F421978

General Info

Members Datasets Scaffolds Average Seq Length
360 241 720 181

Family's Representative Sequence

Representative Sequence 3300046694|Ga0495649_0081151|Ga0495649_0081151_908_1531
Length 207
Sequence LNSKSGITSESGGSPAAASGVVPDDLVQVGFVFGAYGLVGGVRIRPFSADADALLHAKTWWLDKPGMRGVEVKRAKMHSGDVVATLVEVGDRDMAEALKGAAVFIPRSQFPKLDDEDEFYWADLIGLAVENQQGESLGVVHDMMSNGPQSILRVAPAAAPDGSTSEASSGQLSVQLSDERLIPFVDRFVIKVDKAAKKIVVDWGLDY

Samples

Sample ID Description Type Environment
1 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
2 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
71 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
115 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
116 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
119 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
120 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
121 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
128 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
136 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
137 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
138 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
139 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
140 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
141 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
142 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
143 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
144 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
145 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
146 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
147 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
148 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
149 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
150 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
151 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
152 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
153 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
154 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
155 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
156 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
157 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
158 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
159 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
160 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
161 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
162 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
163 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
164 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
165 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
166 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
167 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
168 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
169 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
170 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
171 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
172 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
173 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
174 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
175 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
176 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
177 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
178 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
179 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
188 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
189 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
190 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
191 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
192 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
193 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
196 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
197 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
202 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
237 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
238 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
239 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
240 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
241 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80
Metatranscriptomes 18.61
Isolates 1.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.17
Nodule 0
Rhizoplane 6.39
Rhizosphere 87.78
Stem 0
Stem Tuber 0
Unclassified 1.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495649_0081151 3300046694 Bacteria 1734
2 Ga0006770J48903_1044971 3300003305 Bacteria 966
3 rootH1_10078610 3300003316 Bacteria 2069
4 Ga0007417J51691_1034645 3300003544 Bacteria 908
5 Ga0007410J51695_1045320 3300003574 Bacteria 881
6 Ga0007429J51699_1036152 3300003579 Bacteria 1269
7 Ga0032354_1044129 3300003693 Bacteria 1010
8 Ga0055529_1000478 3300003763 Bacteria 38030
9 Ga0055526_1000709 3300003771 Bacteria 25255
10 Ga0055526_1000967 3300003771 Bacteria 21251
11 Ga0055537_1000822 3300003773 Bacteria 15242
12 Ga0055524_1003597 3300003775 Bacteria 7473
13 Ga0055534_1000601 3300003784 Bacteria 18680
14 Ga0055528_1000050 3300003790 Bacteria 93078
15 Ga0070658_10292657 3300005327 Bacteria 1388
16 Ga0070676_10297788 3300005328 Bacteria 1092
17 Ga0070683_100031806 3300005329 Bacteria 4801
18 Ga0070683_100345248 3300005329 Bacteria 1417
19 Ga0070690_100573873 3300005330 Bacteria 853
20 Ga0068869_100116268 3300005334 Bacteria 2040
21 Ga0070680_100063571 3300005336 Bacteria 3023
22 Ga0068868_100007250 3300005338 Bacteria 7885
23 Ga0070660_100033410 3300005339 Bacteria 3878
24 Ga0070660_100056839 3300005339 Bacteria 3028
25 Ga0070660_100951534 3300005339 Bacteria 725
26 Ga0070661_100006678 3300005344 Bacteria 7957
27 Ga0070661_100392787 3300005344 Bacteria 1095
28 Ga0070692_10088785 3300005345 Bacteria 1677
29 Ga0070669_100030757 3300005353 Bacteria 3875
30 Ga0070675_100002913 3300005354 Bacteria 12900
31 Ga0070671_100026405 3300005355 Bacteria 4772
32 Ga0070659_100016269 3300005366 Bacteria 5583
33 Ga0070659_100371939 3300005366 Bacteria 1202
34 Ga0070659_100590631 3300005366 Bacteria 953
35 Ga0070667_100027407 3300005367 Bacteria 4739
36 Ga0070667_100098290 3300005367 Bacteria 2526
37 Ga0070667_100145127 3300005367 Bacteria 2081
38 Ga0070701_10229450 3300005438 Bacteria 1111
39 Ga0070700_100346310 3300005441 Bacteria 1100
40 Ga0070663_100002045 3300005455 Bacteria 11280
41 Ga0070663_100933565 3300005455 Unclassified 751
42 Ga0070678_100116129 3300005456 Bacteria 2102
43 Ga0070662_100017564 3300005457 Bacteria 4825
44 Ga0070681_10292477 3300005458 Bacteria 1539
45 Ga0070681_10677835 3300005458 Bacteria 946
46 Ga0070679_100021313 3300005530 Bacteria 6325
47 Ga0070679_100300863 3300005530 Bacteria 1555
48 Ga0068853_100016917 3300005539 Bacteria 6011
49 Ga0068853_100460753 3300005539 Bacteria 1196
50 Ga0070672_100013676 3300005543 Bacteria 5738
51 Ga0070693_100434691 3300005547 Bacteria 917
52 Ga0070664_100005621 3300005564 Bacteria 10089
53 Ga0068857_100037458 3300005577 Bacteria 4296
54 Ga0068856_100090006 3300005614 Bacteria 3052
55 Ga0068856_100167235 3300005614 Bacteria 2210
56 Ga0068856_100240220 3300005614 Bacteria 1827
57 Ga0068856_101388115 3300005614 Bacteria 717
58 Ga0068852_100007663 3300005616 Bacteria 7896
59 Ga0068852_100084612 3300005616 Bacteria 2823
60 Ga0068852_100323911 3300005616 Bacteria 1497
61 Ga0068852_101656106 3300005616 Bacteria 662
62 Ga0068859_100144987 3300005617 Bacteria 2449
63 Ga0068859_100399405 3300005617 Bacteria 1470
64 Ga0068864_100405350 3300005618 Bacteria 1296
65 Ga0068861_100000757 3300005719 Bacteria 19364
66 Ga0068851_10018213 3300005834 Bacteria 3381
67 Ga0068851_10081821 3300005834 Bacteria 1687
68 Ga0068863_100099315 3300005841 Bacteria 2765
69 Ga0068863_100610029 3300005841 Bacteria 1080
70 Ga0068858_100019626 3300005842 Bacteria 6319
71 Ga0068860_100033406 3300005843 Bacteria 4936
72 Ga0068860_100551594 3300005843 Bacteria 1155
73 Ga0075432_10039542 3300006058 Bacteria 1645
74 Ga0068871_100684300 3300006358 Bacteria 939
75 Ga0075434_100166543 3300006871 Bacteria 2224
76 Ga0068865_100309763 3300006881 Bacteria 1267
77 Ga0097620_100144996 3300006931 Bacteria 2449
78 Ga0097620_100399379 3300006931 Bacteria 1470
79 Ga0105245_10109932 3300009098 Bacteria 2562
80 Ga0105242_10181008 3300009176 Bacteria 1859
81 Ga0105248_10081871 3300009177 Bacteria 3629
82 Ga0105248_10404876 3300009177 Bacteria 1536
83 Ga0105238_10059079 3300009551 Bacteria 3842
84 Ga0105238_10081408 3300009551 Bacteria 3227
85 Ga0105239_10197223 3300010375 Bacteria 2254
86 Ga0157373_10038721 3300013100 Bacteria 3416
87 Ga0157369_10065353 3300013105 Bacteria 3915
88 Ga0157369_10454278 3300013105 Bacteria 1327
89 Ga0157374_10353148 3300013296 Bacteria 1461
90 Ga0163162_10012542 3300013306 Bacteria 8279
91 Ga0157372_10016161 3300013307 Bacteria 8007
92 Ga0157372_10167119 3300013307 Bacteria 2544
93 Ga0157380_10075625 3300014326 Bacteria 2738
94 Ga0157377_10010702 3300014745 Bacteria 4549
95 Ga0157379_10005388 3300014968 Bacteria 10986
96 Ga0157379_10008057 3300014968 Bacteria 9149
97 Ga0157376_10029054 3300014969 Bacteria 4402
98 Ga0163161_10020402 3300017792 Bacteria 4651
99 Ga0213872_10000191 3300021361 Bacteria 54643
100 Ga0213872_10000305 3300021361 Bacteria 41889
101 Ga0213872_10002189 3300021361 Bacteria 11721
102 Ga0213872_10002860 3300021361 Bacteria 9864
103 Ga0213872_10004063 3300021361 Bacteria 7879
104 Ga0213872_10013863 3300021361 Bacteria 3767
105 Ga0209565_1000018 3300025263 Bacteria 460940
106 Ga0209455_1000047 3300025272 Bacteria 379709
107 Ga0209673_1000090 3300025273 Bacteria 202223
108 Ga0209675_1000005 3300025291 Bacteria 849192
109 Ga0209564_1000032 3300025295 Bacteria 464041
110 Ga0209564_1000078 3300025295 Bacteria 275766
111 Ga0209256_1000070 3300025299 Bacteria 245034
112 Ga0207656_10042567 3300025321 Bacteria 1933
113 Ga0207656_10070274 3300025321 Bacteria 1554
114 Ga0207682_10095876 3300025893 Bacteria 1292
115 Ga0207680_10042631 3300025903 Bacteria 2656
116 Ga0207645_10031014 3300025907 Bacteria 3443
117 Ga0207705_10677067 3300025909 Unclassified 802
118 Ga0207660_10021246 3300025917 Bacteria 4364
119 Ga0207657_10007926 3300025919 Bacteria 10832
120 Ga0207657_10064285 3300025919 Bacteria 3132
121 Ga0207649_10105704 3300025920 Bacteria 1871
122 Ga0207649_10110943 3300025920 Bacteria 1832
123 Ga0207652_10008328 3300025921 Bacteria 8336
124 Ga0207681_10033865 3300025923 Bacteria 3354
125 Ga0207694_10110387 3300025924 Bacteria 2187
126 Ga0207694_10742832 3300025924 Unclassified 828
127 Ga0207650_10124130 3300025925 Bacteria 2014
128 Ga0207650_10848168 3300025925 Bacteria 775
129 Ga0207659_10143819 3300025926 Bacteria 1854
130 Ga0207687_10039484 3300025927 Bacteria 3232
131 Ga0207644_10078530 3300025931 Bacteria 2433
132 Ga0207644_10200778 3300025931 Bacteria 1573
133 Ga0207690_10010177 3300025932 Bacteria 5585
134 Ga0207690_10024909 3300025932 Bacteria 3751
135 Ga0207690_10083619 3300025932 Bacteria 2235
136 Ga0207706_10002060 3300025933 Bacteria 19704
137 Ga0207686_10367892 3300025934 Bacteria 1087
138 Ga0207691_10042085 3300025940 Bacteria 4213
139 Ga0207711_10141451 3300025941 Bacteria 2165
140 Ga0207711_10688168 3300025941 Bacteria 954
141 Ga0207689_10000919 3300025942 Bacteria 28269
142 Ga0207661_10671941 3300025944 Bacteria 952
143 Ga0207679_10309511 3300025945 Bacteria 1364
144 Ga0207668_10044827 3300025972 Bacteria 3012
145 Ga0207658_10077813 3300025986 Bacteria 2532
146 Ga0207658_10131839 3300025986 Bacteria 2009
147 Ga0207658_10356883 3300025986 Bacteria 1274
148 Ga0207677_10003852 3300026023 Bacteria 7986
149 Ga0207703_10058830 3300026035 Bacteria 3138
150 Ga0207639_10384160 3300026041 Bacteria 1262
151 Ga0207678_10005670 3300026067 Bacteria 11156
152 Ga0207702_10023989 3300026078 Bacteria 5061
153 Ga0207702_10295007 3300026078 Bacteria 1537
154 Ga0207641_10090017 3300026088 Bacteria 2682
155 Ga0207641_10321936 3300026088 Bacteria 1466
156 Ga0207674_10601922 3300026116 Bacteria 1062
157 Ga0207675_100000956 3300026118 Bacteria 28809
158 Ga0207683_10063700 3300026121 Bacteria 3248
159 Ga0207698_10041309 3300026142 Bacteria 3435
160 Ga0207698_10160476 3300026142 Bacteria 1965
161 Ga0207698_10408422 3300026142 Bacteria 1300
162 Ga0207698_10719110 3300026142 Bacteria 995
163 Ga0268265_10246707 3300028380 Bacteria 1579
164 Ga0268265_10443928 3300028380 Bacteria 1210
165 Ga0268264_10225394 3300028381 Bacteria 1728
166 Ga0268264_10392687 3300028381 Bacteria 1331
167 Ga0316181_1128786 3300030744 Bacteria 1444
168 Ga0265331_10030217 3300031250 Bacteria 2698
169 Ga0307509_10771948 3300031507 Bacteria 626
170 Ga0307408_100000401 3300031548 Bacteria 38921
171 Ga0307408_100051568 3300031548 Bacteria 2964
172 Ga0316575_10000494 3300031665 Bacteria 11406
173 Ga0307405_10078072 3300031731 Bacteria 2153
174 Ga0307518_10046074 3300031838 Bacteria 3171
175 Ga0307412_10008266 3300031911 Bacteria 5932
176 Ga0307412_10828330 3300031911 Bacteria 805
177 Ga0307409_100001376 3300031995 Bacteria 11862
178 Ga0307416_100006637 3300032002 Bacteria 7262
179 Ga0307416_100006785 3300032002 Bacteria 7199
180 Ga0307414_10937127 3300032004 Unclassified 795
181 Ga0307411_10080392 3300032005 Bacteria 2241
182 Ga0307415_100006664 3300032126 Bacteria 6250
183 Ga0316583_10103699 3300032133 Bacteria 991
184 Ga0373931_0005543 3300035691 Bacteria 5849
185 Ga0395899_0003935 3300037312 Bacteria 11705
186 Ga0395899_0069683 3300037312 Bacteria 2575
187 Ga0395900_0002282 3300037418 Bacteria 21301
188 Ga0395900_0010620 3300037418 Bacteria 9416
189 Ga0395900_0026968 3300037418 Bacteria 5880
190 Ga0395898_0018737 3300037466 Bacteria 7054
191 Ga0395898_0431270 3300037466 Bacteria 1256
192 Ga0395905_0190906 3300037471 Bacteria 1921
193 Ga0395905_1177177 3300037471 Bacteria 670
194 Ga0395901_0001532 3300038443 Bacteria 23959
195 Ga0395901_0050852 3300038443 Bacteria 4306
196 Ga0395901_0296625 3300038443 Bacteria 1676
197 Ga0395901_0516407 3300038443 Bacteria 1214
198 Ga0395901_1558348 3300038443 Bacteria 615
199 Ga0436365_1337200 3300039437 Bacteria 2693
200 Ga0436361_0091148 3300039447 Bacteria 7977
201 Ga0436361_0128896 3300039447 Bacteria 18118
202 Ga0436361_0636225 3300039447 Bacteria 2448
203 Ga0436361_0788745 3300039447 Bacteria 34906
204 Ga0436361_0891393 3300039447 Bacteria 99242
205 Ga0436361_1028197 3300039447 Bacteria 31240
206 Ga0436361_1200667 3300039447 Bacteria 4910
207 Ga0436363_0607531 3300039450 Bacteria 1418
208 Ga0466972_0000162 3300044658 Bacteria 53301
209 Ga0466972_0009956 3300044658 Bacteria 4772
210 Ga0453683_0045645 3300044673 Bacteria 2747
211 Ga0466965_0002397 3300044683 Bacteria 7949
212 Ga0466965_0021721 3300044683 Bacteria 3092
213 Ga0466964_0013092 3300044706 Bacteria 3144
214 Ga0453684_0579310 3300044712 Bacteria 1233
215 Ga0466971_0024700 3300044719 Bacteria 2681
216 Ga0466968_0058982 3300044735 Bacteria 1652
217 Ga0466959_0003791 3300045049 Bacteria 10025
218 Ga0466959_0133444 3300045049 Bacteria 1759
219 Ga0451576_0000006 3300045051 Bacteria 949698
220 Ga0451576_0187750 3300045051 Bacteria 2158
221 Ga0451576_0333806 3300045051 Bacteria 1587
222 Ga0451576_0575562 3300045051 Bacteria 1183
223 Ga0451576_1087256 3300045051 Bacteria 837
224 Ga0495590_0050380 3300046457 Bacteria 1453
225 Ga0495638_0034055 3300046460 Bacteria 3253
226 Ga0495650_0000109 3300046471 Bacteria 199925
227 Ga0495639_0127878 3300046475 Bacteria 1215
228 Ga0495584_0008480 3300046491 Bacteria 5322
229 Ga0495607_0005674 3300046501 Bacteria 8890
230 Ga0495607_0021955 3300046501 Bacteria 4014
231 Ga0495583_0007348 3300046506 Bacteria 6941
232 Ga0495606_0027762 3300046507 Bacteria 4006
233 Ga0495610_0014427 3300046512 Bacteria 4640
234 Ga0495616_0006790 3300046513 Bacteria 6898
235 Ga0495643_0128656 3300046522 Bacteria 1273
236 Ga0495643_0185783 3300046522 Bacteria 1007
237 Ga0495648_0129931 3300046524 Bacteria 1341
238 Ga0495642_0020946 3300046528 Bacteria 2570
239 Ga0495654_0029741 3300046530 Bacteria 2784
240 Ga0495609_0001092 3300046538 Bacteria 18861
241 Ga0495622_0000036 3300046557 Bacteria 122551
242 Ga0495633_0008945 3300046558 Bacteria 5580
243 Ga0495633_0069562 3300046558 Bacteria 1643
244 Ga0495668_0000046 3300046616 Bacteria 224203
245 Ga0495668_0010183 3300046616 Bacteria 5714
246 Ga0495668_0192779 3300046616 Bacteria 1116
247 Ga0495611_0064613 3300046648 Bacteria 1667
248 Ga0495625_0000656 3300046660 Bacteria 49427
249 Ga0495659_0002715 3300046664 Bacteria 5690
250 Ga0495661_0008856 3300046665 Bacteria 6936
251 Ga0495669_0001882 3300046684 Bacteria 8607
252 Ga0495670_0307263 3300046691 Bacteria 850
253 Ga0495671_0039105 3300046692 Bacteria 2396
254 Ga0495649_0056238 3300046694 Bacteria 2124
255 Ga0495660_0010730 3300046810 Bacteria 5324
256 Ga0495660_0036347 3300046810 Bacteria 2748
257 Ga0495660_0306654 3300046810 Bacteria 718
258 Ga0495672_0000005 3300047320 Bacteria 593294
259 Ga0495677_0013193 3300047445 Bacteria 3006
260 Ga0495679_043416 3300047446 Bacteria 1382
261 Ga0495685_054392 3300047447 Bacteria 1354
262 Ga0495681_0010642 3300047470 Bacteria 5557
263 Ga0495686_0000352 3300047472 Bacteria 75409
264 Ga0495686_0006245 3300047472 Bacteria 9175
265 Ga0496100_0047000 3300048903 Bacteria 2779
266 Ga0496100_0062635 3300048903 Bacteria 2455
267 Ga0496101_0018972 3300048904 Bacteria 4687
268 Ga0496101_0043989 3300048904 Bacteria 3194
269 Ga0496102_0024951 3300048905 Bacteria 5318
270 Ga0496102_0050677 3300048905 Bacteria 3781
271 Ga0496105_0118485 3300048908 Bacteria 2184
272 Ga0496105_0303246 3300048908 Bacteria 1284
273 Ga0496106_0061816 3300048909 Bacteria 2842
274 Ga0496107_0011483 3300048910 Bacteria 6171
275 Ga0496108_0036447 3300048911 Bacteria 4092
276 Ga0496108_0063814 3300048911 Bacteria 3102
277 Ga0496109_0028476 3300048912 Bacteria 4996
278 Ga0496109_0032154 3300048912 Bacteria 4714
279 Ga0496109_1229687 3300048912 Bacteria 685
280 Ga0496110_0008453 3300048913 Bacteria 8286
281 Ga0496110_0331391 3300048913 Bacteria 1386
282 Ga0496111_0015214 3300048914 Bacteria 5275
283 Ga0496111_0102089 3300048914 Bacteria 2108
284 Ga0496112_0394891 3300048915 Bacteria 1323
285 Ga0496113_0217253 3300048916 Bacteria 1523
286 Ga0496114_0053803 3300048917 Bacteria 3356
287 Ga0496115_0143611 3300048918 Bacteria 1969
288 Ga0496125_0000545 3300048928 Bacteria 64939
289 Ga0501306_007174 3300049127 Bacteria 1327
290 Ga0501305_018570 3300049161 Bacteria 1008
291 Ga0495678_040595 3300049459 Bacteria 1869
292 Ga0495682_0052615 3300049460 Bacteria 1479
293 Ga0501319_006113 3300049535 Bacteria 881
294 Ga0501320_007686 3300049536 Bacteria 1044
295 Ga0501324_001603 3300049540 Bacteria 1532
296 Ga0501324_004347 3300049540 Bacteria 1125
297 Ga0501044_0296735 3300049823 Bacteria 1546
298 Ga0500555_049174 3300053103 Bacteria 1156
299 Ga0587084_000329 3300059477 Bacteria 3517
300 Ga0587084_010947 3300059477 Bacteria 1199
301 Ga0587084_018801 3300059477 Bacteria 1012
302 Ga0587093_001569 3300059478 Bacteria 1966
303 Ga0587066_006539 3300059490 Bacteria 1543
304 Ga0587066_023714 3300059490 Bacteria 1038
305 Ga0587070_002086 3300059491 Bacteria 2203
306 Ga0587070_010920 3300059491 Bacteria 1347
307 Ga0587077_000689 3300059493 Bacteria 3132
308 Ga0587077_009628 3300059493 Bacteria 1471
309 Ga0587080_000448 3300059503 Bacteria 3473
310 Ga0587080_002416 3300059503 Bacteria 2194
311 Ga0587082_002268 3300059504 Bacteria 2144
312 Ga0587082_003223 3300059504 Bacteria 1937
313 Ga0587083_0005830 3300059505 Bacteria 1803
314 Ga0587085_003757 3300059506 Bacteria 1679
315 Ga0587085_005645 3300059506 Bacteria 1483
316 Ga0587086_000841 3300059507 Bacteria 2451
317 Ga0587088_047944 3300059508 Bacteria 827
318 Ga0587089_004116 3300059509 Bacteria 1589
319 Ga0587089_007656 3300059509 Bacteria 1286
320 Ga0587090_000218 3300059510 Bacteria 4197
321 Ga0587090_000401 3300059510 Bacteria 3515
322 Ga0587090_005284 3300059510 Bacteria 1612
323 Ga0587091_000869 3300059511 Bacteria 2956
324 Ga0587091_001743 3300059511 Bacteria 2435
325 Ga0587091_032917 3300059511 Bacteria 983
326 Ga0587094_001563 3300059513 Bacteria 2200
327 Ga0587094_003367 3300059513 Bacteria 1738
328 Ga0587095_004653 3300059514 Bacteria 1012
329 Ga0587101_001053 3300059623 Bacteria 2245
330 Ga0587101_011629 3300059623 Bacteria 1129
331 Ga0587109_002035 3300059624 Bacteria 2492
332 Ga0587115_002601 3300059626 Bacteria 1813
333 Ga0587117_017971 3300059627 Bacteria 957
334 Ga0587062_008764 3300059639 Bacteria 1215
335 Ga0587067_001802 3300059640 Bacteria 2410
336 Ga0587069_005798 3300059642 Bacteria 1455
337 Ga0587072_001099 3300059643 Bacteria 3183
338 Ga0587072_029900 3300059643 Bacteria 1012
339 Ga0587075_003805 3300059644 Bacteria 1712
340 Ga0587076_001164 3300059645 Bacteria 2594
341 Ga0587076_001389 3300059645 Bacteria 2444
342 Ga0587078_000835 3300059646 Bacteria 2524
343 Ga0587079_003069 3300059647 Bacteria 2140
344 Ga0587079_007840 3300059647 Bacteria 1610
345 Ga0587079_018937 3300059647 Bacteria 1213
346 Ga0587100_000742 3300059648 Bacteria 1694
347 Ga0587107_008368 3300059652 Bacteria 1193
348 Ga0587108_005477 3300059653 Bacteria 958
349 Ga0587124_002894 3300059660 Bacteria 1242
350 Ga0587124_003018 3300059660 Bacteria 1226
351 Ga0587071_005731 3300060344 Bacteria 1912
352 Ga0587071_044040 3300060344 Bacteria 903
353 Ga0587111_0001374 3300060346 Bacteria 2898
354 Ga0587111_0001481 3300060346 Bacteria 2835
355 Ga0466962_0064042 3300061719 Bacteria 1755
356 2547372621 2547132103 Bacteria 5115736
357 2843691669 2843690924 Bacteria 5169057
358 2846037043 2846033681 Bacteria 4377894
359 2846040166 2846037992 Bacteria 4526407
360 2998348354 2998344455 Bacteria 4222996
361 Ga0495649_0081151
362 Ga0006770J48903_1044971
363 rootH1_10078610
364 Ga0007417J51691_1034645
365 Ga0007410J51695_1045320
366 Ga0007429J51699_1036152
367 Ga0032354_1044129
368 Ga0055529_1000478
369 Ga0055526_1000709
370 Ga0055526_1000967
371 Ga0055537_1000822
372 Ga0055524_1003597
373 Ga0055534_1000601
374 Ga0055528_1000050
375 Ga0070658_10292657
376 Ga0070676_10297788
377 Ga0070683_100031806
378 Ga0070683_100345248
379 Ga0070690_100573873
380 Ga0068869_100116268
381 Ga0070680_100063571
382 Ga0068868_100007250
383 Ga0070660_100033410
384 Ga0070660_100056839
385 Ga0070660_100951534
386 Ga0070661_100006678
387 Ga0070661_100392787
388 Ga0070692_10088785
389 Ga0070669_100030757
390 Ga0070675_100002913
391 Ga0070671_100026405
392 Ga0070659_100016269
393 Ga0070659_100371939
394 Ga0070659_100590631
395 Ga0070667_100027407
396 Ga0070667_100098290
397 Ga0070667_100145127
398 Ga0070701_10229450
399 Ga0070700_100346310
400 Ga0070663_100002045
401 Ga0070663_100933565
402 Ga0070678_100116129
403 Ga0070662_100017564
404 Ga0070681_10292477
405 Ga0070681_10677835
406 Ga0070679_100021313
407 Ga0070679_100300863
408 Ga0068853_100016917
409 Ga0068853_100460753
410 Ga0070672_100013676
411 Ga0070693_100434691
412 Ga0070664_100005621
413 Ga0068857_100037458
414 Ga0068856_100090006
415 Ga0068856_100167235
416 Ga0068856_100240220
417 Ga0068856_101388115
418 Ga0068852_100007663
419 Ga0068852_100084612
420 Ga0068852_100323911
421 Ga0068852_101656106
422 Ga0068859_100144987
423 Ga0068859_100399405
424 Ga0068864_100405350
425 Ga0068861_100000757
426 Ga0068851_10018213
427 Ga0068851_10081821
428 Ga0068863_100099315
429 Ga0068863_100610029
430 Ga0068858_100019626
431 Ga0068860_100033406
432 Ga0068860_100551594
433 Ga0075432_10039542
434 Ga0068871_100684300
435 Ga0075434_100166543
436 Ga0068865_100309763
437 Ga0097620_100144996
438 Ga0097620_100399379
439 Ga0105245_10109932
440 Ga0105242_10181008
441 Ga0105248_10081871
442 Ga0105248_10404876
443 Ga0105238_10059079
444 Ga0105238_10081408
445 Ga0105239_10197223
446 Ga0157373_10038721
447 Ga0157369_10065353
448 Ga0157369_10454278
449 Ga0157374_10353148
450 Ga0163162_10012542
451 Ga0157372_10016161
452 Ga0157372_10167119
453 Ga0157380_10075625
454 Ga0157377_10010702
455 Ga0157379_10005388
456 Ga0157379_10008057
457 Ga0157376_10029054
458 Ga0163161_10020402
459 Ga0213872_10000191
460 Ga0213872_10000305
461 Ga0213872_10002189
462 Ga0213872_10002860
463 Ga0213872_10004063
464 Ga0213872_10013863
465 Ga0209565_1000018
466 Ga0209455_1000047
467 Ga0209673_1000090
468 Ga0209675_1000005
469 Ga0209564_1000032
470 Ga0209564_1000078
471 Ga0209256_1000070
472 Ga0207656_10042567
473 Ga0207656_10070274
474 Ga0207682_10095876
475 Ga0207680_10042631
476 Ga0207645_10031014
477 Ga0207705_10677067
478 Ga0207660_10021246
479 Ga0207657_10007926
480 Ga0207657_10064285
481 Ga0207649_10105704
482 Ga0207649_10110943
483 Ga0207652_10008328
484 Ga0207681_10033865
485 Ga0207694_10110387
486 Ga0207694_10742832
487 Ga0207650_10124130
488 Ga0207650_10848168
489 Ga0207659_10143819
490 Ga0207687_10039484
491 Ga0207644_10078530
492 Ga0207644_10200778
493 Ga0207690_10010177
494 Ga0207690_10024909
495 Ga0207690_10083619
496 Ga0207706_10002060
497 Ga0207686_10367892
498 Ga0207691_10042085
499 Ga0207711_10141451
500 Ga0207711_10688168
501 Ga0207689_10000919
502 Ga0207661_10671941
503 Ga0207679_10309511
504 Ga0207668_10044827
505 Ga0207658_10077813
506 Ga0207658_10131839
507 Ga0207658_10356883
508 Ga0207677_10003852
509 Ga0207703_10058830
510 Ga0207639_10384160
511 Ga0207678_10005670
512 Ga0207702_10023989
513 Ga0207702_10295007
514 Ga0207641_10090017
515 Ga0207641_10321936
516 Ga0207674_10601922
517 Ga0207675_100000956
518 Ga0207683_10063700
519 Ga0207698_10041309
520 Ga0207698_10160476
521 Ga0207698_10408422
522 Ga0207698_10719110
523 Ga0268265_10246707
524 Ga0268265_10443928
525 Ga0268264_10225394
526 Ga0268264_10392687
527 Ga0316181_1128786
528 Ga0265331_10030217
529 Ga0307509_10771948
530 Ga0307408_100000401
531 Ga0307408_100051568
532 Ga0316575_10000494
533 Ga0307405_10078072
534 Ga0307518_10046074
535 Ga0307412_10008266
536 Ga0307412_10828330
537 Ga0307409_100001376
538 Ga0307416_100006637
539 Ga0307416_100006785
540 Ga0307414_10937127
541 Ga0307411_10080392
542 Ga0307415_100006664
543 Ga0316583_10103699
544 Ga0373931_0005543
545 Ga0395899_0003935
546 Ga0395899_0069683
547 Ga0395900_0002282
548 Ga0395900_0010620
549 Ga0395900_0026968
550 Ga0395898_0018737
551 Ga0395898_0431270
552 Ga0395905_0190906
553 Ga0395905_1177177
554 Ga0395901_0001532
555 Ga0395901_0050852
556 Ga0395901_0296625
557 Ga0395901_0516407
558 Ga0395901_1558348
559 Ga0436365_1337200
560 Ga0436361_0091148
561 Ga0436361_0128896
562 Ga0436361_0636225
563 Ga0436361_0788745
564 Ga0436361_0891393
565 Ga0436361_1028197
566 Ga0436361_1200667
567 Ga0436363_0607531
568 Ga0466972_0000162
569 Ga0466972_0009956
570 Ga0453683_0045645
571 Ga0466965_0002397
572 Ga0466965_0021721
573 Ga0466964_0013092
574 Ga0453684_0579310
575 Ga0466971_0024700
576 Ga0466968_0058982
577 Ga0466959_0003791
578 Ga0466959_0133444
579 Ga0451576_0000006
580 Ga0451576_0187750
581 Ga0451576_0333806
582 Ga0451576_0575562
583 Ga0451576_1087256
584 Ga0495590_0050380
585 Ga0495638_0034055
586 Ga0495650_0000109
587 Ga0495639_0127878
588 Ga0495584_0008480
589 Ga0495607_0005674
590 Ga0495607_0021955
591 Ga0495583_0007348
592 Ga0495606_0027762
593 Ga0495610_0014427
594 Ga0495616_0006790
595 Ga0495643_0128656
596 Ga0495643_0185783
597 Ga0495648_0129931
598 Ga0495642_0020946
599 Ga0495654_0029741
600 Ga0495609_0001092
601 Ga0495622_0000036
602 Ga0495633_0008945
603 Ga0495633_0069562
604 Ga0495668_0000046
605 Ga0495668_0010183
606 Ga0495668_0192779
607 Ga0495611_0064613
608 Ga0495625_0000656
609 Ga0495659_0002715
610 Ga0495661_0008856
611 Ga0495669_0001882
612 Ga0495670_0307263
613 Ga0495671_0039105
614 Ga0495649_0056238
615 Ga0495660_0010730
616 Ga0495660_0036347
617 Ga0495660_0306654
618 Ga0495672_0000005
619 Ga0495677_0013193
620 Ga0495679_043416
621 Ga0495685_054392
622 Ga0495681_0010642
623 Ga0495686_0000352
624 Ga0495686_0006245
625 Ga0496100_0047000
626 Ga0496100_0062635
627 Ga0496101_0018972
628 Ga0496101_0043989
629 Ga0496102_0024951
630 Ga0496102_0050677
631 Ga0496105_0118485
632 Ga0496105_0303246
633 Ga0496106_0061816
634 Ga0496107_0011483
635 Ga0496108_0036447
636 Ga0496108_0063814
637 Ga0496109_0028476
638 Ga0496109_0032154
639 Ga0496109_1229687
640 Ga0496110_0008453
641 Ga0496110_0331391
642 Ga0496111_0015214
643 Ga0496111_0102089
644 Ga0496112_0394891
645 Ga0496113_0217253
646 Ga0496114_0053803
647 Ga0496115_0143611
648 Ga0496125_0000545
649 Ga0501306_007174
650 Ga0501305_018570
651 Ga0495678_040595
652 Ga0495682_0052615
653 Ga0501319_006113
654 Ga0501320_007686
655 Ga0501324_001603
656 Ga0501324_004347
657 Ga0501044_0296735
658 Ga0500555_049174
659 Ga0587084_000329
660 Ga0587084_010947
661 Ga0587084_018801
662 Ga0587093_001569
663 Ga0587066_006539
664 Ga0587066_023714
665 Ga0587070_002086
666 Ga0587070_010920
667 Ga0587077_000689
668 Ga0587077_009628
669 Ga0587080_000448
670 Ga0587080_002416
671 Ga0587082_002268
672 Ga0587082_003223
673 Ga0587083_0005830
674 Ga0587085_003757
675 Ga0587085_005645
676 Ga0587086_000841
677 Ga0587088_047944
678 Ga0587089_004116
679 Ga0587089_007656
680 Ga0587090_000218
681 Ga0587090_000401
682 Ga0587090_005284
683 Ga0587091_000869
684 Ga0587091_001743
685 Ga0587091_032917
686 Ga0587094_001563
687 Ga0587094_003367
688 Ga0587095_004653
689 Ga0587101_001053
690 Ga0587101_011629
691 Ga0587109_002035
692 Ga0587115_002601
693 Ga0587117_017971
694 Ga0587062_008764
695 Ga0587067_001802
696 Ga0587069_005798
697 Ga0587072_001099
698 Ga0587072_029900
699 Ga0587075_003805
700 Ga0587076_001164
701 Ga0587076_001389
702 Ga0587078_000835
703 Ga0587079_003069
704 Ga0587079_007840
705 Ga0587079_018937
706 Ga0587100_000742
707 Ga0587107_008368
708 Ga0587108_005477
709 Ga0587124_002894
710 Ga0587124_003018
711 Ga0587071_005731
712 Ga0587071_044040
713 Ga0587111_0001374
714 Ga0587111_0001481
715 Ga0466962_0064042
716 2547372621
717 2843691669
718 2846037043
719 2846040166
720 2998348354

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01782

RimM

RimM N-terminal domain

28

109

0.95

PF05239

PRC

PRC-barrel domain

116

204

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dog-assembly1.cif.gz_A solution structure of the n-terminal domain of rimm from thermus thermophilus hb8 0.8726 12 100
2dog-assembly1.cif.gz_A solution structure of the n-terminal domain of rimm from thermus thermophilus hb8 0.8449 12 100
3a1p-assembly2.cif.gz_C structure of ribosome maturation protein rimm and ribosomal protein s19 0.8083 12 142
7cq1-assembly1.cif.gz_A solution structure of the c-terminal domain of mycobacterium tuberculosis ribosome maturation factor protein rimm 0.7122 102 153
3a1p-assembly2.cif.gz_C structure of ribosome maturation protein rimm and ribosomal protein s19 0.6507 12 142
ID Description Score Start End Superfamily
3a1pC01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;RimM 0.9183 12 99 2.40.30.60
3a1pC01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;RimM 0.8977 12 99 2.40.30.60
af_I1KSK3_79_172_2.40.30.60 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;RimM 0.871 13 97 2.40.30.60
2f1lA01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;RimM 0.8626 11 98 2.40.30.60
af_Q2FZ44_1_87_2.40.30.60 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;RimM 0.8616 12 95 2.40.30.60
ID Description Score Start End GO Terms
AF-A0A177QY58-F1-model_v4 Ribosome maturation factor RimM 0.8957 13 141 GO:0005737
GO:0005840
GO:0006364
GO:0042274
GO:0043022
AF-A0A117KNZ0-F1-model_v4 Ribosome maturation factor RimM 0.8862 8 142 GO:0005737
GO:0005840
GO:0006364
GO:0042274
GO:0043022
AF-A0A3D3PNT2-F1-model_v4 Ribosome maturation factor RimM 0.8854 3 141 GO:0005737
GO:0005840
GO:0006364
GO:0043022
AF-A0A3N5SMV8-F1-model_v4 deleted 0.8713 6 120
AF-A0A3N5SMV8-F1-model_v4 deleted 0.8573 6 120

Map