756 3300046542 Bacteria 6508
215 Ga0495597_0025100 3300046542 Bacteria 2745
216 Ga0495597_0033888 3300046542 Bacteria 2310
217 Ga0495597_0036911 3300046542 Bacteria 2197
218 Ga0495597_0037526 3300046542 Bacteria 2175
219 Ga0495597_0040829 3300046542 Bacteria 2073
220 Ga0495597_0055663 3300046542 Bacteria 1734
221 Ga0495597_0066175 3300046542 Bacteria 1566
222 Ga0495597_0119832 3300046542 Bacteria 1097
223 Ga0495622_0000092 3300046557 Bacteria 80637
224 Ga0495622_0000306 3300046557 Bacteria 36746
225 Ga0495622_0074785 3300046557 Bacteria 1562
226 Ga0495633_0000068 3300046558 Bacteria 136733
227 Ga0495633_0000094 3300046558 Bacteria 120459
228 Ga0495633_0000392 3300046558 Bacteria 46091
229 Ga0495633_0006337 3300046558 Bacteria 7038
230 Ga0495633_0008121 3300046558 Bacteria 5951
231 Ga0495633_0009604 3300046558 Bacteria 5329
232 Ga0495633_0011953 3300046558 Bacteria 4642
233 Ga0495633_0019274 3300046558 Bacteria 3451
234 Ga0495633_0019318 3300046558 Bacteria 3447
235 Ga0495633_0041787 3300046558 Bacteria 2179
236 Ga0495633_0057581 3300046558 Bacteria 1825
237 Ga0495633_0171254 3300046558 Bacteria 1000
238 Ga0495656_0017165 3300046615 Bacteria 2758
239 Ga0495656_0078887 3300046615 Bacteria 1481
240 Ga0495668_0000135 3300046616 Bacteria 111827
241 Ga0495668_0000385 3300046616 Bacteria 58130
242 Ga0495668_0000841 3300046616 Bacteria 34791
243 Ga0495668_0001035 3300046616 Bacteria 29498
244 Ga0495668_0004883 3300046616 Bacteria 9311
245 Ga0495668_0007243 3300046616 Bacteria 7117
246 Ga0495668_0008874 3300046616 Bacteria 6225
247 Ga0495668_0029395 3300046616 Bacteria 3105
248 Ga0495668_0173467 3300046616 Bacteria 1181
249 Ga0495611_0003307 3300046648 Bacteria 7124
250 Ga0495611_0006430 3300046648 Bacteria 5008
251 Ga0495611_0010104 3300046648 Bacteria 3995
252 Ga0495611_0062879 3300046648 Bacteria 1688
253 Ga0495611_0104120 3300046648 Bacteria 1319
254 Ga0495625_0001271 3300046660 Bacteria 31711
255 Ga0495625_0001498 3300046660 Bacteria 28077
256 Ga0495625_0029327 3300046660 Bacteria 4117
257 Ga0495625_0082645 3300046660 Bacteria 2233
258 Ga0495625_0169817 3300046660 Bacteria 1457
259 Ga0495625_0239910 3300046660 Bacteria 1180
260 Ga0495659_0000132 3300046664 Bacteria 32778
261 Ga0495659_0004220 3300046664 Bacteria 4534
262 Ga0495661_0020705 3300046665 Bacteria 4290
263 Ga0495661_0034129 3300046665 Bacteria 3203
264 Ga0495661_0057787 3300046665 Bacteria 2314
265 Ga0495588_0035947 3300046674 Bacteria 2512
266 Ga0495588_0070980 3300046674 Bacteria 1811
267 Ga0495588_0124427 3300046674 Bacteria 1359
268 Ga0495588_0150408 3300046674 Bacteria 1230
269 Ga0495669_0002580 3300046684 Bacteria 7403
270 Ga0495669_0006592 3300046684 Bacteria 4855
271 Ga0495670_0006724 3300046691 Bacteria 5656
272 Ga0495670_0014847 3300046691 Bacteria 3834
273 Ga0495670_0016518 3300046691 Bacteria 3628
274 Ga0495671_0000033 3300046692 Bacteria 197509
275 Ga0495671_0000826 3300046692 Bacteria 22124
276 Ga0495671_0007304 3300046692 Bacteria 6308
277 Ga0495671_0025348 3300046692 Bacteria 3083
278 Ga0495671_0065988 3300046692 Bacteria 1781
279 Ga0495671_0235164 3300046692 Bacteria 885
280 Ga0495649_0016935 3300046694 Bacteria 4124
281 Ga0495649_0101038 3300046694 Bacteria 1533
282 Ga0495660_0001474 3300046810 Bacteria 16009
283 Ga0495660_0002771 3300046810 Bacteria 11055
284 Ga0495660_0006164 3300046810 Bacteria 7120
285 Ga0495660_0039626 3300046810 Bacteria 2616
286 Ga0495660_0111504 3300046810 Bacteria 1395
287 Ga0495636_0000595 3300047318 Bacteria 13292
288 Ga0495636_0006763 3300047318 Bacteria 4507
289 Ga0495636_0070862 3300047318 Bacteria 1487
290 Ga0495636_0160550 3300047318 Bacteria 1012
291 Ga0495672_0000078 3300047320 Bacteria 164474
292 Ga0495672_0000713 3300047320 Bacteria 36575
293 Ga0495672_0008090 3300047320 Bacteria 7810
294 Ga0495676_0014159 3300047321 Bacteria 7141
295 Ga0495676_0191293 3300047321 Bacteria 1427
296 Ga0495683_0000164 3300047323 Bacteria 64840
297 Ga0495683_0000965 3300047323 Bacteria 20164
298 Ga0495683_0019415 3300047323 Bacteria 3508
299 Ga0495683_0019779 3300047323 Bacteria 3473
300 Ga0495683_0076342 3300047323 Bacteria 1639
301 Ga0495683_0107538 3300047323 Bacteria 1335
302 Ga0495687_001336 3300047443 Bacteria 22968
303 Ga0495677_0007578 3300047445 Bacteria 4052
304 Ga0495677_0014842 3300047445 Bacteria 2833
305 Ga0495677_0017154 3300047445 Bacteria 2625
306 Ga0495677_0018505 3300047445 Bacteria 2525
307 Ga0495679_062380 3300047446 Bacteria 1090
308 Ga0495685_000105 3300047447 Bacteria 29931
309 Ga0495673_0000031 3300047469 Bacteria 447868
310 Ga0495673_0000166 3300047469 Bacteria 112730
311 Ga0495673_0016398 3300047469 Bacteria 3788
312 Ga0495681_0007972 3300047470 Bacteria 6688
313 Ga0495681_0018068 3300047470 Bacteria 3895
314 Ga0495681_0056362 3300047470 Bacteria 1829
315 Ga0495686_0003955 3300047472 Bacteria 12441
316 Ga0495686_0006565 3300047472 Bacteria 8876
317 Ga0495615_0001517 3300048090 Bacteria 3483
318 Ga0495626_0001914 3300048091 Bacteria 15472
319 Ga0495626_0003481 3300048091 Bacteria 10085
320 Ga0495626_0082298 3300048091 Bacteria 1428
321 Ga0495626_0118164 3300048091 Bacteria 1142
322 Ga0496102_0003306 3300048905 Bacteria 13668
323 Ga0496103_0045070 3300048906 Bacteria 2720
324 Ga0496111_0083893 3300048914 Bacteria 2329
325 Ga0496114_0125268 3300048917 Bacteria 2214
326 Ga0496115_0031570 3300048918 Bacteria 4174
327 Ga0496115_0032966 3300048918 Bacteria 4088
328 Ga0496116_0052512 3300048919 Bacteria 2700
329 Ga0496116_0110562 3300048919 Bacteria 1616
330 Ga0496116_0116389 3300048919 Bacteria 1558
331 Ga0496117_0000056 3300048920 Bacteria 271417
332 Ga0496118_0000047 3300048921 Bacteria 271417
333 Ga0496121_0037040 3300048924 Bacteria 4337
334 Ga0496121_0100264 3300048924 Bacteria 2236
335 Ga0496122_0002412 3300048925 Bacteria 26616
336 Ga0496122_0101611 3300048925 Bacteria 1920
337 Ga0496123_0004267 3300048926 Bacteria 15211
338 Ga0496123_0013944 3300048926 Bacteria 6697
339 Ga0496124_0135630 3300048927 Bacteria 1949
340 Ga0496124_0180679 3300048927 Bacteria 1624
341 Ga0496124_0183420 3300048927 Bacteria 1608
342 Ga0496125_0099141 3300048928 Bacteria 2153
343 Ga0496126_0030570 3300048929 Bacteria 5099
344 Ga0495678_000013 3300049459 Bacteria 316375
345 Ga0495678_000546 3300049459 Bacteria 36290
346 Ga0495678_001181 3300049459 Bacteria 21515
347 Ga0495678_005509 3300049459 Bacteria 6973
348 Ga0495678_037968 3300049459 Bacteria 1953
349 Ga0495678_084813 3300049459 Bacteria 1129
350 Ga0495678_094608 3300049459 Bacteria 1045
351 Ga0495682_0004683 3300049460 Bacteria 5791
352 Ga0495682_0010690 3300049460 Bacteria 3546
353 Ga0501263_013481 3300049760 Bacteria 1037
354 Ga0501269_000105 3300049766 Bacteria 26228
355 Ga0500618_000166 3300053125 Bacteria 55289
356 Ga0500586_000542 3300053145 Bacteria 7614
357 Ga0500586_001521 3300053145 Bacteria 4917

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2932410948 2932415175 281
2 iso_pu_bacteria 2932416698 2932421177 281
3 3300046520 Ga0495637_0025452 Ga0495637_0025452_1739_2587 282
4 3300046694 Ga0495649_0016935 Ga0495649_0016935_1016_1864 282
5 3300046694 Ga0495649_0101038 Ga0495649_0101038_481_1329 282
6 3300048091 Ga0495626_0003481 Ga0495626_0003481_4745_5593 282
7 3300003187 JGI25151J46595_10060944 JGI25151J46595_100609441 283
8 3300003322 rootL2_10017396 rootL2_100173963 283
9 3300003763 Ga0055529_1000027 Ga0055529_1000027174 283
10 3300003771 Ga0055526_1000135 Ga0055526_10001358 283
11 3300003775 Ga0055524_1000022 Ga0055524_1000022137 283
12 3300005262 Ga0065165_1000321 Ga0065165_100032120 283
13 3300006948 Ga0099826_10000006 Ga0099826_10000006275 283
14 3300009036 Ga0105244_10015180 Ga0105244_100151805 283
15 3300015261 Ga0182006_1000030 Ga0182006_100003093 283
16 3300015262 Ga0182007_10000157 Ga0182007_100001579 283
17 3300015265 Ga0182005_1000021 Ga0182005_1000021139 283
18 3300021361 Ga0213872_10000186 Ga0213872_100001863 283
19 3300021361 Ga0213872_10000857 Ga0213872_100008573 283
20 3300021361 Ga0213872_10008868 Ga0213872_100088683 283
21 3300021361 Ga0213872_10075787 Ga0213872_100757871 283
22 3300025208 Ga0209436_118017 Ga0209436_1180171 283
23 3300025245 Ga0207425_1000893 Ga0207425_100089310 283
24 3300025246 Ga0209646_1000148 Ga0209646_100014844 283
25 3300025263 Ga0209565_1003257 Ga0209565_10032574 283
26 3300025272 Ga0209455_1000033 Ga0209455_1000033272 283
27 3300025284 Ga0209130_1000149 Ga0209130_100014953 283
28 3300025294 Ga0209025_1007625 Ga0209025_10076252 283
29 3300025295 Ga0209564_1000028 Ga0209564_1000028315 283
30 3300025295 Ga0209564_1000493 Ga0209564_100049361 283
31 3300025295 Ga0209564_1021842 Ga0209564_10218422 283
32 3300025297 Ga0209758_1000278 Ga0209758_100027853 283
33 3300025299 Ga0209256_1000035 Ga0209256_1000035136 283
34 3300025728 Ga0207655_1014489 Ga0207655_10144892 283
35 3300027666 Ga0209282_1000003 Ga0209282_1000003100 283
36 3300031548 Ga0307408_100000376 Ga0307408_10000037612 283
37 3300031838 Ga0307518_10172752 Ga0307518_101727522 283
38 3300037312 Ga0395899_0003013 Ga0395899_0003013_7764_8618 283
39 3300037471 Ga0395905_0074476 Ga0395905_0074476_1769_2623 283
40 3300037471 Ga0395905_0134789 Ga0395905_0134789_1029_1883 283
41 3300038443 Ga0395901_0148531 Ga0395901_0148531_68_922 283
42 3300038443 Ga0395901_0301177 Ga0395901_0301177_786_1640 283
43 3300039447 Ga0436361_0529851 Ga0436361_0529851_2406_3257 283
44 3300039447 Ga0436361_0900144 Ga0436361_0900144_35081_35932 283
45 3300039447 Ga0436361_1192773 Ga0436361_1192773_3060_3911 283
46 3300042139 Ga0450904_001178 Ga0450904_001178_295_1146 283
47 3300044683 Ga0466965_0030658 Ga0466965_0030658_928_1779 283
48 3300046452 Ga0495617_000011 Ga0495617_000011_117833_118684 283
49 3300046452 Ga0495617_002691 Ga0495617_002691_2129_2980 283
50 3300046453 Ga0495627_071550 Ga0495627_071550_93_944 283
51 3300046457 Ga0495590_0000022 Ga0495590_0000022_42293_43144 283
52 3300046457 Ga0495590_0010677 Ga0495590_0010677_26_877 283
53 3300046460 Ga0495638_0000506 Ga0495638_0000506_26216_27067 283
54 3300046460 Ga0495638_0014634 Ga0495638_0014634_3339_4190 283
55 3300046460 Ga0495638_0024694 Ga0495638_0024694_1055_1906 283
56 3300046460 Ga0495638_0040062 Ga0495638_0040062_1179_2030 283
57 3300046460 Ga0495638_0057912 Ga0495638_0057912_750_1601 283
58 3300046460 Ga0495638_0108618 Ga0495638_0108618_93_944 283
59 3300046460 Ga0495638_0180247 Ga0495638_0180247_226_1077 283
60 3300046463 Ga0495653_0000029 Ga0495653_0000029_68082_68933 283
61 3300046471 Ga0495650_0000146 Ga0495650_0000146_26902_27753 283
62 3300046471 Ga0495650_0000481 Ga0495650_0000481_26760_27611 283
63 3300046471 Ga0495650_0000633 Ga0495650_0000633_37415_38266 283
64 3300046471 Ga0495650_0001829 Ga0495650_0001829_14527_15378 283
65 3300046471 Ga0495650_0005897 Ga0495650_0005897_2784_3635 283
66 3300046474 Ga0495605_0001477 Ga0495605_0001477_2024_2875 283
67 3300046475 Ga0495639_0009058 Ga0495639_0009058_2783_3634 283
68 3300046491 Ga0495584_0000013 Ga0495584_0000013_96787_97638 283
69 3300046491 Ga0495584_0000356 Ga0495584_0000356_25118_25969 283
70 3300046491 Ga0495584_0000572 Ga0495584_0000572_5656_6507 283
71 3300046491 Ga0495584_0018373 Ga0495584_0018373_2682_3533 283
72 3300046491 Ga0495584_0018536 Ga0495584_0018536_144_995 283
73 3300046491 Ga0495584_0080726 Ga0495584_0080726_199_1050 283
74 3300046492 Ga0495585_0000216 Ga0495585_0000216_4172_5023 283
75 3300046492 Ga0495585_0003107 Ga0495585_0003107_5518_6369 283
76 3300046492 Ga0495585_0006564 Ga0495585_0006564_753_1604 283
77 3300046492 Ga0495585_0007256 Ga0495585_0007256_296_1147 283
78 3300046492 Ga0495585_0007922 Ga0495585_0007922_1424_2275 283
79 3300046492 Ga0495585_0038422 Ga0495585_0038422_67_918 283
80 3300046492 Ga0495585_0070930 Ga0495585_0070930_514_1365 283
81 3300046492 Ga0495585_0075281 Ga0495585_0075281_811_1662 283
82 3300046492 Ga0495585_0102297 Ga0495585_0102297_59_910 283
83 3300046492 Ga0495585_0164164 Ga0495585_0164164_20_871 283
84 3300046499 Ga0495594_0001911 Ga0495594_0001911_4396_5247 283
85 3300046499 Ga0495594_0118520 Ga0495594_0118520_173_1024 283
86 3300046500 Ga0495596_0000648 Ga0495596_0000648_15582_16433 283
87 3300046500 Ga0495596_0007248 Ga0495596_0007248_76_927 283
88 3300046501 Ga0495607_0002399 Ga0495607_0002399_11588_12439 283
89 3300046501 Ga0495607_0021560 Ga0495607_0021560_3043_3894 283
90 3300046501 Ga0495607_0039193 Ga0495607_0039193_1091_1942 283
91 3300046501 Ga0495607_0051562 Ga0495607_0051562_131_982 283
92 3300046506 Ga0495583_0000063 Ga0495583_0000063_127457_128308 283
93 3300046506 Ga0495583_0000116 Ga0495583_0000116_81973_82824 283
94 3300046506 Ga0495583_0000486 Ga0495583_0000486_18580_19431 283
95 3300046507 Ga0495606_0000127 Ga0495606_0000127_8807_9658 283
96 3300046507 Ga0495606_0001258 Ga0495606_0001258_13963_14814 283
97 3300046507 Ga0495606_0001705 Ga0495606_0001705_25374_26225 283
98 3300046507 Ga0495606_0002825 Ga0495606_0002825_14619_15470 283
99 3300046507 Ga0495606_0004060 Ga0495606_0004060_9983_10834 283
100 3300046507 Ga0495606_0037664 Ga0495606_0037664_2259_3110 283
101 3300046507 Ga0495606_0082138 Ga0495606_0082138_940_1791 283
102 3300046512 Ga0495610_0000007 Ga0495610_0000007_631997_632848 283
103 3300046512 Ga0495610_0001968 Ga0495610_0001968_11124_11975 283
104 3300046512 Ga0495610_0004712 Ga0495610_0004712_8558_9409 283
105 3300046512 Ga0495610_0034091 Ga0495610_0034091_1120_1971 283
106 3300046513 Ga0495616_0013798 Ga0495616_0013798_931_1782 283
107 3300046513 Ga0495616_0042051 Ga0495616_0042051_374_1225 283
108 3300046513 Ga0495616_0049338 Ga0495616_0049338_1195_2046 283
109 3300046513 Ga0495616_0052340 Ga0495616_0052340_976_1827 283
110 3300046515 Ga0495620_0031734 Ga0495620_0031734_1275_2126 283
111 3300046518 Ga0495631_0007277 Ga0495631_0007277_1768_2619 283
112 3300046518 Ga0495631_0017684 Ga0495631_0017684_1097_1948 283
113 3300046518 Ga0495631_0075711 Ga0495631_0075711_246_1097 283
114 3300046520 Ga0495637_0000283 Ga0495637_0000283_23292_24143 283
115 3300046520 Ga0495637_0002104 Ga0495637_0002104_6406_7257 283
116 3300046522 Ga0495643_0000450 Ga0495643_0000450_18425_19276 283
117 3300046522 Ga0495643_0001352 Ga0495643_0001352_4155_5006 283
118 3300046522 Ga0495643_0035365 Ga0495643_0035365_352_1203 283
119 3300046522 Ga0495643_0065429 Ga0495643_0065429_184_1035 283
120 3300046523 Ga0495644_0012046 Ga0495644_0012046_978_1829 283
121 3300046523 Ga0495644_0019815 Ga0495644_0019815_930_1781 283
122 3300046523 Ga0495644_0110392 Ga0495644_0110392_103_954 283
123 3300046524 Ga0495648_0000004 Ga0495648_0000004_210288_211139 283
124 3300046524 Ga0495648_0002431 Ga0495648_0002431_7016_7867 283
125 3300046524 Ga0495648_0008069 Ga0495648_0008069_5450_6301 283
126 3300046524 Ga0495648_0012500 Ga0495648_0012500_2691_3542 283
127 3300046524 Ga0495648_0012891 Ga0495648_0012891_3715_4566 283
128 3300046524 Ga0495648_0015325 Ga0495648_0015325_1118_1969 283
129 3300046524 Ga0495648_0047522 Ga0495648_0047522_260_1111 283
130 3300046525 Ga0495663_0006339 Ga0495663_0006339_69_920 283
131 3300046526 Ga0495666_0074977 Ga0495666_0074977_346_1197 283
132 3300046526 Ga0495666_0149600 Ga0495666_0149600_183_1034 283
133 3300046528 Ga0495642_0006215 Ga0495642_0006215_2725_3576 283
134 3300046528 Ga0495642_0008432 Ga0495642_0008432_1416_2267 283
135 3300046528 Ga0495642_0031725 Ga0495642_0031725_1258_2109 283
136 3300046530 Ga0495654_0000025 Ga0495654_0000025_145137_145988 283
137 3300046530 Ga0495654_0003324 Ga0495654_0003324_7684_8535 283
138 3300046530 Ga0495654_0052696 Ga0495654_0052696_122_973 283
139 3300046535 Ga0495586_0105344 Ga0495586_0105344_183_1034 283
140 3300046538 Ga0495609_0001986 Ga0495609_0001986_4364_5227 283
141 3300046538 Ga0495609_0002075 Ga0495609_0002075_11233_12084 283
142 3300046538 Ga0495609_0002394 Ga0495609_0002394_8368_9219 283
143 3300046538 Ga0495609_0006360 Ga0495609_0006360_1427_2278 283
144 3300046538 Ga0495609_0010443 Ga0495609_0010443_918_1769 283
145 3300046538 Ga0495609_0028971 Ga0495609_0028971_1071_1922 283
146 3300046538 Ga0495609_0038351 Ga0495609_0038351_1236_2087 283
147 3300046538 Ga0495609_0070065 Ga0495609_0070065_654_1505 283
148 3300046542 Ga0495597_0000373 Ga0495597_0000373_35692_36543 283
149 3300046542 Ga0495597_0001051 Ga0495597_0001051_8502_9353 283
150 3300046542 Ga0495597_0005756 Ga0495597_0005756_1159_2010 283
151 3300046542 Ga0495597_0025100 Ga0495597_0025100_247_1098 283
152 3300046542 Ga0495597_0033888 Ga0495597_0033888_542_1393 283
153 3300046542 Ga0495597_0036911 Ga0495597_0036911_178_1029 283
154 3300046542 Ga0495597_0040829 Ga0495597_0040829_1198_2049 283
155 3300046542 Ga0495597_0055663 Ga0495597_0055663_697_1548 283
156 3300046542 Ga0495597_0066175 Ga0495597_0066175_496_1347 283
157 3300046542 Ga0495597_0119832 Ga0495597_0119832_178_1029 283
158 3300046557 Ga0495622_0000092 Ga0495622_0000092_46284_47135 283
159 3300046557 Ga0495622_0000306 Ga0495622_0000306_18384_19235 283
160 3300046557 Ga0495622_0074785 Ga0495622_0074785_259_1110 283
161 3300046558 Ga0495633_0000068 Ga0495633_0000068_18739_19590 283
162 3300046558 Ga0495633_0000094 Ga0495633_0000094_21016_21867 283
163 3300046558 Ga0495633_0000392 Ga0495633_0000392_34248_35099 283
164 3300046558 Ga0495633_0006337 Ga0495633_0006337_3992_4843 283
165 3300046558 Ga0495633_0008121 Ga0495633_0008121_1886_2737 283
166 3300046558 Ga0495633_0011953 Ga0495633_0011953_2570_3421 283
167 3300046558 Ga0495633_0019274 Ga0495633_0019274_252_1103 283
168 3300046558 Ga0495633_0019318 Ga0495633_0019318_1388_2239 283
169 3300046558 Ga0495633_0041787 Ga0495633_0041787_1252_2103 283
170 3300046558 Ga0495633_0057581 Ga0495633_0057581_929_1780 283
171 3300046558 Ga0495633_0171254 Ga0495633_0171254_11_862 283
172 3300046615 Ga0495656_0017165 Ga0495656_0017165_993_1844 283
173 3300046615 Ga0495656_0078887 Ga0495656_0078887_140_991 283
174 3300046616 Ga0495668_0000385 Ga0495668_0000385_24124_24975 283
175 3300046616 Ga0495668_0000841 Ga0495668_0000841_17715_18566 283
176 3300046616 Ga0495668_0001035 Ga0495668_0001035_10668_11519 283
177 3300046616 Ga0495668_0004883 Ga0495668_0004883_3790_4641 283
178 3300046616 Ga0495668_0007243 Ga0495668_0007243_3109_3960 283
179 3300046616 Ga0495668_0008874 Ga0495668_0008874_1141_1992 283
180 3300046616 Ga0495668_0173467 Ga0495668_0173467_71_934 283
181 3300046648 Ga0495611_0003307 Ga0495611_0003307_3892_4743 283
182 3300046648 Ga0495611_0006430 Ga0495611_0006430_1609_2460 283
183 3300046648 Ga0495611_0010104 Ga0495611_0010104_339_1190 283
184 3300046648 Ga0495611_0062879 Ga0495611_0062879_693_1544 283
185 3300046648 Ga0495611_0104120 Ga0495611_0104120_11_862 283
186 3300046660 Ga0495625_0001271 Ga0495625_0001271_12781_13632 283
187 3300046660 Ga0495625_0001498 Ga0495625_0001498_4221_5072 283
188 3300046660 Ga0495625_0029327 Ga0495625_0029327_2285_3136 283
189 3300046660 Ga0495625_0082645 Ga0495625_0082645_84_935 283
190 3300046660 Ga0495625_0169817 Ga0495625_0169817_100_951 283
191 3300046660 Ga0495625_0239910 Ga0495625_0239910_260_1111 283
192 3300046664 Ga0495659_0000132 Ga0495659_0000132_4327_5178 283
193 3300046664 Ga0495659_0004220 Ga0495659_0004220_2108_2959 283
194 3300046665 Ga0495661_0034129 Ga0495661_0034129_1335_2186 283
195 3300046665 Ga0495661_0057787 Ga0495661_0057787_853_1704 283
196 3300046674 Ga0495588_0035947 Ga0495588_0035947_512_1363 283
197 3300046674 Ga0495588_0124427 Ga0495588_0124427_268_1119 283
198 3300046674 Ga0495588_0150408 Ga0495588_0150408_261_1112 283
199 3300046684 Ga0495669_0002580 Ga0495669_0002580_6404_7255 283
200 3300046684 Ga0495669_0006592 Ga0495669_0006592_3556_4407 283
201 3300046691 Ga0495670_0006724 Ga0495670_0006724_1270_2121 283
202 3300046691 Ga0495670_0014847 Ga0495670_0014847_2973_3824 283
203 3300046691 Ga0495670_0016518 Ga0495670_0016518_2153_3004 283
204 3300046692 Ga0495671_0000033 Ga0495671_0000033_84259_85110 283
205 3300046692 Ga0495671_0000826 Ga0495671_0000826_2141_2992 283
206 3300046692 Ga0495671_0007304 Ga0495671_0007304_2002_2853 283
207 3300046692 Ga0495671_0025348 Ga0495671_0025348_1498_2349 283
208 3300046692 Ga0495671_0235164 Ga0495671_0235164_22_873 283
209 3300046810 Ga0495660_0002771 Ga0495660_0002771_8012_8863 283
210 3300046810 Ga0495660_0006164 Ga0495660_0006164_3557_4408 283
211 3300046810 Ga0495660_0039626 Ga0495660_0039626_1512_2363 283
212 3300046810 Ga0495660_0111504 Ga0495660_0111504_508_1359 283
213 3300047318 Ga0495636_0000595 Ga0495636_0000595_10352_11203 283
214 3300047318 Ga0495636_0070862 Ga0495636_0070862_505_1356 283
215 3300047320 Ga0495672_0000078 Ga0495672_0000078_12633_13484 283
216 3300047320 Ga0495672_0000713 Ga0495672_0000713_33440_34291 283
217 3300047320 Ga0495672_0008090 Ga0495672_0008090_702_1553 283
218 3300047321 Ga0495676_0014159 Ga0495676_0014159_3012_3863 283
219 3300047321 Ga0495676_0191293 Ga0495676_0191293_274_1125 283
220 3300047323 Ga0495683_0000164 Ga0495683_0000164_13064_13915 283
221 3300047323 Ga0495683_0000965 Ga0495683_0000965_12581_13432 283
222 3300047323 Ga0495683_0019415 Ga0495683_0019415_1019_1870 283
223 3300047323 Ga0495683_0019779 Ga0495683_0019779_2257_3108 283
224 3300047323 Ga0495683_0076342 Ga0495683_0076342_64_915 283
225 3300047443 Ga0495687_001336 Ga0495687_001336_10384_11235 283
226 3300047445 Ga0495677_0007578 Ga0495677_0007578_1538_2389 283
227 3300047445 Ga0495677_0014842 Ga0495677_0014842_14_865 283
228 3300047445 Ga0495677_0017154 Ga0495677_0017154_640_1491 283
229 3300047445 Ga0495677_0018505 Ga0495677_0018505_887_1738 283
230 3300047447 Ga0495685_000105 Ga0495685_000105_13297_14148 283
231 3300047469 Ga0495673_0000166 Ga0495673_0000166_33158_34009 283
232 3300047469 Ga0495673_0016398 Ga0495673_0016398_227_1078 283
233 3300047470 Ga0495681_0007972 Ga0495681_0007972_25_876 283
234 3300047470 Ga0495681_0018068 Ga0495681_0018068_284_1135 283
235 3300047470 Ga0495681_0056362 Ga0495681_0056362_889_1740 283
236 3300047472 Ga0495686_0003955 Ga0495686_0003955_10035_10886 283
237 3300047472 Ga0495686_0006565 Ga0495686_0006565_2494_3345 283
238 3300048090 Ga0495615_0001517 Ga0495615_0001517_2060_2911 283
239 3300048091 Ga0495626_0001914 Ga0495626_0001914_9605_10456 283
240 3300048091 Ga0495626_0082298 Ga0495626_0082298_239_1090 283
241 3300048091 Ga0495626_0118164 Ga0495626_0118164_63_914 283
242 3300048914 Ga0496111_0083893 Ga0496111_0083893_919_1770 283
243 3300048917 Ga0496114_0125268 Ga0496114_0125268_977_1828 283
244 3300048918 Ga0496115_0031570 Ga0496115_0031570_1041_1892 283
245 3300048919 Ga0496116_0116389 Ga0496116_0116389_364_1215 283
246 3300048920 Ga0496117_0000056 Ga0496117_0000056_137465_138316 283
247 3300048921 Ga0496118_0000047 Ga0496118_0000047_133102_133953 283
248 3300048924 Ga0496121_0037040 Ga0496121_0037040_1828_2679 283
249 3300048924 Ga0496121_0100264 Ga0496121_0100264_839_1690 283
250 3300048925 Ga0496122_0002412 Ga0496122_0002412_7089_7940 283
251 3300048925 Ga0496122_0101611 Ga0496122_0101611_222_1073 283
252 3300048926 Ga0496123_0004267 Ga0496123_0004267_10254_11105 283
253 3300048926 Ga0496123_0013944 Ga0496123_0013944_2762_3613 283
254 3300048927 Ga0496124_0183420 Ga0496124_0183420_166_1017 283
255 3300048928 Ga0496125_0099141 Ga0496125_0099141_622_1473 283
256 3300049459 Ga0495678_000546 Ga0495678_000546_16561_17412 283
257 3300049459 Ga0495678_001181 Ga0495678_001181_9977_10828 283
258 3300049459 Ga0495678_005509 Ga0495678_005509_4557_5408 283
259 3300049459 Ga0495678_037968 Ga0495678_037968_351_1202 283
260 3300049459 Ga0495678_084813 Ga0495678_084813_241_1092 283
261 3300049459 Ga0495678_094608 Ga0495678_094608_148_999 283
262 3300049460 Ga0495682_0004683 Ga0495682_0004683_4881_5732 283
263 3300049460 Ga0495682_0010690 Ga0495682_0010690_296_1147 283
264 3300049766 Ga0501269_000105 Ga0501269_000105_16624_17475 283
265 3300053125 Ga0500618_000166 Ga0500618_000166_42885_43736 283
266 3300053145 Ga0500586_000542 Ga0500586_000542_1247_2098 283
267 3300053145 Ga0500586_001521 Ga0500586_001521_311_1162 283
268 iso_pu_bacteria 2818991436 2819544667 283
269 3300002774 JGI25150J39212_1000697 JGI25150J39212_10006972 284
270 3300003354 JGI25160J50197_1003026 JGI25160J50197_10030268 284
271 3300003374 JGI25161J50226_1001224 JGI25161J50226_10012249 284
272 3300003374 JGI25161J50226_1001691 JGI25161J50226_10016913 284
273 3300003771 Ga0055526_1027721 Ga0055526_10277212 284
274 3300003775 Ga0055524_1002418 Ga0055524_100241810 284
275 3300003775 Ga0055524_1006411 Ga0055524_10064113 284
276 3300003775 Ga0055524_1007914 Ga0055524_10079145 284
277 3300003791 Ga0055530_10002326 Ga0055530_1000232610 284
278 3300003791 Ga0055530_10023358 Ga0055530_100233582 284
279 3300003791 Ga0055530_10023410 Ga0055530_100234102 284
280 3300003794 Ga0055531_10009938 Ga0055531_100099382 284
281 3300004625 Ga0055543_1002286 Ga0055543_10022865 284
282 3300005262 Ga0065165_1006082 Ga0065165_10060825 284
283 3300014497 Ga0182008_10023968 Ga0182008_100239683 284
284 3300015261 Ga0182006_1000150 Ga0182006_100015057 284
285 3300017792 Ga0163161_10147379 Ga0163161_101473792 284
286 3300025208 Ga0209436_100866 Ga0209436_1008663 284
287 3300025208 Ga0209436_100960 Ga0209436_10096010 284
288 3300025245 Ga0207425_1000013 Ga0207425_1000013176 284
289 3300025245 Ga0207425_1000517 Ga0207425_100051720 284
290 3300025258 Ga0209129_1000102 Ga0209129_100010294 284
291 3300025258 Ga0209129_1003303 Ga0209129_10033033 284
292 3300025263 Ga0209565_1001502 Ga0209565_10015025 284
293 3300025263 Ga0209565_1001846 Ga0209565_10018463 284
294 3300025263 Ga0209565_1010600 Ga0209565_10106002 284
295 3300025284 Ga0209130_1003582 Ga0209130_10035823 284
296 3300025284 Ga0209130_1006632 Ga0209130_10066322 284
297 3300025284 Ga0209130_1008584 Ga0209130_10085843 284
298 3300025295 Ga0209564_1000088 Ga0209564_100008898 284
299 3300025295 Ga0209564_1023924 Ga0209564_10239243 284
300 3300025297 Ga0209758_1000031 Ga0209758_1000031288 284
301 3300025298 Ga0209050_1000078 Ga0209050_100007815 284
302 3300025298 Ga0209050_1001071 Ga0209050_100107110 284
303 3300025298 Ga0209050_1007966 Ga0209050_10079663 284
304 3300025299 Ga0209256_1000303 Ga0209256_100030353 284
305 3300025299 Ga0209256_1000881 Ga0209256_100088124 284
306 3300025299 Ga0209256_1003419 Ga0209256_10034193 284
307 3300025302 Ga0207426_1002264 Ga0207426_10022646 284
308 3300025304 Ga0209257_1002042 Ga0209257_10020429 284
309 3300027111 Ga0209281_1007021 Ga0209281_10070214 284
310 3300028794 Ga0307515_10136652 Ga0307515_101366523 284
311 3300031548 Ga0307408_100019301 Ga0307408_1000193016 284
312 3300031901 Ga0307406_10216480 Ga0307406_102164801 284
313 3300037312 Ga0395899_0000085 Ga0395899_0000085_137256_138116 284
314 3300039447 Ga0436361_0035193 Ga0436361_0035193_4468_5322 284
315 3300044658 Ga0466972_0000595 Ga0466972_0000595_5610_6476 284
316 3300044658 Ga0466972_0003892 Ga0466972_0003892_2513_3373 284
317 3300044706 Ga0466964_0005655 Ga0466964_0005655_2664_3548 284
318 3300044735 Ga0466968_0011001 Ga0466968_0011001_1798_2658 284
319 3300046453 Ga0495627_000006 Ga0495627_000006_434174_435028 284
320 3300046471 Ga0495650_0004239 Ga0495650_0004239_3589_4446 284
321 3300046474 Ga0495605_0075072 Ga0495605_0075072_47_901 284
322 3300046492 Ga0495585_0004013 Ga0495585_0004013_4741_5595 284
323 3300046506 Ga0495583_0000294 Ga0495583_0000294_30152_31006 284
324 3300046506 Ga0495583_0001417 Ga0495583_0001417_4974_5828 284
325 3300046506 Ga0495583_0108052 Ga0495583_0108052_179_1036 284
326 3300046507 Ga0495606_0000004 Ga0495606_0000004_31292_32146 284
327 3300046507 Ga0495606_0005993 Ga0495606_0005993_8393_9247 284
328 3300046507 Ga0495606_0007474 Ga0495606_0007474_2847_3704 284
329 3300046507 Ga0495606_0010767 Ga0495606_0010767_943_1998 284
330 3300046507 Ga0495606_0161575 Ga0495606_0161575_124_981 284
331 3300046512 Ga0495610_0002543 Ga0495610_0002543_1141_1995 284
332 3300046513 Ga0495616_0000185 Ga0495616_0000185_23889_24743 284
333 3300046518 Ga0495631_0006178 Ga0495631_0006178_747_1604 284
334 3300046518 Ga0495631_0127604 Ga0495631_0127604_178_1035 284
335 3300046522 Ga0495643_0000158 Ga0495643_0000158_44410_45264 284
336 3300046525 Ga0495663_0039868 Ga0495663_0039868_282_1139 284
337 3300046538 Ga0495609_0000804 Ga0495609_0000804_4377_5231 284
338 3300046542 Ga0495597_0037526 Ga0495597_0037526_936_1790 284
339 3300046558 Ga0495633_0009604 Ga0495633_0009604_901_1755 284
340 3300046616 Ga0495668_0000135 Ga0495668_0000135_6645_7499 284
341 3300046616 Ga0495668_0029395 Ga0495668_0029395_1373_2230 284
342 3300046665 Ga0495661_0020705 Ga0495661_0020705_1750_2607 284
343 3300046674 Ga0495588_0070980 Ga0495588_0070980_819_1676 284
344 3300046692 Ga0495671_0065988 Ga0495671_0065988_810_1667 284
345 3300046810 Ga0495660_0001474 Ga0495660_0001474_897_1751 284
346 3300047318 Ga0495636_0006763 Ga0495636_0006763_417_1271 284
347 3300047318 Ga0495636_0160550 Ga0495636_0160550_139_993 284
348 3300047323 Ga0495683_0107538 Ga0495683_0107538_454_1311 284
349 3300047446 Ga0495679_062380 Ga0495679_062380_92_949 284
350 3300047469 Ga0495673_0000031 Ga0495673_0000031_55016_55870 284
351 3300048905 Ga0496102_0003306 Ga0496102_0003306_946_1800 284
352 3300048906 Ga0496103_0045070 Ga0496103_0045070_42_896 284
353 3300048918 Ga0496115_0032966 Ga0496115_0032966_1879_2736 284
354 3300048919 Ga0496116_0052512 Ga0496116_0052512_861_1715 284
355 3300048919 Ga0496116_0110562 Ga0496116_0110562_459_1316 284
356 3300048927 Ga0496124_0135630 Ga0496124_0135630_136_993 284
357 3300048927 Ga0496124_0180679 Ga0496124_0180679_436_1290 284
358 3300048929 Ga0496126_0030570 Ga0496126_0030570_2671_3525 284
359 3300049459 Ga0495678_000013 Ga0495678_000013_172985_173848 284
360 3300049760 Ga0501263_013481 Ga0501263_013481_83_937 284

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00581

Rhodanese

Rhodanese-like domain

160

270

0.82

PF00581

Rhodanese

Rhodanese-like domain

7

133

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hwi-assembly1.cif.gz_A crystal structure of probable thiosulfate sulfurtransferase cysa2 (rhodanese-like protein) from mycobacterium tuberculosis 0.8795 3 282
1boi-assembly1.cif.gz_A n-terminally truncated rhodanese 0.8784 4 271
4jgt-assembly2.cif.gz_B structure and kinetic analysis of h2s production by human mercaptopyruvate sulfurtransferase 0.8754 4 278
3aay-assembly1.cif.gz_A crystal structure of probable thiosulfate sulfurtransferase cysa3 (rv3117) from mycobacterium tuberculosis: orthorhombic form 0.8753 3 282
3aax-assembly2.cif.gz_B crystal structure of probable thiosulfate sulfurtransferase cysa3 (rv3117) from mycobacterium tuberculosis: monoclinic form 0.8739 3 282
ID Description Score Start End Superfamily
1uarA01 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9184 4 154 3.40.250.10
af_Q24JL3_210_336_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.8843 158 278 3.40.250.10
af_P9WHF5_1_149_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.884 3 150 3.40.250.10
af_F1Q9K6_160_299_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.8701 158 271 3.40.250.10
1uarA01 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.8692 4 154 3.40.250.10
ID Description Score Start End GO Terms
AF-A0A542LPA2-F1-model_v4 Sulfurtransferase 0.9593 1 282 GO:0004792
AF-A0A4Y9T4R8-F1-model_v4 Sulfurtransferase 0.9587 1 282 GO:0004792
AF-A0A4Y9T4R8-F1-model_v4 Sulfurtransferase 0.9521 1 282 GO:0004792
AF-A0A7V8KWT5-F1-model_v4 deleted 0.9357 2 282
AF-A0A1C6M840-F1-model_v4 Thiosulfate/3-mercaptopyruvate sulfurtransferase 0.9354 1 282 GO:0004792

Feature Viewer

pLDDT pTM Quality
91.8 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map