F421983

General Info

Members Datasets Scaffolds Average Seq Length
360 322 120 401

Family's Representative Sequence

Representative Sequence 3300047443|Ga0495687_026570|Ga0495687_026570_494_1834
Length 446
Sequence MAEIVLLAGHGNRMSLIAALIKPHGLTYIHGQTGWTCIANWKSNLDHRETARILVAGSGPAGLIAALGFAEAGFPVTLIGPEAGGPDGRTTALMNPALKILDRLGVLADIGPKAAPLKVMRIVDATSRLIRSPVVTFRATEIGEEQFGLNLPNSALNPALARAVAVHSGIEWLKVMVESWRLDADEAHAVLADGREISASLAVAXXXRLSPAREAAGIAASVRSYPQAALVLNFGHRSEHGFTSTEFHTETGPFTQVPLPGNRSSLVWVVKPETAKDLAALDDVTLSERVEQQMQSMLGRVSVEPGRQIYPLSAASPGRFAQNRVALVGEAAHVFPPIGAQGLNLGIRDIDDLIGIAGENRSDPGAPKALAAYDSRRRPDILARSGAVNLLNMSLLSDMLPAQMARSAGLTVLGSFAPLRAFFMREGLRPGSGFAALTGLGKQVRR

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
4 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
5 2509276019 Ensifer aridi TW10 Isolate Nodule
6 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
7 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
8 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
9 2512875024 Mesorhizobium loti R88b Isolate Nodule
10 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
11 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
12 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
13 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
14 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
15 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
16 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
17 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
18 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
19 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
20 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
21 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
22 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
23 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
24 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
25 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
26 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
27 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
28 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
29 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
30 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
31 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
32 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
33 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
34 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
35 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
36 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
37 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
38 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
39 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
40 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
41 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
42 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
43 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
44 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
45 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
46 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
47 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
48 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
49 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
50 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
51 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
52 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
53 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
54 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
55 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
56 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
57 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
58 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
59 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
60 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
61 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
62 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
63 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
64 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
65 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
66 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
67 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
68 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
69 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
70 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
71 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
72 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
73 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
74 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
75 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
76 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
77 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
78 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
79 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
80 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
81 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
82 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
83 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
84 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
85 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
86 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
87 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
88 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
89 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
90 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
91 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
92 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
93 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
94 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
95 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
96 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
97 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
98 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
99 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
100 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
101 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
102 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
103 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
104 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
105 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
106 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
107 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
108 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
109 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
110 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
111 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
112 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
113 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
114 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
115 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
116 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
117 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
118 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
119 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
120 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
121 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
122 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
123 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
124 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
125 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
126 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
127 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
128 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
129 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
130 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
131 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
132 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
133 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
134 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
135 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
136 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
137 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
138 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
139 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
140 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
141 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
142 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
143 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
144 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
145 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
146 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
147 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
148 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
149 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
150 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
151 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
152 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
153 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
154 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
155 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
156 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
157 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
158 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
159 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
160 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
161 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
162 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
163 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
164 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
165 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
166 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
167 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
168 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
169 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
170 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
171 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
172 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
173 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
174 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
175 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
176 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
177 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
178 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
179 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
180 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
181 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
182 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
183 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
184 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
185 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
186 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
187 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
188 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
189 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
190 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
191 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
192 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
193 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
194 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
195 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
196 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
197 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
198 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
199 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
200 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
201 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
202 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
203 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
204 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
205 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
206 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
207 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
208 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
209 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
210 3004167301 Mesorhizobium loti 582 Isolate Unclassified
211 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
212 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
213 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
214 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
215 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
216 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
217 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
218 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
219 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
220 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
221 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
222 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
223 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
224 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
225 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
226 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
227 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
228 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
229 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
230 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
231 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
232 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
233 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
234 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
235 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
236 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
237 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
238 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
239 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
240 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
241 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
242 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
243 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
244 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
245 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
246 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
247 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
248 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
249 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
250 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
251 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
252 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
259 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
260 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
261 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
262 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
263 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
264 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
265 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
266 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
267 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
268 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
269 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
270 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
271 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
272 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
273 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
274 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
275 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
276 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
277 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
290 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
291 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
292 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
293 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
294 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
295 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
296 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
298 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
299 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
300 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
301 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
302 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
303 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
304 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
305 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
306 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
307 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
308 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
309 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
310 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
311 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
312 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
313 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
314 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
315 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
316 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
317 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
318 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
319 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
320 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
321 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
322 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 33.33
Metatranscriptomes 0
Isolates 66.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.83
Nodule 57.22
Rhizoplane 0.83
Rhizosphere 24.72
Stem 0
Stem Tuber 0
Unclassified 11.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1007325 3300002705 Bacteria 2913
2 JGI25157J39369_1000963 3300002741 Bacteria 13455
3 JGI25152J39213_1001213 3300002773 Bacteria 11822
4 JGI25151J46595_10020246 3300003187 Bacteria 2808
5 JGI25165J46597_1000033 3300003214 Bacteria 293030
6 rootH2_10041784 3300003320 Bacteria 3887
7 rootL2_10027690 3300003322 Bacteria 11854
8 Ga0055542_1000654 3300003762 Bacteria 28482
9 Ga0070663_100018318 3300005455 Bacteria 4589
10 Ga0068867_100017373 3300005459 Bacteria 5111
11 Ga0070665_100053323 3300005548 Bacteria 4056
12 Ga0068856_100072923 3300005614 Bacteria 3399
13 Ga0081540_1036306 3300005983 Bacteria 2630
14 Ga0081539_10001774 3300005985 Bacteria 34330
15 Ga0075365_10002068 3300006038 Bacteria 9574
16 Ga0075365_10031349 3300006038 Bacteria 3410
17 Ga0075364_10003139 3300006051 Bacteria 9351
18 Ga0105240_10104497 3300009093 Bacteria 3440
19 Ga0105240_10211276 3300009093 Bacteria 2267
20 Ga0105243_10015480 3300009148 Bacteria 5765
21 Ga0105237_10005996 3300009545 Bacteria 13605
22 Ga0105237_10220578 3300009545 Bacteria 1896
23 Ga0105238_10017009 3300009551 Bacteria 7383
24 Ga0105238_10123688 3300009551 Bacteria 2566
25 Ga0105238_10193126 3300009551 Bacteria 2012
26 Ga0105239_10020786 3300010375 Bacteria 7244
27 Ga0105239_10170086 3300010375 Bacteria 2436
28 Ga0105239_10185651 3300010375 Bacteria 2327
29 Ga0105239_10213858 3300010375 Bacteria 2161
30 Ga0157369_10198323 3300013105 Bacteria 2107
31 Ga0214544_1001054 3300021320 Bacteria 55518
32 Ga0214542_1036171 3300021321 Bacteria 1479
33 Ga0209026_1000002 3300025250 Bacteria 1136158
34 Ga0209148_1000072 3300025254 Bacteria 325292
35 Ga0209759_1000146 3300025256 Bacteria 121497
36 Ga0209233_1000027 3300025261 Bacteria 652089
37 Ga0209233_1004165 3300025261 Bacteria 4972
38 Ga0209455_1000153 3300025272 Bacteria 124411
39 Ga0209758_1003327 3300025297 Bacteria 14794
40 Ga0207694_10009648 3300025924 Bacteria 7277
41 Ga0207709_10028383 3300025935 Bacteria 3235
42 Ga0207640_10061637 3300025981 Bacteria 2485
43 Ga0207678_10066746 3300026067 Bacteria 3088
44 Ga0207648_10017341 3300026089 Bacteria 6556
45 Ga0207674_10272267 3300026116 Bacteria 1641
46 Ga0307412_10111438 3300031911 Bacteria 1955
47 Ga0395900_0043223 3300037418 Bacteria 4644
48 Ga0395898_0121896 3300037466 Bacteria 2498
49 Ga0395898_0378901 3300037466 Bacteria 1349
50 Ga0395905_0229186 3300037471 Bacteria 1737
51 Ga0395901_0024161 3300038443 Bacteria 6235
52 Ga0395901_0068114 3300038443 Bacteria 3708
53 Ga0466972_0012545 3300044658 Bacteria 4258
54 Ga0466960_0025967 3300044901 Bacteria 2656
55 Ga0495638_0067917 3300046460 Bacteria 2187
56 Ga0495606_0095022 3300046507 Bacteria 1826
57 Ga0495616_0047706 3300046513 Bacteria 2156
58 Ga0495625_0018559 3300046660 Bacteria 5425
59 Ga0495687_026570 3300047443 Bacteria 2723
60 Ga0495602_0164742 3300048088 Bacteria 1727
61 Ga0496112_0131863 3300048915 Bacteria 2470
62 Ga0496115_0241409 3300048918 Bacteria 1489
63 Ga0496119_0057905 3300048922 Bacteria 2339
64 Ga0496120_0000589 3300048923 Bacteria 55133
65 Ga0496120_0019188 3300048923 Bacteria 4382
66 Ga0496121_0212987 3300048924 Bacteria 1367
67 Ga0496125_0092854 3300048928 Bacteria 2255
68 Ga0501031_0000014 3300049568 Bacteria 127199
69 Ga0501031_0054662 3300049568 Bacteria 2601
70 Ga0501032_0000015 3300049569 Bacteria 176755
71 Ga0501032_0060072 3300049569 Bacteria 2550
72 Ga0501033_0000023 3300049570 Bacteria 176725
73 Ga0501033_0001969 3300049570 Bacteria 17888
74 Ga0501034_0000073 3300049571 Bacteria 176737
75 Ga0501034_0272619 3300049571 Bacteria 1633
76 Ga0501036_0000002 3300049572 Bacteria 293106
77 Ga0501037_0000158 3300049573 Bacteria 63431
78 Ga0501037_0166217 3300049573 Bacteria 1571
79 Ga0501038_0000002 3300049574 Bacteria 330446
80 Ga0501038_0154906 3300049574 Bacteria 1866
81 Ga0501039_0000002 3300049575 Bacteria 375152
82 Ga0501040_0003017 3300049576 Bacteria 10906
83 Ga0501043_0003385 3300049579 Bacteria 13134
84 Ga0501046_0099033 3300049580 Bacteria 2238
85 Ga0501047_0001688 3300049581 Bacteria 21480
86 Ga0501047_0007205 3300049581 Bacteria 10455
87 Ga0501047_0055908 3300049581 Bacteria 3816
88 Ga0501047_0220106 3300049581 Bacteria 1755
89 Ga0501069_0006898 3300049585 Bacteria 5936
90 Ga0501069_0051704 3300049585 Bacteria 2287
91 Ga0501070_0000186 3300049586 Bacteria 58369
92 Ga0501070_0000931 3300049586 Bacteria 26365
93 Ga0501070_0026480 3300049586 Bacteria 4864
94 Ga0501070_0027740 3300049586 Bacteria 4750
95 Ga0501070_0093008 3300049586 Bacteria 2495
96 Ga0501070_0098245 3300049586 Bacteria 2422
97 Ga0501071_0079200 3300049587 Bacteria 2402
98 Ga0501073_0076858 3300049589 Bacteria 2323
99 Ga0501073_0218218 3300049589 Bacteria 1318
100 Ga0501074_0070734 3300049590 Bacteria 2508
101 Ga0501079_0151045 3300049741 Bacteria 1811
102 Ga0501080_0001450 3300049742 Bacteria 19946
103 Ga0501080_0034607 3300049742 Bacteria 4717
104 Ga0501080_0105466 3300049742 Bacteria 2613
105 Ga0501035_0000022 3300049822 Bacteria 208622
106 Ga0501035_0000690 3300049822 Bacteria 36838
107 Ga0501035_0001914 3300049822 Bacteria 20905
108 Ga0501044_0000002 3300049823 Bacteria 375152
109 Ga0501044_0002922 3300049823 Bacteria 19435
110 Ga0501044_0029463 3300049823 Bacteria 5788
111 nmdc:mga03683_16566_c1 3300050489 Bacteria 2771
112 nmdc:mga03n38_43267_c1 3300050490 Bacteria 1973
113 nmdc:mga00v17_19146_c1 3300050491 Bacteria 3902
114 nmdc:mga0yw44_30506_c1 3300050492 Bacteria 3125
115 nmdc:mga0yw44_47814_c1 3300050492 Bacteria 2577
116 Ga0495655_0012669 3300053083 Bacteria 1725
117 Ga0500568_0000059 3300053139 Bacteria 108096
118 Ga0500573_0001416 3300053140 Bacteria 11472
119 Ga0500620_000560 3300053155 Bacteria 6410
120 Ga0500622_0013360 3300053156 Bacteria 4429

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049573 Ga0501037_0166217 Ga0501037_0166217_47_1132 353
2 3300046507 Ga0495606_0095022 Ga0495606_0095022_83_1147 354
3 3300049586 Ga0501070_0026480 Ga0501070_0026480_1067_2272 358
4 iso_pu_bacteria 2968097103 2968099345 369
5 iso_pu_bacteria 2551306090 2551718602 372
6 3300037466 Ga0395898_0121896 Ga0395898_0121896_765_2009 373
7 3300049568 Ga0501031_0000014 Ga0501031_0000014_24631_25836 376
8 3300049569 Ga0501032_0000015 Ga0501032_0000015_24631_25836 376
9 3300049570 Ga0501033_0000023 Ga0501033_0000023_24631_25836 376
10 3300049571 Ga0501034_0000073 Ga0501034_0000073_150902_152107 376
11 3300049572 Ga0501036_0000002 Ga0501036_0000002_24631_25836 376
12 3300049573 Ga0501037_0000158 Ga0501037_0000158_37596_38801 376
13 3300049574 Ga0501038_0000002 Ga0501038_0000002_240633_241838 376
14 3300049575 Ga0501039_0000002 Ga0501039_0000002_106675_107880 376
15 3300049576 Ga0501040_0003017 Ga0501040_0003017_7592_8797 376
16 3300049579 Ga0501043_0003385 Ga0501043_0003385_7857_9062 376
17 3300049581 Ga0501047_0001688 Ga0501047_0001688_15829_17034 376
18 3300049822 Ga0501035_0000022 Ga0501035_0000022_160025_161230 376
19 3300049823 Ga0501044_0000002 Ga0501044_0000002_267273_268478 376
20 iso_pu_bacteria 2924710171 2924718542 381
21 3300049581 Ga0501047_0220106 Ga0501047_0220106_185_1363 384
22 3300049586 Ga0501070_0027740 Ga0501070_0027740_803_1981 384
23 3300049586 Ga0501070_0098245 Ga0501070_0098245_815_1981 384
24 3300049742 Ga0501080_0105466 Ga0501080_0105466_680_1858 384
25 iso_pu_bacteria 2508501127 2509140371 389
26 iso_pu_bacteria 2922178524 2922178725 390
27 iso_pu_bacteria 2513237351 2514588959 393
28 3300010375 Ga0105239_10213858 Ga0105239_102138583 394
29 3300050490 nmdc:mga03n38_43267_c1 nmdc:mga03n38_43267_c1_450_1664 395
30 3300053083 Ga0495655_0012669 Ga0495655_0012669_140_1480 395
31 iso_pu_bacteria 2885334103 2885334183 395
32 iso_pu_bacteria 2508501122 2509107738 396
33 iso_pu_bacteria 2509276019 2509376119 396
34 iso_pu_bacteria 2524023207 2524453599 396
35 iso_pu_bacteria 2558860100 2558865665 396
36 iso_pu_bacteria 2558860100 2558868355 396
37 iso_pu_bacteria 2842509118 2842510219 396
38 iso_pu_bacteria 2850079185 2850080944 396
39 iso_pu_bacteria 2852387548 2852389628 396
40 iso_pu_bacteria 8018127388 8018129576 396
41 iso_pu_bacteria 8024486573 8024492600 396
42 iso_pu_bacteria 8046767195 8046772755 396
43 iso_pu_bacteria 8057575449 8057578285 396
44 iso_pu_bacteria 3003930520 3003933425 397
45 3300006038 Ga0075365_10002068 Ga0075365_100020684 398
46 3300006051 Ga0075364_10003139 Ga0075364_100031393 398
47 3300009545 Ga0105237_10220578 Ga0105237_102205782 398
48 3300010375 Ga0105239_10170086 Ga0105239_101700861 398
49 3300025981 Ga0207640_10061637 Ga0207640_100616372 398
50 3300050492 nmdc:mga0yw44_47814_c1 nmdc:mga0yw44_47814_c1_749_1963 398
51 iso_pu_bacteria 2513237164 2514038399 398
52 iso_pu_bacteria 2643221595 2643986749 398
53 iso_pu_bacteria 2643221627 2644155339 398
54 iso_pu_bacteria 2756170246 2756676916 398
55 iso_pu_bacteria 2791355123 2792752865 398
56 iso_pu_bacteria 2844002411 2844006662 398
57 iso_pu_bacteria 2871466892 2871467767 398
58 iso_pu_bacteria 2874168670 2874172684 398
59 iso_pu_bacteria 2906378014 2906381322 398
60 iso_pu_bacteria 2937822353 2937827088 398
61 iso_pu_bacteria 3004167301 3004170056 398
62 iso_pu_bacteria 2503198000 2503202533 399
63 iso_pu_bacteria 2508501123 2509114327 399
64 iso_pu_bacteria 2509276022 2509397051 399
65 iso_pu_bacteria 2510065059 2510317334 399
66 iso_pu_bacteria 2512875016 2512930687 399
67 iso_pu_bacteria 2512875024 2512958432 399
68 iso_pu_bacteria 2513237090 2513613615 399
69 iso_pu_bacteria 2513237305 2514416816 399
70 iso_pu_bacteria 2588253730 2588516352 399
71 iso_pu_bacteria 2597489875 2597813838 399
72 iso_pu_bacteria 2599185301 2599939651 399
73 iso_pu_bacteria 2687453392 2688599247 399
74 iso_pu_bacteria 2693429783 2694632040 399
75 iso_pu_bacteria 2693429784 2694634553 399
76 iso_pu_bacteria 2721755686 2723576195 399
77 iso_pu_bacteria 2841734538 2841740262 399
78 iso_pu_bacteria 2844009547 2844014423 399
79 iso_pu_bacteria 2847670302 2847670917 399
80 iso_pu_bacteria 2847686936 2847693117 399
81 iso_pu_bacteria 2856314179 2856316374 399
82 iso_pu_bacteria 2856320880 2856326123 399
83 iso_pu_bacteria 2856334872 2856341892 399
84 iso_pu_bacteria 2856349417 2856350665 399
85 iso_pu_bacteria 2856364286 2856369033 399
86 iso_pu_bacteria 2857349434 2857355719 399
87 iso_pu_bacteria 2857367948 2857370322 399
88 iso_pu_bacteria 2869162929 2869165415 399
89 iso_pu_bacteria 2869169390 2869173235 399
90 iso_pu_bacteria 2869242130 2869245780 399
91 iso_pu_bacteria 2869249662 2869253587 399
92 iso_pu_bacteria 2869256925 2869262642 399
93 iso_pu_bacteria 2869264136 2869264675 399
94 iso_pu_bacteria 2869271264 2869273026 399
95 iso_pu_bacteria 2869278585 2869278806 399
96 iso_pu_bacteria 2869285874 2869291551 399
97 iso_pu_bacteria 2871429161 2871433831 399
98 iso_pu_bacteria 2871451962 2871452200 399
99 iso_pu_bacteria 2871474448 2871475604 399
100 iso_pu_bacteria 2871481445 2871488597 399
101 iso_pu_bacteria 2871488783 2871495140 399
102 iso_pu_bacteria 2871495908 2871500580 399
103 iso_pu_bacteria 2874102143 2874104577 399
104 iso_pu_bacteria 2874116593 2874121933 399
105 iso_pu_bacteria 2874123672 2874125821 399
106 iso_pu_bacteria 2874131515 2874136691 399
107 iso_pu_bacteria 2874139085 2874145390 399
108 iso_pu_bacteria 2874146452 2874153410 399
109 iso_pu_bacteria 2874155637 2874160674 399
110 iso_pu_bacteria 2874162495 2874164244 399
111 iso_pu_bacteria 2876363079 2876367966 399
112 iso_pu_bacteria 2876386047 2876391158 399
113 iso_pu_bacteria 2876392853 2876395140 399
114 iso_pu_bacteria 2876399893 2876403300 399
115 iso_pu_bacteria 2876413966 2876419700 399
116 iso_pu_bacteria 2876420981 2876424446 399
117 iso_pu_bacteria 2878035449 2878041698 399
118 iso_pu_bacteria 2878738818 2878743716 399
119 iso_pu_bacteria 2878745973 2878751443 399
120 iso_pu_bacteria 2878753008 2878758193 399
121 iso_pu_bacteria 2878760144 2878764669 399
122 iso_pu_bacteria 2878767105 2878771770 399
123 iso_pu_bacteria 2878774303 2878779964 399
124 iso_pu_bacteria 2881147464 2881152679 399
125 iso_pu_bacteria 2881155292 2881156091 399
126 iso_pu_bacteria 2881861095 2881864856 399
127 iso_pu_bacteria 2882632389 2882638525 399
128 iso_pu_bacteria 2885305155 2885310485 399
129 iso_pu_bacteria 2885312484 2885317310 399
130 iso_pu_bacteria 2885318864 2885323807 399
131 iso_pu_bacteria 2885350715 2885354934 399
132 iso_pu_bacteria 2888350351 2888356773 399
133 iso_pu_bacteria 2889016732 2889023243 399
134 iso_pu_bacteria 2903448605 2903449728 399
135 iso_pu_bacteria 2903492973 2903496074 399
136 iso_pu_bacteria 2903492973 2903505530 399
137 iso_pu_bacteria 2903521522 2903526962 399
138 iso_pu_bacteria 2903528002 2903533189 399
139 iso_pu_bacteria 2903540706 2903545393 399
140 iso_pu_bacteria 2904659560 2904661771 399
141 iso_pu_bacteria 2906308376 2906313360 399
142 iso_pu_bacteria 2906321335 2906326071 399
143 iso_pu_bacteria 2906328253 2906328504 399
144 iso_pu_bacteria 2906363423 2906370733 399
145 iso_pu_bacteria 2906370794 2906372977 399
146 iso_pu_bacteria 2906401398 2906402331 399
147 iso_pu_bacteria 2906408224 2906414263 399
148 iso_pu_bacteria 2906414383 2906416511 399
149 iso_pu_bacteria 2906427513 2906432836 399
150 iso_pu_bacteria 2922151315 2922158027 399
151 iso_pu_bacteria 2922158528 2922158586 399
152 iso_pu_bacteria 2922172374 2922173006 399
153 iso_pu_bacteria 2922185730 2922186110 399
154 iso_pu_bacteria 2924726620 2924730328 399
155 iso_pu_bacteria 2924733363 2924739194 399
156 iso_pu_bacteria 2924741084 2924742529 399
157 iso_pu_bacteria 2924754689 2924754979 399
158 iso_pu_bacteria 2924776078 2924781529 399
159 iso_pu_bacteria 2924784321 2924785933 399
160 iso_pu_bacteria 2937813078 2937820490 399
161 iso_pu_bacteria 2937836603 2937837614 399
162 iso_pu_bacteria 2937861824 2937862700 399
163 iso_pu_bacteria 2937877337 2937879167 399
164 iso_pu_bacteria 2937972304 2937975086 399
165 iso_pu_bacteria 2937994558 2937999243 399
166 iso_pu_bacteria 2958034702 2958034922 399
167 iso_pu_bacteria 2958041894 2958042949 399
168 iso_pu_bacteria 2958041894 2958056384 399
169 iso_pu_bacteria 2958064165 2958067153 399
170 iso_pu_bacteria 2958071322 2958074172 399
171 iso_pu_bacteria 2958084443 2958086341 399
172 iso_pu_bacteria 2958100919 2958106379 399
173 iso_pu_bacteria 2958108152 2958110251 399
174 iso_pu_bacteria 2958115193 2958122607 399
175 iso_pu_bacteria 2958122699 2958129048 399
176 iso_pu_bacteria 2958130278 2958135951 399
177 iso_pu_bacteria 2958137437 2958142966 399
178 iso_pu_bacteria 2958158011 2958159424 399
179 iso_pu_bacteria 2958165035 2958169717 399
180 iso_pu_bacteria 2958172287 2958176095 399
181 iso_pu_bacteria 2958179912 2958185418 399
182 iso_pu_bacteria 2961077736 2961083685 399
183 iso_pu_bacteria 2961114664 2961116924 399
184 iso_pu_bacteria 2961163497 2961168177 399
185 iso_pu_bacteria 2961170736 2961174824 399
186 iso_pu_bacteria 2963644680 2963648539 399
187 iso_pu_bacteria 2965018300 2965022996 399
188 iso_pu_bacteria 2965025482 2965029348 399
189 iso_pu_bacteria 2965040258 2965047192 399
190 iso_pu_bacteria 2965047637 2965055089 399
191 iso_pu_bacteria 2965062239 2965063208 399
192 iso_pu_bacteria 2965089291 2965094991 399
193 iso_pu_bacteria 2965119406 2965123163 399
194 iso_pu_bacteria 2967996073 2968000760 399
195 iso_pu_bacteria 2968003550 2968009868 399
196 iso_pu_bacteria 2968016561 2968017653 399
197 iso_pu_bacteria 2968083720 2968083768 399
198 iso_pu_bacteria 2968091066 2968091961 399
199 iso_pu_bacteria 2968110612 2968112831 399
200 iso_pu_bacteria 2968117919 2968122936 399
201 iso_pu_bacteria 2968128360 2968128879 399
202 iso_pu_bacteria 2968171901 2968176577 399
203 iso_pu_bacteria 2970469710 2970472172 399
204 iso_pu_bacteria 2970489779 2970489886 399
205 iso_pu_bacteria 2970503327 2970507410 399
206 iso_pu_bacteria 2970510686 2970517843 399
207 iso_pu_bacteria 2970524798 2970530151 399
208 iso_pu_bacteria 2970540015 2970546154 399
209 iso_pu_bacteria 2970547951 2970548148 399
210 iso_pu_bacteria 2970554993 2970559516 399
211 iso_pu_bacteria 2970593180 2970593402 399
212 iso_pu_bacteria 2970627176 2970628391 399
213 iso_pu_bacteria 2977821940 2977828733 399
214 iso_pu_bacteria 2977843712 2977848788 399
215 iso_pu_bacteria 2977851361 2977853311 399
216 iso_pu_bacteria 2977864932 2977872087 399
217 iso_pu_bacteria 2977872689 2977873141 399
218 iso_pu_bacteria 2977898635 2977901483 399
219 iso_pu_bacteria 2977922695 2977929093 399
220 iso_pu_bacteria 2977935797 2977939930 399
221 iso_pu_bacteria 2977950692 2977950701 399
222 iso_pu_bacteria 2977957713 2977964704 399
223 iso_pu_bacteria 2977986579 2977989358 399
224 iso_pu_bacteria 2979710463 2979711800 399
225 iso_pu_bacteria 2979764755 2979768723 399
226 iso_pu_bacteria 2979772303 2979778119 399
227 iso_pu_bacteria 2979779861 2979784433 399
228 iso_pu_bacteria 2979808191 2979812606 399
229 iso_pu_bacteria 2987636660 2987640853 399
230 iso_pu_bacteria 2987645492 2987649062 399
231 iso_pu_bacteria 2987659509 2987664191 399
232 iso_pu_bacteria 2996310559 2996311063 399
233 iso_pu_bacteria 2996336353 2996337807 399
234 iso_pu_bacteria 2996341866 2996344766 399
235 iso_pu_bacteria 2996348954 2996351088 399
236 iso_pu_bacteria 2996386984 2996388214 399
237 iso_pu_bacteria 3000135777 3000138305 399
238 iso_pu_bacteria 3004188549 3004193246 399
239 iso_pu_bacteria 3004203850 3004209050 399
240 iso_pu_bacteria 3004211236 3004212630 399
241 iso_pu_bacteria 3004218560 3004221694 399
242 iso_pu_bacteria 3004232784 3004238152 399
243 iso_pu_bacteria 3004239961 3004244870 399
244 iso_pu_bacteria 3004248173 3004254831 399
245 iso_pu_bacteria 3004268573 3004273758 399
246 iso_pu_bacteria 3004275668 3004277786 399
247 iso_pu_bacteria 3004289098 3004290161 399
248 iso_pu_bacteria 3004334049 3004340409 399
249 iso_pu_bacteria 637000159 637073733 399
250 iso_pu_bacteria 649633066 649873734 399
251 iso_pu_bacteria 8004312739 8004313084 399
252 iso_pu_bacteria 8004361976 8004363267 399
253 iso_pu_bacteria 8004374579 8004379705 399
254 iso_pu_bacteria 8004387939 8004393893 399
255 iso_pu_bacteria 8004445564 8004448156 399
256 iso_pu_bacteria 8004640170 8004643249 399
257 iso_pu_bacteria 8004703790 8004714567 399
258 iso_pu_bacteria 8004714634 8004719615 399
259 iso_pu_bacteria 8055617313 8055621796 399
260 3300002773 JGI25152J39213_1001213 JGI25152J39213_10012131 400
261 3300003187 JGI25151J46595_10020246 JGI25151J46595_100202463 400
262 3300003320 rootH2_10041784 rootH2_100417845 400
263 3300003322 rootL2_10027690 rootL2_100276907 400
264 3300021321 Ga0214542_1036171 Ga0214542_10361712 400
265 3300046513 Ga0495616_0047706 Ga0495616_0047706_73_1284 400
266 3300053140 Ga0500573_0001416 Ga0500573_0001416_4885_6087 400
267 3300053156 Ga0500622_0013360 Ga0500622_0013360_1554_2765 400
268 iso_pu_bacteria 2889790730 2889792146 400
269 iso_pu_bacteria 2889914905 2889917907 400
270 3300049568 Ga0501031_0054662 Ga0501031_0054662_1346_2554 401
271 3300006038 Ga0075365_10031349 Ga0075365_100313492 402
272 3300046660 Ga0495625_0018559 Ga0495625_0018559_1477_2685 402
273 3300047443 Ga0495687_026570 Ga0495687_026570_494_1834 402
274 3300049569 Ga0501032_0060072 Ga0501032_0060072_765_1985 402
275 3300049570 Ga0501033_0001969 Ga0501033_0001969_15740_16972 402
276 3300049571 Ga0501034_0272619 Ga0501034_0272619_128_1360 402
277 3300049574 Ga0501038_0154906 Ga0501038_0154906_283_1515 402
278 3300049580 Ga0501046_0099033 Ga0501046_0099033_697_1917 402
279 3300049581 Ga0501047_0007205 Ga0501047_0007205_2896_4128 402
280 3300049581 Ga0501047_0055908 Ga0501047_0055908_689_1921 402
281 3300049585 Ga0501069_0006898 Ga0501069_0006898_1674_2906 402
282 3300049585 Ga0501069_0051704 Ga0501069_0051704_357_1589 402
283 3300049586 Ga0501070_0000186 Ga0501070_0000186_47698_48930 402
284 3300049586 Ga0501070_0000931 Ga0501070_0000931_15467_16699 402
285 3300049587 Ga0501071_0079200 Ga0501071_0079200_627_1859 402
286 3300049589 Ga0501073_0076858 Ga0501073_0076858_462_1694 402
287 3300049589 Ga0501073_0218218 Ga0501073_0218218_22_1242 402
288 3300049590 Ga0501074_0070734 Ga0501074_0070734_1252_2484 402
289 3300049741 Ga0501079_0151045 Ga0501079_0151045_78_1310 402
290 3300049742 Ga0501080_0001450 Ga0501080_0001450_10985_12217 402
291 3300049742 Ga0501080_0034607 Ga0501080_0034607_3037_4269 402
292 3300049822 Ga0501035_0000690 Ga0501035_0000690_25864_27096 402
293 3300049822 Ga0501035_0001914 Ga0501035_0001914_1784_3016 402
294 3300049823 Ga0501044_0002922 Ga0501044_0002922_11058_12290 402
295 3300049823 Ga0501044_0029463 Ga0501044_0029463_725_1957 402
296 3300050489 nmdc:mga03683_16566_c1 nmdc:mga03683_16566_c1_147_1487 402
297 3300050492 nmdc:mga0yw44_30506_c1 nmdc:mga0yw44_30506_c1_1601_2851 402
298 3300053139 Ga0500568_0000059 Ga0500568_0000059_81488_82696 402
299 3300053155 Ga0500620_000560 Ga0500620_000560_3081_4289 402
300 iso_pu_bacteria 2924762789 2924768794 402
301 iso_pu_bacteria 2987666974 2987670472 402
302 3300002705 JGI25156J39149_1007325 JGI25156J39149_10073253 403
303 3300002741 JGI25157J39369_1000963 JGI25157J39369_10009634 403
304 3300003214 JGI25165J46597_1000033 JGI25165J46597_1000033119 403
305 3300003762 Ga0055542_1000654 Ga0055542_100065420 403
306 3300005455 Ga0070663_100018318 Ga0070663_1000183183 403
307 3300005459 Ga0068867_100017373 Ga0068867_1000173734 403
308 3300005548 Ga0070665_100053323 Ga0070665_1000533232 403
309 3300005614 Ga0068856_100072923 Ga0068856_1000729231 403
310 3300005983 Ga0081540_1036306 Ga0081540_10363062 403
311 3300005985 Ga0081539_10001774 Ga0081539_100017744 403
312 3300009093 Ga0105240_10104497 Ga0105240_101044972 403
313 3300009093 Ga0105240_10211276 Ga0105240_102112762 403
314 3300009148 Ga0105243_10015480 Ga0105243_100154802 403
315 3300009545 Ga0105237_10005996 Ga0105237_100059969 403
316 3300009551 Ga0105238_10017009 Ga0105238_100170095 403
317 3300009551 Ga0105238_10123688 Ga0105238_101236882 403
318 3300009551 Ga0105238_10193126 Ga0105238_101931262 403
319 3300010375 Ga0105239_10020786 Ga0105239_100207865 403
320 3300010375 Ga0105239_10185651 Ga0105239_101856513 403
321 3300013105 Ga0157369_10198323 Ga0157369_101983232 403
322 3300021320 Ga0214544_1001054 Ga0214544_100105455 403
323 3300025250 Ga0209026_1000002 Ga0209026_1000002646 403
324 3300025254 Ga0209148_1000072 Ga0209148_100007251 403
325 3300025256 Ga0209759_1000146 Ga0209759_1000146104 403
326 3300025261 Ga0209233_1000027 Ga0209233_1000027545 403
327 3300025261 Ga0209233_1004165 Ga0209233_10041654 403
328 3300025272 Ga0209455_1000153 Ga0209455_100015378 403
329 3300025297 Ga0209758_1003327 Ga0209758_10033279 403
330 3300025924 Ga0207694_10009648 Ga0207694_100096485 403
331 3300025935 Ga0207709_10028383 Ga0207709_100283833 403
332 3300026067 Ga0207678_10066746 Ga0207678_100667462 403
333 3300026089 Ga0207648_10017341 Ga0207648_100173415 403
334 3300026116 Ga0207674_10272267 Ga0207674_102722672 403
335 3300031911 Ga0307412_10111438 Ga0307412_101114382 403
336 3300037418 Ga0395900_0043223 Ga0395900_0043223_804_2015 403
337 3300037466 Ga0395898_0378901 Ga0395898_0378901_53_1264 403
338 3300037471 Ga0395905_0229186 Ga0395905_0229186_234_1445 403
339 3300038443 Ga0395901_0024161 Ga0395901_0024161_4096_5382 403
340 3300038443 Ga0395901_0068114 Ga0395901_0068114_729_1940 403
341 3300044658 Ga0466972_0012545 Ga0466972_0012545_838_2049 403
342 3300044901 Ga0466960_0025967 Ga0466960_0025967_380_1666 403
343 3300046460 Ga0495638_0067917 Ga0495638_0067917_702_1964 403
344 3300048088 Ga0495602_0164742 Ga0495602_0164742_310_1521 403
345 3300048915 Ga0496112_0131863 Ga0496112_0131863_1039_2253 403
346 3300048918 Ga0496115_0241409 Ga0496115_0241409_222_1436 403
347 3300048922 Ga0496119_0057905 Ga0496119_0057905_273_1484 403
348 3300048923 Ga0496120_0000589 Ga0496120_0000589_45674_46885 403
349 3300048923 Ga0496120_0019188 Ga0496120_0019188_641_1855 403
350 3300048924 Ga0496121_0212987 Ga0496121_0212987_12_1298 403
351 3300048928 Ga0496125_0092854 Ga0496125_0092854_35_1246 403
352 3300049586 Ga0501070_0093008 Ga0501070_0093008_288_1541 403
353 3300050491 nmdc:mga00v17_19146_c1 nmdc:mga00v17_19146_c1_2648_3874 403
354 iso_pu_bacteria 2856342000 2856346194 403
355 iso_pu_bacteria 2888343758 2888347717 403
356 iso_pu_bacteria 2913295892 2913300579 403
357 iso_pu_bacteria 2920760137 2920765833 403
358 iso_pu_bacteria 2961127735 2961128074 403
359 iso_pu_bacteria 2977971508 2977976504 403
360 iso_pu_bacteria 8004633249 8004636230 403

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01494

FAD_binding_3

FAD binding domain

50

383

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ado-assembly1.cif.gz_A crystal structure of the rabbit l-gulonate 3-dehydrogenase 0.9844 8 35
7o1k-assembly1.cif.gz_B structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme alpha-e141a, beta-c92a mutant 0.9728 6 35
4b3h-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis fatty acid beta- oxidation complex 0.9726 6 35
4b3j-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis fatty acid beta- oxidation complex with coenzymea bound at the hydratase and thiolase active sites 0.9701 6 35
2vq3-assembly1.cif.gz_B crystal structure of the membrane proximal oxidoreductase domain of human steap3, the dominant ferric reductase of the erythroid transferrin cycle 0.9691 8 36
ID Description Score Start End Superfamily
4b3jB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9991 7 35 3.40.50.720
af_Q2FYG1_1_188_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9734 7 36 3.40.50.720
af_Q5U1B0_1_189_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9698 6 35 3.40.50.720
2vq3B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9691 8 36 3.40.50.720
4k22B02 Alpha Beta;2-Layer Sandwich;D-Amino Acid Oxidase; Chain A, domain 2;D-Amino Acid Oxidase, subunit A, domain 2 0.9671 184 267 3.30.9.10
ID Description Score Start End GO Terms
AF-A0A502RCZ4-F1-model_v4 deleted 0.987 1 403
AF-A0A532EAB8-F1-model_v4 UbiH/UbiF family hydroxylase 0.9803 58 403 GO:0004497
GO:0006744
GO:0016705
GO:0071949
AF-A0A532EAB8-F1-model_v4 UbiH/UbiF family hydroxylase 0.9775 58 403 GO:0004497
GO:0006744
GO:0016705
GO:0071949
AF-A0A533J1C5-F1-model_v4 deleted 0.967 79 387
AF-A0A537UCI0-F1-model_v4 UbiH/UbiF family hydroxylase 0.966 6 312 GO:0004497
GO:0006744
GO:0016705
GO:0071949

Feature Viewer

pLDDT pTM Quality
83.1 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map