F422005

General Info

Members Datasets Scaffolds Average Seq Length
360 270 720 254

Family's Representative Sequence

Representative Sequence 3300049572|Ga0501036_0016280|Ga0501036_0016280_4849_5769
Length 306
Sequence MGETIFGMWRANAGQAVGMNGGRASLCPPCAHYHTIRILAAASIPSWCGEAIVPNEDRSPRLAVLIDADNASAKIADGLFEEIAKIGEASVRRIYGDFSNPRSKAWTDTLSKHAIIPQQQFAYTTGKNASDITLVIDAMDLLHSGRFDGFCLVSSDSDFTRLAARIREQGVDVFGFGEQKTPESFRQACRRFVYTENLLSGVANSHDDVSSRKSLQPPSAAVPIVKKVIAQIESEDGWVPLGQVGTQLANLTSDFDPRNFGFRKLSDLIRKTSAFDIEHRPGQAMRIRVKAAAPLRPRADKKPERQ

Samples

Sample ID Description Type Environment
1 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
56 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
63 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
72 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
73 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
74 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
75 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
76 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
79 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
81 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
83 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
86 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
109 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
110 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
111 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
118 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
119 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
120 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
121 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
122 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
123 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
124 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
125 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
126 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
127 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
128 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
129 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
132 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
133 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
134 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
135 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
136 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
151 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
152 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
153 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
154 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
155 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
156 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
157 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
158 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
159 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
163 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
164 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
165 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
166 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
167 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
168 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
169 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
170 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
171 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
172 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
173 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
174 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
175 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
176 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
177 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
178 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
179 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
180 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
181 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
182 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
183 2643221607 Rhizobium sp. Root73 Isolate Unclassified
184 2643221610 Ensifer sp. Root74 Isolate Unclassified
185 2643221675 Ensifer sp. Root1298 Isolate Unclassified
186 2643221680 Ensifer sp. Root1312 Isolate Unclassified
187 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
188 2643221726 Ensifer sp. Root954 Isolate Unclassified
189 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
190 2718217882 Rhizobium sp. N741 Isolate Nodule
191 2718218009 Rhizobium sp. N561 Isolate Nodule
192 2718218363 Rhizobium sp. N113 Isolate Nodule
193 2718218365 Rhizobium sp. N731 Isolate Nodule
194 2718218366 Rhizobium sp. N621 Isolate Nodule
195 2721755514 Rhizobium sp. N6212 Isolate Nodule
196 2721755810 Rhizobium sp. N871 Isolate Nodule
197 2728369365 Rhizobium sp. N1341 Isolate Nodule
198 2728369397 Rhizobium sp. N1314 Isolate Nodule
199 2791355263 Rhizobium chutanense C5 Isolate Nodule
200 2791355264 Rhizobium sp. S9 Isolate Nodule
201 2791355266 Rhizobium sp. L43 Isolate Nodule
202 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
203 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
204 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
205 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
206 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
207 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
208 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
209 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
210 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
211 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
212 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
213 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
214 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
215 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
216 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
217 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
218 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
219 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
220 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
221 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
222 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
223 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
224 2904699407
225 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
226 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
227 2906610324
228 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
229 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
230 2922425934
231 2936381700 Rhizobium chutanense C16 Isolate Unclassified
232 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
233 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
234 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
235 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
236 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
237 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
238 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
239 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
240 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
241 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
242 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
243 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
244 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
245 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
246 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
247 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
248 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
249 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
250 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
251 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
252 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
253 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
254 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
255 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
256 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
257 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
258 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
259 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
260 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
261 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
262 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
263 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
264 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
265 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
266 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
267 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
268 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
269 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
270 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 72.27
Metatranscriptomes 0
Isolates 27.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.72
Nodule 21.39
Rhizoplane 1.94
Rhizosphere 52.78
Stem 0
Stem Tuber 0
Unclassified 0.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501036_0016280 3300049572 Bacteria 6211
2 JGI25159J45721_1000175 3300002987 Bacteria 29637
3 JGI25151J46595_10000373 3300003187 Bacteria 46885
4 JGI25151J46595_10001163 3300003187 Bacteria 18979
5 JGI25165J46597_1000041 3300003214 Bacteria 272566
6 JGI25153J46596_10003023 3300003215 Bacteria 9516
7 JGI25160J50197_1000365 3300003354 Bacteria 29637
8 JGI25160J50197_1039406 3300003354 Bacteria 1106
9 JGI25161J50226_1000280 3300003374 Bacteria 29331
10 Ga0055526_1001092 3300003771 Bacteria 19774
11 Ga0055526_1009369 3300003771 Bacteria 4720
12 Ga0055526_1013021 3300003771 Bacteria 3560
13 Ga0055524_1008274 3300003775 Bacteria 4333
14 Ga0055524_1022021 3300003775 Bacteria 2094
15 Ga0055536_1009544 3300003781 Bacteria 3993
16 Ga0055528_1000638 3300003790 Bacteria 25688
17 Ga0055528_1005587 3300003790 Bacteria 5819
18 Ga0055530_10021428 3300003791 Bacteria 1905
19 Ga0055531_10011368 3300003794 Bacteria 4303
20 Ga0055543_1000372 3300004625 Bacteria 29554
21 Ga0065165_1001221 3300005262 Bacteria 29554
22 Ga0070670_100366761 3300005331 Bacteria 1267
23 Ga0068869_100056720 3300005334 Bacteria 2857
24 Ga0070680_100076235 3300005336 Bacteria 2760
25 Ga0068868_100373557 3300005338 Bacteria 1225
26 Ga0070660_100173860 3300005339 Bacteria 1741
27 Ga0070661_100006990 3300005344 Bacteria 7789
28 Ga0070661_100085961 3300005344 Bacteria 2325
29 Ga0070668_100120499 3300005347 Bacteria 2096
30 Ga0070668_100147561 3300005347 Bacteria 1899
31 Ga0070669_100258573 3300005353 Bacteria 1389
32 Ga0070671_100056896 3300005355 Bacteria 3254
33 Ga0070663_100138787 3300005455 Bacteria 1853
34 Ga0070681_10025743 3300005458 Bacteria 5915
35 Ga0070698_100460374 3300005471 Bacteria 1208
36 Ga0070679_100058603 3300005530 Bacteria 3837
37 Ga0070679_100191857 3300005530 Bacteria 2012
38 Ga0070697_100145997 3300005536 Bacteria 1991
39 Ga0068853_100003239 3300005539 Bacteria 12442
40 Ga0068853_100030185 3300005539 Bacteria 4578
41 Ga0068853_100155546 3300005539 Bacteria 2060
42 Ga0070665_100351507 3300005548 Bacteria 1479
43 Ga0068855_100492197 3300005563 Bacteria 1334
44 Ga0068857_100011976 3300005577 Bacteria 7544
45 Ga0068854_100358906 3300005578 Bacteria 1195
46 Ga0068856_100143004 3300005614 Bacteria 2399
47 Ga0068852_100293557 3300005616 Bacteria 1571
48 Ga0068851_10046841 3300005834 Bacteria 2188
49 Ga0068863_100003503 3300005841 Bacteria 15483
50 Ga0068860_100001008 3300005843 Bacteria 31179
51 Ga0068862_100000163 3300005844 Bacteria 74506
52 Ga0081455_10049130 3300005937 Bacteria 3639
53 Ga0081540_1006315 3300005983 Bacteria 8664
54 Ga0081539_10001801 3300005985 Bacteria 33917
55 Ga0075365_10001463 3300006038 Bacteria 10723
56 Ga0075368_10000287 3300006042 Bacteria 14467
57 Ga0075363_100000904 3300006048 Bacteria 10461
58 Ga0075364_10011297 3300006051 Bacteria 5423
59 Ga0075364_10197761 3300006051 Bacteria 1362
60 Ga0075362_10001875 3300006177 Bacteria 6889
61 Ga0075367_10000871 3300006178 Bacteria 12080
62 Ga0075369_10002398 3300006186 Bacteria 6681
63 Ga0097621_100602994 3300006237 Bacteria 1004
64 Ga0068871_100700658 3300006358 Bacteria 928
65 Ga0075434_100122890 3300006871 Bacteria 2612
66 Ga0097620_100179476 3300006931 Bacteria 2200
67 Ga0105251_10031302 3300009011 Bacteria 2663
68 Ga0105250_10040418 3300009092 Bacteria 1871
69 Ga0105240_10011604 3300009093 Bacteria 12258
70 Ga0105240_10587441 3300009093 Bacteria 1228
71 Ga0111539_10480277 3300009094 Bacteria 1447
72 Ga0105247_10020612 3300009101 Bacteria 3963
73 Ga0105247_10243393 3300009101 Bacteria 1226
74 Ga0105238_10020477 3300009551 Bacteria 6734
75 Ga0105238_10052222 3300009551 Bacteria 4110
76 Ga0105249_10000067 3300009553 Bacteria 149492
77 Ga0105249_10211897 3300009553 Bacteria 1902
78 Ga0105148_100139 3300009978 Bacteria 10762
79 Ga0099796_10102566 3300010159 Bacteria 1078
80 Ga0105239_10003590 3300010375 Bacteria 18946
81 Ga0105239_10037776 3300010375 Bacteria 5292
82 Ga0105239_10045181 3300010375 Bacteria 4827
83 Ga0157370_10203875 3300013104 Bacteria 1834
84 Ga0157369_10010432 3300013105 Bacteria 10587
85 Ga0157378_10559866 3300013297 Bacteria 1150
86 Ga0163162_10169418 3300013306 Bacteria 2308
87 Ga0163162_10472758 3300013306 Bacteria 1385
88 Ga0157380_10465176 3300014326 Bacteria 1219
89 Ga0182008_10128163 3300014497 Bacteria 1264
90 Ga0209436_100259 3300025208 Bacteria 24235
91 Ga0209437_108954 3300025233 Unclassified 1580
92 Ga0207425_1003523 3300025245 Bacteria 4978
93 Ga0209129_1004554 3300025258 Bacteria 5348
94 Ga0209233_1000104 3300025261 Bacteria 272675
95 Ga0209455_1001350 3300025272 Bacteria 11283
96 Ga0209673_1000022 3300025273 Bacteria 413125
97 Ga0209130_1000598 3300025284 Bacteria 34961
98 Ga0209676_1005905 3300025292 Bacteria 6214
99 Ga0209025_1000969 3300025294 Bacteria 43045
100 Ga0209025_1002488 3300025294 Bacteria 19372
101 Ga0209564_1000163 3300025295 Bacteria 162077
102 Ga0209564_1000692 3300025295 Bacteria 49341
103 Ga0209758_1002375 3300025297 Bacteria 19372
104 Ga0209050_1006124 3300025298 Bacteria 7256
105 Ga0209256_1001225 3300025299 Bacteria 28613
106 Ga0209256_1001398 3300025299 Bacteria 25156
107 Ga0207426_1000779 3300025302 Bacteria 34961
108 Ga0207656_10040155 3300025321 Bacteria 1983
109 Ga0207710_10012667 3300025900 Bacteria 3548
110 Ga0207710_10092693 3300025900 Bacteria 1416
111 Ga0207684_10085628 3300025910 Bacteria 2684
112 Ga0207654_10077086 3300025911 Bacteria 1997
113 Ga0207707_10087741 3300025912 Bacteria 2718
114 Ga0207695_10186869 3300025913 Bacteria 1991
115 Ga0207657_10142946 3300025919 Bacteria 1954
116 Ga0207694_10099842 3300025924 Bacteria 2299
117 Ga0207679_10213491 3300025945 Bacteria 1620
118 Ga0207667_10307309 3300025949 Bacteria 1620
119 Ga0207667_10392594 3300025949 Bacteria 1413
120 Ga0207712_10000054 3300025961 Bacteria 148878
121 Ga0207712_10009711 3300025961 Bacteria 6098
122 Ga0207668_10127424 3300025972 Bacteria 1938
123 Ga0207640_10273330 3300025981 Bacteria 1323
124 Ga0207639_10011470 3300026041 Bacteria 6157
125 Ga0207678_10100384 3300026067 Bacteria 2472
126 Ga0207641_10008688 3300026088 Bacteria 8388
127 Ga0207674_10007240 3300026116 Bacteria 12947
128 Ga0207698_10291189 3300026142 Bacteria 1515
129 Ga0209813_10000027 3300027866 Bacteria 69637
130 Ga0268266_10307920 3300028379 Bacteria 1479
131 Ga0268265_10000182 3300028380 Bacteria 74651
132 Ga0268264_10003017 3300028381 Bacteria 14599
133 Ga0268264_10750260 3300028381 Bacteria 972
134 Ga0307515_10355730 3300028794 Bacteria 1108
135 Ga0307509_10172726 3300031507 Bacteria 2038
136 Ga0307508_10000090 3300031616 Bacteria 106893
137 Ga0307508_10265721 3300031616 Bacteria 1310
138 Ga0373955_0062225 3300035172 Bacteria 2064
139 Ga0373925_0165807 3300037068 Bacteria 1742
140 Ga0395900_0010066 3300037418 Bacteria 9672
141 Ga0395898_0371066 3300037466 Bacteria 1365
142 Ga0395905_0346203 3300037471 Bacteria 1378
143 Ga0395901_0046355 3300038443 Bacteria 4515
144 Ga0395901_0079329 3300038443 Bacteria 3428
145 Ga0436360_0803520 3300039438 Bacteria 1160
146 Ga0436360_0860069 3300039438 Bacteria 1339
147 Ga0436360_1211757 3300039438 Bacteria 1086
148 Ga0451791_1426729 3300041451 Bacteria 987
149 Ga0439448_0102717 3300042005 Bacteria 973
150 Ga0439435_0000469 3300042436 Bacteria 6391
151 Ga0495592_0217058 3300046454 Bacteria 1281
152 Ga0495629_0199232 3300046459 Bacteria 1385
153 Ga0495629_0245793 3300046459 Bacteria 1232
154 Ga0495638_0009959 3300046460 Bacteria 6627
155 Ga0495638_0060940 3300046460 Bacteria 2332
156 Ga0495639_0221740 3300046475 Bacteria 930
157 Ga0495648_0114698 3300046524 Bacteria 1459
158 Ga0495668_0075078 3300046616 Bacteria 1857
159 Ga0496102_0563229 3300048905 Bacteria 1062
160 Ga0496103_0109638 3300048906 Bacteria 1753
161 Ga0496107_0034512 3300048910 Bacteria 3624
162 Ga0496109_0100483 3300048912 Bacteria 2684
163 Ga0496113_0549743 3300048916 Bacteria 926
164 Ga0496121_0165241 3300048924 Bacteria 1614
165 Ga0496121_0235864 3300048924 Bacteria 1278
166 Ga0496124_0319439 3300048927 Bacteria 1112
167 Ga0496125_0086478 3300048928 Bacteria 2371
168 Ga0496126_0019907 3300048929 Bacteria 6597
169 Ga0496126_0390011 3300048929 Bacteria 1132
170 Ga0501031_0000036 3300049568 Bacteria 73760
171 Ga0501031_0000068 3300049568 Bacteria 56283
172 Ga0501031_0023006 3300049568 Bacteria 4064
173 Ga0501032_0000100 3300049569 Bacteria 73505
174 Ga0501032_0000103 3300049569 Bacteria 72143
175 Ga0501032_0004376 3300049569 Bacteria 10655
176 Ga0501032_0095544 3300049569 Bacteria 1970
177 Ga0501032_0308402 3300049569 Bacteria 1022
178 Ga0501033_0000088 3300049570 Bacteria 87638
179 Ga0501033_0000778 3300049570 Bacteria 29323
180 Ga0501033_0003728 3300049570 Bacteria 12395
181 Ga0501033_0009764 3300049570 Bacteria 7372
182 Ga0501033_0075297 3300049570 Bacteria 2477
183 Ga0501034_0000365 3300049571 Bacteria 77224
184 Ga0501034_0000397 3300049571 Bacteria 73511
185 Ga0501034_0004282 3300049571 Bacteria 15914
186 Ga0501034_0005317 3300049571 Bacteria 14111
187 Ga0501034_0039512 3300049571 Bacteria 4779
188 Ga0501034_0158801 3300049571 Bacteria 2233
189 Ga0501036_0000056 3300049572 Bacteria 73511
190 Ga0501036_0000058 3300049572 Bacteria 72516
191 Ga0501036_0000544 3300049572 Bacteria 27031
192 Ga0501036_0031967 3300049572 Bacteria 4447
193 Ga0501037_0000119 3300049573 Bacteria 73510
194 Ga0501037_0000157 3300049573 Bacteria 63800
195 Ga0501037_0007051 3300049573 Bacteria 8208
196 Ga0501037_0136455 3300049573 Bacteria 1757
197 Ga0501037_0218352 3300049573 Bacteria 1342
198 Ga0501038_0000091 3300049574 Bacteria 77224
199 Ga0501038_0000098 3300049574 Bacteria 73471
200 Ga0501038_0000837 3300049574 Bacteria 27392
201 Ga0501038_0001470 3300049574 Bacteria 21665
202 Ga0501038_0014937 3300049574 Bacteria 7070
203 Ga0501038_0080716 3300049574 Bacteria 2741
204 Ga0501039_0000013 3300049575 Bacteria 234418
205 Ga0501039_0000071 3300049575 Bacteria 77224
206 Ga0501039_0001124 3300049575 Bacteria 19671
207 Ga0501040_0197695 3300049576 Bacteria 1427
208 Ga0501041_0188180 3300049577 Bacteria 1293
209 Ga0501042_0039549 3300049578 Bacteria 3352
210 Ga0501043_0001191 3300049579 Bacteria 22880
211 Ga0501043_0001914 3300049579 Bacteria 17825
212 Ga0501043_0081327 3300049579 Bacteria 2545
213 Ga0501043_0223913 3300049579 Bacteria 1454
214 Ga0501046_0003472 3300049580 Bacteria 14468
215 Ga0501046_0039551 3300049580 Bacteria 3776
216 Ga0501046_0204670 3300049580 Bacteria 1467
217 Ga0501047_0000797 3300049581 Bacteria 32944
218 Ga0501047_0014437 3300049581 Bacteria 7511
219 Ga0501047_0030775 3300049581 Bacteria 5173
220 Ga0501047_0185821 3300049581 Bacteria 1943
221 Ga0501048_0000925 3300049582 Bacteria 21630
222 Ga0501048_0054840 3300049582 Bacteria 2831
223 Ga0501068_0039477 3300049584 Bacteria 2830
224 Ga0501070_0072704 3300049586 Bacteria 2846
225 Ga0501070_0093675 3300049586 Bacteria 2485
226 Ga0501070_0105549 3300049586 Bacteria 2329
227 Ga0501073_0042427 3300049589 Bacteria 3211
228 Ga0501073_0075193 3300049589 Bacteria 2351
229 Ga0501073_0408823 3300049589 Bacteria 938
230 Ga0501074_0006277 3300049590 Bacteria 8581
231 Ga0501076_0154681 3300049592 Bacteria 1866
232 Ga0501079_0111904 3300049741 Bacteria 2122
233 Ga0501080_0008286 3300049742 Bacteria 9417
234 Ga0501080_0013473 3300049742 Bacteria 7523
235 Ga0501081_0076013 3300049743 Bacteria 2345
236 Ga0501083_0106249 3300049744 Bacteria 1848
237 Ga0501083_0239318 3300049744 Bacteria 1182
238 Ga0501035_0000053 3300049822 Bacteria 142860
239 Ga0501035_0000503 3300049822 Bacteria 44064
240 Ga0501035_0005592 3300049822 Bacteria 11870
241 Ga0501035_0013016 3300049822 Bacteria 7677
242 Ga0501035_0013388 3300049822 Bacteria 7572
243 Ga0501035_0140082 3300049822 Bacteria 2103
244 Ga0501035_0163268 3300049822 Bacteria 1927
245 Ga0501035_0424938 3300049822 Bacteria 1103
246 Ga0501044_0000214 3300049823 Bacteria 73483
247 Ga0501044_0000225 3300049823 Bacteria 71586
248 Ga0501044_0023441 3300049823 Bacteria 6564
249 Ga0501044_0042224 3300049823 Bacteria 4744
250 nmdc:mga05p37_318786_c1 3300050507 Bacteria 1840
251 nmdc:mga0n895_25121_c1 3300050512 Bacteria 5625
252 nmdc:mga08x19_149348_c1 3300050514 Bacteria 1581
253 Ga0500562_060411 3300053108 Bacteria 1018
254 Ga0500559_0078423 3300053136 Bacteria 1498
255 Ga0500622_0027369 3300053156 Bacteria 3005
256 Ga0500636_0014831 3300053177 Bacteria 4587
257 Ga0500645_049412 3300053730 Bacteria 1230
258 Ga0500601_006494 3300053737 Bacteria 1288
259 2509142334 2508501127 Bacteria 7037543
260 2510844023 2510461069 Bacteria 5505000
261 2513856251 2513237137 Bacteria 9558895
262 2513912841 2513237144 Bacteria 7530820
263 2513918154 2513237145 Bacteria 8979722
264 2513924087 2513237146 Bacteria 7166346
265 2517891607 2517572143 Bacteria 9484767
266 2524460929 2524023209 Bacteria 6679728
267 2524538633 2524023228 Bacteria 10118060
268 2599416133 2599185170 Bacteria 7295545
269 2643775497 2643221551 Bacteria 3750538
270 2643793943 2643221555 Bacteria 3749717
271 2643839874 2643221564 Bacteria 4193379
272 2644047521 2643221607 Bacteria 6314006
273 2644070272 2643221610 Bacteria 7480339
274 2644421034 2643221675 Bacteria 7473456
275 2644454557 2643221680 Bacteria 7473610
276 2644480988 2643221686 Bacteria 6310811
277 2644692496 2643221726 Bacteria 7455827
278 2671118620 2667528175 Bacteria 7532676
279 2719183649 2718217882 Bacteria 6556348
280 2719728090 2718218009 Bacteria 6478651
281 2721144951 2718218363 Bacteria 6524337
282 2721155687 2718218365 Bacteria 6274507
283 2721167038 2718218366 Bacteria 6425255
284 2722838016 2721755514 Bacteria 6424414
285 2724042284 2721755810 Bacteria 6479005
286 2730161789 2728369365 Bacteria 6555560
287 2730300794 2728369397 Bacteria 6274511
288 2793340375 2791355263 Bacteria 6872478
289 2793346133 2791355264 Bacteria 6429314
290 2793358025 2791355266 Bacteria 7116587
291 2837681480 2837678835 Bacteria 5252418
292 2838024974 2838022645 Bacteria 6494267
293 2838036254 2838035591 Bacteria 7166484
294 2838048587 2838042994 Bacteria 6046894
295 2841737603 2841734538 Bacteria 6784580
296 2842202058 2842198810 Bacteria 6608673
297 2842298942 2842298080 Bacteria 6123127
298 2842342724 2842341865 Bacteria 7003929
299 2842359190 2842357229 Bacteria 6485165
300 2847691684 2847686936 Bacteria 6278406
301 2856315548 2856314179 Bacteria 6477897
302 2871481213 2871474448 Bacteria 6806570
303 2874108890 2874102143 Bacteria 6342645
304 2874126743 2874123672 Bacteria 7238285
305 2874143602 2874139085 Bacteria 7021506
306 2876375151 2876369609 Bacteria 6807521
307 2878037220 2878035449 Bacteria 6555736
308 2878790196 2878788777 Bacteria 6567085
309 2881155038 2881147464 Bacteria 7779814
310 2885313001 2885312484 Bacteria 6415165
311 2885332568 2885326080 Bacteria 7134805
312 2885341555 2885334103 Bacteria 7216818
313 2904704668
314 2906329447 2906328253 Bacteria 6585166
315 2906415685 2906414383 Bacteria 6580790
316 2906616780
317 2906640142 2906635258 Bacteria 8601019
318 2906667109 2906660503 Bacteria 8595048
319 2922431161
320 2936385517 2936381700 Bacteria 7006523
321 2937840162 2937836603 Bacteria 6811263
322 2937895790 2937891427 Bacteria 6357007
323 2937994845 2937994558 Bacteria 7036190
324 2941510901 2941507105 Bacteria 8166816
325 2941518285 2941515067 Bacteria 8166720
326 2941526844 2941523033 Bacteria 8169134
327 2958072779 2958071322 Bacteria 6815895
328 2958122067 2958115193 Bacteria 6923548
329 2958165325 2958165035 Bacteria 6906348
330 2961163783 2961163497 Bacteria 6901077
331 2961176952 2961170736 Bacteria 7072258
332 2965018588 2965018300 Bacteria 6883036
333 2968102907 2968097103 Bacteria 6107094
334 2968118305 2968117919 Bacteria 6536078
335 2968131054 2968128360 Bacteria 6270294
336 2968132344 2968128360 Bacteria 6270294
337 2968172189 2968171901 Bacteria 6894245
338 2970509625 2970503327 Bacteria 7099517
339 2970555279 2970554993 Bacteria 6814252
340 2977861366 2977858184 Bacteria 6215359
341 2977865024 2977864932 Bacteria 7534097
342 2977944625 2977942078 Bacteria 7570577
343 2979780410 2979779861 Bacteria 6219781
344 2979814412 2979808191 Bacteria 7179355
345 2987638871 2987636660 Bacteria 8088555
346 2987659795 2987659509 Bacteria 6966464
347 3004188842 3004188549 Bacteria 6952365
348 3004204885 3004203850 Bacteria 7307914
349 3004268984 3004268573 Bacteria 7043476
350 3005480979 3005474847 Bacteria 9259049
351 8003575338 8003570095 Bacteria 5747666
352 8004448183 8004445564 Bacteria 6322258
353 8004633893 8004633249 Bacteria 6723080
354 8004699806 8004695233 Bacteria 6731676
355 8004712930 8004703790 Bacteria 8006957
356 8006939733 8006933436 Bacteria 10410654
357 8006979483 8006973647 Bacteria 10679141
358 8019565630 8019555841 Bacteria 9642137
359 8019575726 8019565922 Bacteria 9639779
360 8045868466 8045864390 Bacteria 5043873
361 Ga0501036_0016280
362 JGI25159J45721_1000175
363 JGI25151J46595_10000373
364 JGI25151J46595_10001163
365 JGI25165J46597_1000041
366 JGI25153J46596_10003023
367 JGI25160J50197_1000365
368 JGI25160J50197_1039406
369 JGI25161J50226_1000280
370 Ga0055526_1001092
371 Ga0055526_1009369
372 Ga0055526_1013021
373 Ga0055524_1008274
374 Ga0055524_1022021
375 Ga0055536_1009544
376 Ga0055528_1000638
377 Ga0055528_1005587
378 Ga0055530_10021428
379 Ga0055531_10011368
380 Ga0055543_1000372
381 Ga0065165_1001221
382 Ga0070670_100366761
383 Ga0068869_100056720
384 Ga0070680_100076235
385 Ga0068868_100373557
386 Ga0070660_100173860
387 Ga0070661_100006990
388 Ga0070661_100085961
389 Ga0070668_100120499
390 Ga0070668_100147561
391 Ga0070669_100258573
392 Ga0070671_100056896
393 Ga0070663_100138787
394 Ga0070681_10025743
395 Ga0070698_100460374
396 Ga0070679_100058603
397 Ga0070679_100191857
398 Ga0070697_100145997
399 Ga0068853_100003239
400 Ga0068853_100030185
401 Ga0068853_100155546
402 Ga0070665_100351507
403 Ga0068855_100492197
404 Ga0068857_100011976
405 Ga0068854_100358906
406 Ga0068856_100143004
407 Ga0068852_100293557
408 Ga0068851_10046841
409 Ga0068863_100003503
410 Ga0068860_100001008
411 Ga0068862_100000163
412 Ga0081455_10049130
413 Ga0081540_1006315
414 Ga0081539_10001801
415 Ga0075365_10001463
416 Ga0075368_10000287
417 Ga0075363_100000904
418 Ga0075364_10011297
419 Ga0075364_10197761
420 Ga0075362_10001875
421 Ga0075367_10000871
422 Ga0075369_10002398
423 Ga0097621_100602994
424 Ga0068871_100700658
425 Ga0075434_100122890
426 Ga0097620_100179476
427 Ga0105251_10031302
428 Ga0105250_10040418
429 Ga0105240_10011604
430 Ga0105240_10587441
431 Ga0111539_10480277
432 Ga0105247_10020612
433 Ga0105247_10243393
434 Ga0105238_10020477
435 Ga0105238_10052222
436 Ga0105249_10000067
437 Ga0105249_10211897
438 Ga0105148_100139
439 Ga0099796_10102566
440 Ga0105239_10003590
441 Ga0105239_10037776
442 Ga0105239_10045181
443 Ga0157370_10203875
444 Ga0157369_10010432
445 Ga0157378_10559866
446 Ga0163162_10169418
447 Ga0163162_10472758
448 Ga0157380_10465176
449 Ga0182008_10128163
450 Ga0209436_100259
451 Ga0209437_108954
452 Ga0207425_1003523
453 Ga0209129_1004554
454 Ga0209233_1000104
455 Ga0209455_1001350
456 Ga0209673_1000022
457 Ga0209130_1000598
458 Ga0209676_1005905
459 Ga0209025_1000969
460 Ga0209025_1002488
461 Ga0209564_1000163
462 Ga0209564_1000692
463 Ga0209758_1002375
464 Ga0209050_1006124
465 Ga0209256_1001225
466 Ga0209256_1001398
467 Ga0207426_1000779
468 Ga0207656_10040155
469 Ga0207710_10012667
470 Ga0207710_10092693
471 Ga0207684_10085628
472 Ga0207654_10077086
473 Ga0207707_10087741
474 Ga0207695_10186869
475 Ga0207657_10142946
476 Ga0207694_10099842
477 Ga0207679_10213491
478 Ga0207667_10307309
479 Ga0207667_10392594
480 Ga0207712_10000054
481 Ga0207712_10009711
482 Ga0207668_10127424
483 Ga0207640_10273330
484 Ga0207639_10011470
485 Ga0207678_10100384
486 Ga0207641_10008688
487 Ga0207674_10007240
488 Ga0207698_10291189
489 Ga0209813_10000027
490 Ga0268266_10307920
491 Ga0268265_10000182
492 Ga0268264_10003017
493 Ga0268264_10750260
494 Ga0307515_10355730
495 Ga0307509_10172726
496 Ga0307508_10000090
497 Ga0307508_10265721
498 Ga0373955_0062225
499 Ga0373925_0165807
500 Ga0395900_0010066
501 Ga0395898_0371066
502 Ga0395905_0346203
503 Ga0395901_0046355
504 Ga0395901_0079329
505 Ga0436360_0803520
506 Ga0436360_0860069
507 Ga0436360_1211757
508 Ga0451791_1426729
509 Ga0439448_0102717
510 Ga0439435_0000469
511 Ga0495592_0217058
512 Ga0495629_0199232
513 Ga0495629_0245793
514 Ga0495638_0009959
515 Ga0495638_0060940
516 Ga0495639_0221740
517 Ga0495648_0114698
518 Ga0495668_0075078
519 Ga0496102_0563229
520 Ga0496103_0109638
521 Ga0496107_0034512
522 Ga0496109_0100483
523 Ga0496113_0549743
524 Ga0496121_0165241
525 Ga0496121_0235864
526 Ga0496124_0319439
527 Ga0496125_0086478
528 Ga0496126_0019907
529 Ga0496126_0390011
530 Ga0501031_0000036
531 Ga0501031_0000068
532 Ga0501031_0023006
533 Ga0501032_0000100
534 Ga0501032_0000103
535 Ga0501032_0004376
536 Ga0501032_0095544
537 Ga0501032_0308402
538 Ga0501033_0000088
539 Ga0501033_0000778
540 Ga0501033_0003728
541 Ga0501033_0009764
542 Ga0501033_0075297
543 Ga0501034_0000365
544 Ga0501034_0000397
545 Ga0501034_0004282
546 Ga0501034_0005317
547 Ga0501034_0039512
548 Ga0501034_0158801
549 Ga0501036_0000056
550 Ga0501036_0000058
551 Ga0501036_0000544
552 Ga0501036_0031967
553 Ga0501037_0000119
554 Ga0501037_0000157
555 Ga0501037_0007051
556 Ga0501037_0136455
557 Ga0501037_0218352
558 Ga0501038_0000091
559 Ga0501038_0000098
560 Ga0501038_0000837
561 Ga0501038_0001470
562 Ga0501038_0014937
563 Ga0501038_0080716
564 Ga0501039_0000013
565 Ga0501039_0000071
566 Ga0501039_0001124
567 Ga0501040_0197695
568 Ga0501041_0188180
569 Ga0501042_0039549
570 Ga0501043_0001191
571 Ga0501043_0001914
572 Ga0501043_0081327
573 Ga0501043_0223913
574 Ga0501046_0003472
575 Ga0501046_0039551
576 Ga0501046_0204670
577 Ga0501047_0000797
578 Ga0501047_0014437
579 Ga0501047_0030775
580 Ga0501047_0185821
581 Ga0501048_0000925
582 Ga0501048_0054840
583 Ga0501068_0039477
584 Ga0501070_0072704
585 Ga0501070_0093675
586 Ga0501070_0105549
587 Ga0501073_0042427
588 Ga0501073_0075193
589 Ga0501073_0408823
590 Ga0501074_0006277
591 Ga0501076_0154681
592 Ga0501079_0111904
593 Ga0501080_0008286
594 Ga0501080_0013473
595 Ga0501081_0076013
596 Ga0501083_0106249
597 Ga0501083_0239318
598 Ga0501035_0000053
599 Ga0501035_0000503
600 Ga0501035_0005592
601 Ga0501035_0013016
602 Ga0501035_0013388
603 Ga0501035_0140082
604 Ga0501035_0163268
605 Ga0501035_0424938
606 Ga0501044_0000214
607 Ga0501044_0000225
608 Ga0501044_0023441
609 Ga0501044_0042224
610 nmdc:mga05p37_318786_c1
611 nmdc:mga0n895_25121_c1
612 nmdc:mga08x19_149348_c1
613 Ga0500562_060411
614 Ga0500559_0078423
615 Ga0500622_0027369
616 Ga0500636_0014831
617 Ga0500645_049412
618 Ga0500601_006494
619 2509142334
620 2510844023
621 2513856251
622 2513912841
623 2513918154
624 2513924087
625 2517891607
626 2524460929
627 2524538633
628 2599416133
629 2643775497
630 2643793943
631 2643839874
632 2644047521
633 2644070272
634 2644421034
635 2644454557
636 2644480988
637 2644692496
638 2671118620
639 2719183649
640 2719728090
641 2721144951
642 2721155687
643 2721167038
644 2722838016
645 2724042284
646 2730161789
647 2730300794
648 2793340375
649 2793346133
650 2793358025
651 2837681480
652 2838024974
653 2838036254
654 2838048587
655 2841737603
656 2842202058
657 2842298942
658 2842342724
659 2842359190
660 2847691684
661 2856315548
662 2871481213
663 2874108890
664 2874126743
665 2874143602
666 2876375151
667 2878037220
668 2878790196
669 2881155038
670 2885313001
671 2885332568
672 2885341555
673 2904704668
674 2906329447
675 2906415685
676 2906616780
677 2906640142
678 2906667109
679 2922431161
680 2936385517
681 2937840162
682 2937895790
683 2937994845
684 2941510901
685 2941518285
686 2941526844
687 2958072779
688 2958122067
689 2958165325
690 2961163783
691 2961176952
692 2965018588
693 2968102907
694 2968118305
695 2968131054
696 2968132344
697 2968172189
698 2970509625
699 2970555279
700 2977861366
701 2977865024
702 2977944625
703 2979780410
704 2979814412
705 2987638871
706 2987659795
707 3004188842
708 3004204885
709 3004268984
710 3005480979
711 8003575338
712 8004448183
713 8004633893
714 8004699806
715 8004712930
716 8006939733
717 8006979483
718 8019565630
719 8019575726
720 8045868466

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01936

NYN

NYN domain

61

199

0.96

PF12872

OST-HTH

OST-HTH/LOTUS domain

219

287

0.88

Map