F422280

General Info

Members Datasets Scaffolds Average Seq Length
361 249 722 332

Family's Representative Sequence

Representative Sequence 3300035119|Ga0373956_0000612|Ga0373956_0000612_3002_4066
Length 354
Sequence VGRTGVAGPAGGIVTGPGPIRHAAVLGAGSWGTAFAKVLADAGCDVRLWTRGWKVAEAISNTRENPGYLPGVRLPAGLRACTDVVEALDGAELVALAVPSQVLRENLGKWREALPVNACLLSLAKGVELGTLKRMSEVVAEVAGAGAERIAVLSGPNLAKEIAAEQPAATVVACADHEVAVRLQQACATAYFRPYTITDVIGCELGGACKNVIALACGMAAGLGFGGNTLASLVTRGLAETARLGVRLGADPMTFSGLAGLGDLVATCWSPLSRNRTFGERLGMGDTLEQAQQAARGQVAEGVKSCSSVRELALRSGVDMPITDAVYRVCHESLEPRAMAAELLTRDHKPERQA

Samples

Sample ID Description Type Environment
1 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
70 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
102 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
103 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
104 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
105 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
106 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
107 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
108 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
109 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
110 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
111 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
112 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
113 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
114 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
117 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
118 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
119 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
120 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
126 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
127 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
128 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
129 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
130 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
131 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
132 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
133 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
134 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
135 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
136 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
137 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
138 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
139 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
140 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
141 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
142 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
145 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
146 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
147 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
148 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
149 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
150 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
151 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
152 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
153 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
160 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
164 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
165 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
166 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
167 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
180 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
181 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
182 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
183 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
184 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
185 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
186 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
187 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
188 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
189 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
191 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
192 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
193 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
194 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
195 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
198 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
199 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
200 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
201 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
202 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
203 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
204 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
205 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
206 2506783011 Frankia datiscae Dg1 Isolate Nodule
207 2558860280 Kutzneria sp. 744 Isolate Unclassified
208 2582580736 Prauserella sp. Am3 Isolate Unclassified
209 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
210 2643221576 Nocardioides sp. Root614 Isolate Unclassified
211 2643221590 Nocardioides sp. Root682 Isolate Unclassified
212 2643221604 Nocardioides sp. Root190 Isolate Unclassified
213 2643221615 Nocardioides sp. Root224 Isolate Unclassified
214 2643221617 Nocardioides sp. Root79 Isolate Unclassified
215 2643221620 Nocardioides sp. Root240 Isolate Unclassified
216 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
217 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
218 2738541305 Nocardioides sp. CF167 Isolate Unclassified
219 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
220 2739367898 Nocardioides sp. CF479 Isolate Unclassified
221 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
222 2773857933 Frankia sp. BMG5.30 Isolate Nodule
223 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
224 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
225 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
226 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
227 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
228 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
229 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
230 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
231 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
232 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
233 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
234 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
235 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
236 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
237 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
238 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
239 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
240 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
241 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
242 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
243 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
244 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
245 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
246 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
247 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
248 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
249 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.53
Metatranscriptomes 0.28
Isolates 12.19

Biome Distribution

Category Percentage (%)
Aerial Root 0.28
Bulb 0
Endosphere 1.39
Nodule 0.55
Rhizoplane 5.26
Rhizosphere 79.22
Stem 0
Stem Tuber 0.28
Unclassified 0.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373956_0000612 3300035119 Bacteria 14647
2 JGI24735J21928_10026783 3300002067 Bacteria 1731
3 JGI25406J46586_10000620 3300003203 Bacteria 16621
4 rootL2_10193277 3300003322 Bacteria 2024
5 Ga0070658_10049405 3300005327 Bacteria 3407
6 Ga0070658_10072124 3300005327 Bacteria 2829
7 Ga0070658_10250984 3300005327 Bacteria 1501
8 Ga0070683_100145492 3300005329 Bacteria 2245
9 Ga0070683_100209809 3300005329 Bacteria 1850
10 Ga0068869_100101622 3300005334 Bacteria 2175
11 Ga0068868_100140586 3300005338 Bacteria 1981
12 Ga0070660_100001896 3300005339 Bacteria 14400
13 Ga0070689_100177262 3300005340 Bacteria 1730
14 Ga0070687_100077387 3300005343 Bacteria 1804
15 Ga0070668_100001456 3300005347 Bacteria 17104
16 Ga0070669_100079047 3300005353 Bacteria 2445
17 Ga0070688_100065099 3300005365 Bacteria 2316
18 Ga0070659_100008607 3300005366 Bacteria 7463
19 Ga0070659_100014707 3300005366 Bacteria 5852
20 Ga0070659_100150307 3300005366 Bacteria 1900
21 Ga0070667_100161802 3300005367 Bacteria 1972
22 Ga0070714_100100708 3300005435 Bacteria 2545
23 Ga0070713_100010695 3300005436 Bacteria 6641
24 Ga0070710_10000170 3300005437 Bacteria 30007
25 Ga0070711_100015568 3300005439 Bacteria 4814
26 Ga0070700_100000088 3300005441 Bacteria 61864
27 Ga0070663_100017834 3300005455 Bacteria 4641
28 Ga0070663_100345005 3300005455 Bacteria 1204
29 Ga0070678_100133936 3300005456 Bacteria 1973
30 Ga0070678_100288988 3300005456 Bacteria 1389
31 Ga0070662_100135213 3300005457 Bacteria 1905
32 Ga0070662_100442955 3300005457 Bacteria 1077
33 Ga0070685_10004093 3300005466 Bacteria 7366
34 Ga0070706_100157838 3300005467 Bacteria 2117
35 Ga0070707_100022170 3300005468 Bacteria 6004
36 Ga0070707_100194317 3300005468 Bacteria 1978
37 Ga0070699_100089759 3300005518 Bacteria 2686
38 Ga0070699_100176197 3300005518 Bacteria 1896
39 Ga0068853_100004749 3300005539 Bacteria 10561
40 Ga0070696_100149358 3300005546 Bacteria 1714
41 Ga0068855_100160947 3300005563 Bacteria 2548
42 Ga0068855_100270231 3300005563 Bacteria 1891
43 Ga0070664_100079740 3300005564 Bacteria 2819
44 Ga0070664_100114851 3300005564 Bacteria 2352
45 Ga0068854_100038832 3300005578 Bacteria 3350
46 Ga0068856_100037301 3300005614 Bacteria 4769
47 Ga0068852_100014744 3300005616 Bacteria 6032
48 Ga0068859_100491450 3300005617 Bacteria 1322
49 Ga0068861_100084863 3300005719 Bacteria 2486
50 Ga0068858_100311735 3300005842 Bacteria 1503
51 Ga0068862_100089267 3300005844 Bacteria 2683
52 Ga0081455_10000011 3300005937 Bacteria 203132
53 Ga0081455_10000856 3300005937 Bacteria 39231
54 Ga0081455_10001927 3300005937 Bacteria 24929
55 Ga0081455_10004893 3300005937 Bacteria 14843
56 Ga0081538_10056270 3300005981 Bacteria 2305
57 Ga0081539_10001153 3300005985 Bacteria 47882
58 Ga0070717_10183480 3300006028 Bacteria 1825
59 Ga0075364_10064504 3300006051 Bacteria 2404
60 Ga0070712_100045201 3300006175 Bacteria 3040
61 Ga0075428_100010252 3300006844 Bacteria 10404
62 Ga0075430_100001901 3300006846 Bacteria 17116
63 Ga0075431_100000515 3300006847 Bacteria 32391
64 Ga0075431_100004346 3300006847 Bacteria 13894
65 Ga0075431_100004364 3300006847 Bacteria 13882
66 Ga0075434_100236451 3300006871 Bacteria 1847
67 Ga0075429_100001113 3300006880 Bacteria 21672
68 Ga0075429_100004768 3300006880 Bacteria 11676
69 Ga0068865_100294996 3300006881 Bacteria 1295
70 Ga0097620_100491456 3300006931 Bacteria 1322
71 Ga0111539_10073712 3300009094 Bacteria 4024
72 Ga0111539_10370988 3300009094 Bacteria 1666
73 Ga0105245_10201533 3300009098 Bacteria 1911
74 Ga0105245_10541075 3300009098 Bacteria 1186
75 Ga0105247_10101903 3300009101 Bacteria 1836
76 Ga0114129_10001475 3300009147 Bacteria 31859
77 Ga0114129_10030468 3300009147 Bacteria 7634
78 Ga0105243_10034182 3300009148 Bacteria 3934
79 Ga0105243_10199170 3300009148 Bacteria 1755
80 Ga0105238_10081134 3300009551 Bacteria 3233
81 Ga0105238_10158322 3300009551 Bacteria 2240
82 Ga0105249_10306661 3300009553 Bacteria 1594
83 Ga0105239_10181986 3300010375 Bacteria 2351
84 Ga0163162_10028541 3300013306 Bacteria 5522
85 Ga0157372_10100350 3300013307 Bacteria 3303
86 Ga0157372_10198930 3300013307 Bacteria 2321
87 Ga0157372_10289022 3300013307 Bacteria 1907
88 Ga0157375_10145182 3300013308 Bacteria 2503
89 Ga0157380_10066382 3300014326 Bacteria 2901
90 Ga0182008_10059683 3300014497 Bacteria 1882
91 Ga0157379_10175690 3300014968 Bacteria 1934
92 Ga0157376_10058494 3300014969 Bacteria 3229
93 Ga0206353_10765213 3300020082 Bacteria 6079
94 Ga0213875_10001713 3300021388 Bacteria 13768
95 Ga0213875_10107669 3300021388 Bacteria 1301
96 Ga0207697_10039866 3300025315 Bacteria 1927
97 Ga0207692_10000293 3300025898 Bacteria 17337
98 Ga0207692_10198752 3300025898 Bacteria 1177
99 Ga0207710_10052843 3300025900 Bacteria 1827
100 Ga0207688_10021330 3300025901 Bacteria 3538
101 Ga0207647_10022502 3300025904 Bacteria 4184
102 Ga0207645_10072569 3300025907 Bacteria 2203
103 Ga0207705_10203088 3300025909 Bacteria 1502
104 Ga0207693_10019802 3300025915 Bacteria 5350
105 Ga0207663_10238847 3300025916 Bacteria 1332
106 Ga0207662_10186658 3300025918 Bacteria 1336
107 Ga0207657_10007437 3300025919 Bacteria 11235
108 Ga0207681_10077139 3300025923 Bacteria 2342
109 Ga0207694_10110760 3300025924 Bacteria 2184
110 Ga0207659_10321127 3300025926 Bacteria 1277
111 Ga0207700_10002007 3300025928 Bacteria 11610
112 Ga0207664_10036239 3300025929 Bacteria 3812
113 Ga0207664_10043105 3300025929 Bacteria 3527
114 Ga0207690_10034998 3300025932 Bacteria 3239
115 Ga0207690_10214072 3300025932 Bacteria 1471
116 Ga0207690_10217670 3300025932 Bacteria 1459
117 Ga0207690_10414403 3300025932 Bacteria 1077
118 Ga0207706_10038747 3300025933 Bacteria 4228
119 Ga0207706_10288761 3300025933 Bacteria 1430
120 Ga0207689_10046572 3300025942 Bacteria 3584
121 Ga0207679_10048130 3300025945 Bacteria 3102
122 Ga0207679_10175549 3300025945 Bacteria 1768
123 Ga0207668_10002772 3300025972 Bacteria 10249
124 Ga0207668_10370765 3300025972 Bacteria 1202
125 Ga0207658_10056428 3300025986 Bacteria 2915
126 Ga0207639_10119185 3300026041 Bacteria 2165
127 Ga0207678_10013082 3300026067 Bacteria 7281
128 Ga0207678_10019141 3300026067 Bacteria 6011
129 Ga0207678_10094117 3300026067 Bacteria 2560
130 Ga0207678_10388370 3300026067 Bacteria 1207
131 Ga0207708_10000110 3300026075 Bacteria 62957
132 Ga0207708_10240708 3300026075 Bacteria 1455
133 Ga0207708_10254703 3300026075 Bacteria 1415
134 Ga0207702_10042603 3300026078 Bacteria 3808
135 Ga0207702_10063678 3300026078 Bacteria 3154
136 Ga0207674_10032850 3300026116 Bacteria 5440
137 Ga0207675_100129089 3300026118 Bacteria 2396
138 Ga0207675_100351079 3300026118 Bacteria 1445
139 Ga0207698_10067955 3300026142 Bacteria 2812
140 Ga0207428_10035054 3300027907 Bacteria 4105
141 Ga0268264_10107943 3300028381 Bacteria 2432
142 Ga0268264_10581040 3300028381 Bacteria 1102
143 Ga0307515_10142433 3300028794 Bacteria 2562
144 Ga0307515_10165771 3300028794 Bacteria 2228
145 Ga0307511_10001109 3300030521 Bacteria 28721
146 Ga0307511_10086168 3300030521 Bacteria 2166
147 Ga0307512_10025285 3300030522 Bacteria 5265
148 Ga0316177_1074566 3300030731 Bacteria 6133
149 Ga0316176_1175502 3300030732 Bacteria 3782
150 Ga0316182_1279110 3300030745 Bacteria 4810
151 Ga0307513_10067115 3300031456 Bacteria 3766
152 Ga0307513_10298833 3300031456 Bacteria 1378
153 Ga0307405_10101187 3300031731 Bacteria 1933
154 Ga0307413_10000562 3300031824 Bacteria 12452
155 Ga0307413_10010784 3300031824 Bacteria 4455
156 Ga0307413_10359620 3300031824 Bacteria 1126
157 Ga0307413_10393857 3300031824 Bacteria 1083
158 Ga0307518_10002521 3300031838 Bacteria 13370
159 Ga0307406_10025796 3300031901 Bacteria 3522
160 Ga0307406_10050704 3300031901 Bacteria 2632
161 Ga0307407_10157376 3300031903 Bacteria 1483
162 Ga0307412_10202691 3300031911 Bacteria 1508
163 Ga0307409_100023956 3300031995 Bacteria 4244
164 Ga0307409_100096706 3300031995 Bacteria 2437
165 Ga0307416_100010101 3300032002 Bacteria 6219
166 Ga0307416_100284001 3300032002 Bacteria 1634
167 Ga0307414_10194431 3300032004 Bacteria 1644
168 Ga0307411_10033572 3300032005 Bacteria 3184
169 Ga0307415_100124463 3300032126 Bacteria 1940
170 Ga0307507_10023687 3300033179 Bacteria 6725
171 Ga0373925_0191681 3300037068 Bacteria 1622
172 Ga0395899_0009287 3300037312 Bacteria 7551
173 Ga0395900_0020407 3300037418 Bacteria 6765
174 Ga0395900_0365755 3300037418 Bacteria 1413
175 Ga0436364_0473109 3300037853 Bacteria 35842
176 Ga0436364_0674710 3300037853 Bacteria 5672
177 Ga0436364_0813769 3300037853 Bacteria 2496
178 Ga0436364_1485205 3300037853 Bacteria 11763
179 Ga0395901_0093104 3300038443 Bacteria 3155
180 Ga0439465_0042533 3300041413 Bacteria 1472
181 Ga0451837_0052201 3300041494 Bacteria 1290
182 Ga0439445_0020552 3300042004 Bacteria 1653
183 Ga0439449_0007924 3300042007 Bacteria 4034
184 Ga0466969_0008629 3300044656 Bacteria 5406
185 Ga0466969_0044020 3300044656 Bacteria 2223
186 Ga0466972_0002149 3300044658 Bacteria 9683
187 Ga0466972_0008011 3300044658 Bacteria 5295
188 Ga0466972_0022374 3300044658 Bacteria 3149
189 Ga0466965_0000195 3300044683 Bacteria 18846
190 Ga0466965_0003086 3300044683 Bacteria 7258
191 Ga0466965_0073928 3300044683 Bacteria 1717
192 Ga0466965_0096120 3300044683 Bacteria 1511
193 Ga0466966_0013861 3300044684 Bacteria 5335
194 Ga0466966_0014395 3300044684 Bacteria 5237
195 Ga0466966_0141169 3300044684 Bacteria 1472
196 Ga0466961_0047401 3300044693 Bacteria 2748
197 Ga0466961_0086551 3300044693 Bacteria 1980
198 Ga0466961_0173454 3300044693 Bacteria 1341
199 Ga0466963_0001665 3300044694 Bacteria 12105
200 Ga0466963_0134965 3300044694 Bacteria 1707
201 Ga0466963_0149617 3300044694 Bacteria 1621
202 Ga0466963_0268412 3300044694 Bacteria 1199
203 Ga0453684_0246671 3300044712 Bacteria 2053
204 Ga0466971_0076382 3300044719 Bacteria 1524
205 Ga0466971_0088615 3300044719 Bacteria 1416
206 Ga0466968_0002161 3300044735 Bacteria 7175
207 Ga0466968_0008849 3300044735 Bacteria 3863
208 Ga0466970_0004725 3300044765 Bacteria 6728
209 Ga0466970_0025412 3300044765 Bacteria 3100
210 Ga0466970_0046457 3300044765 Bacteria 2312
211 Ga0466970_0080802 3300044765 Bacteria 1757
212 Ga0466957_0070316 3300044842 Bacteria 2163
213 Ga0466960_0004045 3300044901 Bacteria 5696
214 Ga0466960_0011878 3300044901 Bacteria 3661
215 Ga0466960_0051380 3300044901 Bacteria 1991
216 Ga0466960_0124714 3300044901 Bacteria 1352
217 Ga0466960_0132670 3300044901 Bacteria 1316
218 Ga0466959_0002480 3300045049 Bacteria 11812
219 Ga0466959_0020369 3300045049 Bacteria 4887
220 Ga0466959_0166297 3300045049 Bacteria 1549
221 Ga0466958_0018859 3300045836 Bacteria 4009
222 Ga0466967_0003549 3300045976 Bacteria 10216
223 Ga0466967_0054528 3300045976 Bacteria 3519
224 Ga0466967_0089825 3300045976 Bacteria 2790
225 Ga0466967_0093188 3300045976 Bacteria 2740
226 Ga0466967_0146760 3300045976 Bacteria 2201
227 Ga0466967_0524726 3300045976 Bacteria 1164
228 Ga0495627_036419 3300046453 Bacteria 1529
229 Ga0495603_0061275 3300046455 Bacteria 2222
230 Ga0495641_0081996 3300046461 Bacteria 1444
231 Ga0495582_0094968 3300046473 Bacteria 1665
232 Ga0495594_0065951 3300046499 Bacteria 2008
233 Ga0495645_0085901 3300046543 Unclassified 2252
234 Ga0495669_0011515 3300046684 Bacteria 3756
235 Ga0495674_0009769 3300047319 Bacteria 9112
236 Ga0496100_0419882 3300048903 Bacteria 1021
237 Ga0496101_0092960 3300048904 Bacteria 2246
238 Ga0496101_0149581 3300048904 Bacteria 1785
239 Ga0496102_0026632 3300048905 Bacteria 5160
240 Ga0496103_0061386 3300048906 Bacteria 2337
241 Ga0496103_0112864 3300048906 Bacteria 1727
242 Ga0496103_0193554 3300048906 Bacteria 1307
243 Ga0496104_0110130 3300048907 Bacteria 2640
244 Ga0496104_0519103 3300048907 Bacteria 1102
245 Ga0496105_0178513 3300048908 Bacteria 1739
246 Ga0496106_0016388 3300048909 Bacteria 5483
247 Ga0496107_0120429 3300048910 Bacteria 1933
248 Ga0496108_0267161 3300048911 Bacteria 1489
249 Ga0496110_0346039 3300048913 Bacteria 1354
250 Ga0496112_0231072 3300048915 Bacteria 1804
251 Ga0496113_0074440 3300048916 Bacteria 2589
252 Ga0496114_0002789 3300048917 Bacteria 13370
253 Ga0496114_0035800 3300048917 Bacteria 4100
254 Ga0496114_0050480 3300048917 Bacteria 3463
255 Ga0496119_0000061 3300048922 Bacteria 171442
256 Ga0496120_0004587 3300048923 Bacteria 11503
257 Ga0501031_0002402 3300049568 Bacteria 11907
258 Ga0501031_0006622 3300049568 Bacteria 7558
259 Ga0501031_0023342 3300049568 Bacteria 4034
260 Ga0501031_0173006 3300049568 Bacteria 1411
261 Ga0501032_0201762 3300049569 Bacteria 1298
262 Ga0501033_0140462 3300049570 Bacteria 1746
263 Ga0501036_0016526 3300049572 Bacteria 6163
264 Ga0501036_0256582 3300049572 Bacteria 1465
265 Ga0501038_0003732 3300049574 Bacteria 14192
266 Ga0501038_0007971 3300049574 Bacteria 9757
267 Ga0501038_0160420 3300049574 Bacteria 1828
268 Ga0501039_0011200 3300049575 Bacteria 6834
269 Ga0501039_0249267 3300049575 Bacteria 1396
270 Ga0501040_0010955 3300049576 Bacteria 5930
271 Ga0501042_0000189 3300049578 Bacteria 28855
272 Ga0501042_0021945 3300049578 Bacteria 4456
273 Ga0501043_0009717 3300049579 Bacteria 7540
274 Ga0501046_0007188 3300049580 Bacteria 9794
275 Ga0501047_0017387 3300049581 Bacteria 6886
276 Ga0501048_0000611 3300049582 Bacteria 25411
277 Ga0501048_0008025 3300049582 Bacteria 7993
278 Ga0501067_0010132 3300049583 Bacteria 5213
279 Ga0501069_0023302 3300049585 Bacteria 3375
280 Ga0501070_0150382 3300049586 Bacteria 1921
281 Ga0501071_0006771 3300049587 Bacteria 7460
282 Ga0501071_0188820 3300049587 Bacteria 1545
283 Ga0501072_0013272 3300049588 Bacteria 6308
284 Ga0501075_0020571 3300049591 Bacteria 4803
285 Ga0501076_0032441 3300049592 Bacteria 4076
286 Ga0501079_0024925 3300049741 Bacteria 4589
287 Ga0501080_0055471 3300049742 Bacteria 3691
288 Ga0501081_0041080 3300049743 Bacteria 3167
289 Ga0501035_0019082 3300049822 Bacteria 6312
290 Ga0501035_0130195 3300049822 Bacteria 2194
291 Ga0501035_0189511 3300049822 Bacteria 1768
292 Ga0501045_0003098 3300049824 Bacteria 11367
293 Ga0501045_0115196 3300049824 Bacteria 1994
294 nmdc:mga07m45_23255_c1 3300050496 Bacteria 1474
295 nmdc:mga05p37_1192_c1 3300050507 Bacteria 30031
296 nmdc:mga05p37_238_c1 3300050507 Bacteria 56124
297 nmdc:mga05p37_266966_c1 3300050507 Bacteria 2046
298 nmdc:mga09592_222438_c1 3300050508 Bacteria 1635
299 nmdc:mga09592_555_c1 3300050508 Bacteria 28350
300 nmdc:mga09592_9836_c1 3300050508 Bacteria 7775
301 nmdc:mga0qj67_2354_c1 3300050509 Bacteria 13454
302 nmdc:mga0qj67_4038_c1 3300050509 Bacteria 10629
303 nmdc:mga06r32_1106_c1 3300050510 Bacteria 24182
304 nmdc:mga06r32_4598_c1 3300050510 Bacteria 12372
305 nmdc:mga06r32_8462_c1 3300050510 Bacteria 9271
306 nmdc:mga08y16_220873_c1 3300050511 Bacteria 1962
307 nmdc:mga08y16_9945_c1 3300050511 Bacteria 9984
308 nmdc:mga0n895_77322_c1 3300050512 Bacteria 3310
309 Ga0495655_0041950 3300053083 Bacteria 1172
310 Ga0500556_0001233 3300053104 Bacteria 11888
311 Ga0500593_000080 3300053117 Bacteria 35767
312 Ga0500577_0004532 3300053142 Bacteria 3680
313 Ga0501084_0029004 3300054114 Bacteria 4627
314 Ga0501084_0171759 3300054114 Bacteria 1830
315 Ga0590075_032616 3300059424 Bacteria 1322
316 Ga0501082_0035265 3300060353 Bacteria 4312
317 Ga0530510_0382527 3300061734 Bacteria 1059
318 2506868263 2506783011 Bacteria 5323186
319 2559429543 2558860280 Bacteria 11429938
320 2583150356 2582580736 Bacteria 5325865
321 2586059084 2585427649 Bacteria 9053857
322 2643893175 2643221576 Bacteria 5214352
323 2643961766 2643221590 Bacteria 5214697
324 2644034096 2643221604 Bacteria 5014917
325 2644089862 2643221615 Bacteria 5487866
326 2644102530 2643221617 Bacteria 5139111
327 2644118193 2643221620 Bacteria 5134593
328 2644319707 2643221657 Bacteria 5490246
329 2644537034 2643221697 Bacteria 3575694
330 2738871306 2738541305 Bacteria 4910150
331 2739203228 2738543005 Bacteria 5278128
332 2740166767 2739367898 Bacteria 4367674
333 2753070679 2751185734 Bacteria 8863695
334 2774902679 2773857933 Bacteria 5818019
335 2776374244 2775506925 Bacteria 7237746
336 2791910610 2791354901 Bacteria 8322202
337 2795794502 2795385472 Bacteria 6627535
338 2809592157 2808606522 Bacteria 9488490
339 2812333837 2811994874 Bacteria 5367947
340 2816427466 2816332119 Bacteria 8120218
341 2855387584 2855386786 Bacteria 4752232
342 2863070974 2863067949 Bacteria 8541735
343 2866552732 2866552031 Bacteria 5824618
344 2866616714 2866612099 Bacteria 7543886
345 2870726762 2870721527 Bacteria 9689237
346 2891327422 2891326441 Bacteria 6439512
347 2899365413 2899359706 Bacteria 10940472
348 2899375254 2899370129 Bacteria 6781179
349 2904770145 2904765812 Bacteria 5369154
350 2904771006 2904770941 Bacteria 5580202
351 2908815049 2908811453 Bacteria 5478616
352 2915773172 2915768154 Bacteria 8424322
353 2917743392 2917736166 Bacteria 9690793
354 2919424467 2919420072 Bacteria 5390363
355 2919436860 2919432681 Bacteria 5390474
356 2928142548 2928142448 Bacteria 5288925
357 2974317191 2974315732 Bacteria 4602776
358 2984525397 2984523437 Bacteria 4508481
359 8003316286 8003314358 Bacteria 10575343
360 8047715556 8047710418 Bacteria 11023148
361 8056211929 8056207758 Bacteria 8639239
362 Ga0373956_0000612
363 JGI24735J21928_10026783
364 JGI25406J46586_10000620
365 rootL2_10193277
366 Ga0070658_10049405
367 Ga0070658_10072124
368 Ga0070658_10250984
369 Ga0070683_100145492
370 Ga0070683_100209809
371 Ga0068869_100101622
372 Ga0068868_100140586
373 Ga0070660_100001896
374 Ga0070689_100177262
375 Ga0070687_100077387
376 Ga0070668_100001456
377 Ga0070669_100079047
378 Ga0070688_100065099
379 Ga0070659_100008607
380 Ga0070659_100014707
381 Ga0070659_100150307
382 Ga0070667_100161802
383 Ga0070714_100100708
384 Ga0070713_100010695
385 Ga0070710_10000170
386 Ga0070711_100015568
387 Ga0070700_100000088
388 Ga0070663_100017834
389 Ga0070663_100345005
390 Ga0070678_100133936
391 Ga0070678_100288988
392 Ga0070662_100135213
393 Ga0070662_100442955
394 Ga0070685_10004093
395 Ga0070706_100157838
396 Ga0070707_100022170
397 Ga0070707_100194317
398 Ga0070699_100089759
399 Ga0070699_100176197
400 Ga0068853_100004749
401 Ga0070696_100149358
402 Ga0068855_100160947
403 Ga0068855_100270231
404 Ga0070664_100079740
405 Ga0070664_100114851
406 Ga0068854_100038832
407 Ga0068856_100037301
408 Ga0068852_100014744
409 Ga0068859_100491450
410 Ga0068861_100084863
411 Ga0068858_100311735
412 Ga0068862_100089267
413 Ga0081455_10000011
414 Ga0081455_10000856
415 Ga0081455_10001927
416 Ga0081455_10004893
417 Ga0081538_10056270
418 Ga0081539_10001153
419 Ga0070717_10183480
420 Ga0075364_10064504
421 Ga0070712_100045201
422 Ga0075428_100010252
423 Ga0075430_100001901
424 Ga0075431_100000515
425 Ga0075431_100004346
426 Ga0075431_100004364
427 Ga0075434_100236451
428 Ga0075429_100001113
429 Ga0075429_100004768
430 Ga0068865_100294996
431 Ga0097620_100491456
432 Ga0111539_10073712
433 Ga0111539_10370988
434 Ga0105245_10201533
435 Ga0105245_10541075
436 Ga0105247_10101903
437 Ga0114129_10001475
438 Ga0114129_10030468
439 Ga0105243_10034182
440 Ga0105243_10199170
441 Ga0105238_10081134
442 Ga0105238_10158322
443 Ga0105249_10306661
444 Ga0105239_10181986
445 Ga0163162_10028541
446 Ga0157372_10100350
447 Ga0157372_10198930
448 Ga0157372_10289022
449 Ga0157375_10145182
450 Ga0157380_10066382
451 Ga0182008_10059683
452 Ga0157379_10175690
453 Ga0157376_10058494
454 Ga0206353_10765213
455 Ga0213875_10001713
456 Ga0213875_10107669
457 Ga0207697_10039866
458 Ga0207692_10000293
459 Ga0207692_10198752
460 Ga0207710_10052843
461 Ga0207688_10021330
462 Ga0207647_10022502
463 Ga0207645_10072569
464 Ga0207705_10203088
465 Ga0207693_10019802
466 Ga0207663_10238847
467 Ga0207662_10186658
468 Ga0207657_10007437
469 Ga0207681_10077139
470 Ga0207694_10110760
471 Ga0207659_10321127
472 Ga0207700_10002007
473 Ga0207664_10036239
474 Ga0207664_10043105
475 Ga0207690_10034998
476 Ga0207690_10214072
477 Ga0207690_10217670
478 Ga0207690_10414403
479 Ga0207706_10038747
480 Ga0207706_10288761
481 Ga0207689_10046572
482 Ga0207679_10048130
483 Ga0207679_10175549
484 Ga0207668_10002772
485 Ga0207668_10370765
486 Ga0207658_10056428
487 Ga0207639_10119185
488 Ga0207678_10013082
489 Ga0207678_10019141
490 Ga0207678_10094117
491 Ga0207678_10388370
492 Ga0207708_10000110
493 Ga0207708_10240708
494 Ga0207708_10254703
495 Ga0207702_10042603
496 Ga0207702_10063678
497 Ga0207674_10032850
498 Ga0207675_100129089
499 Ga0207675_100351079
500 Ga0207698_10067955
501 Ga0207428_10035054
502 Ga0268264_10107943
503 Ga0268264_10581040
504 Ga0307515_10142433
505 Ga0307515_10165771
506 Ga0307511_10001109
507 Ga0307511_10086168
508 Ga0307512_10025285
509 Ga0316177_1074566
510 Ga0316176_1175502
511 Ga0316182_1279110
512 Ga0307513_10067115
513 Ga0307513_10298833
514 Ga0307405_10101187
515 Ga0307413_10000562
516 Ga0307413_10010784
517 Ga0307413_10359620
518 Ga0307413_10393857
519 Ga0307518_10002521
520 Ga0307406_10025796
521 Ga0307406_10050704
522 Ga0307407_10157376
523 Ga0307412_10202691
524 Ga0307409_100023956
525 Ga0307409_100096706
526 Ga0307416_100010101
527 Ga0307416_100284001
528 Ga0307414_10194431
529 Ga0307411_10033572
530 Ga0307415_100124463
531 Ga0307507_10023687
532 Ga0373925_0191681
533 Ga0395899_0009287
534 Ga0395900_0020407
535 Ga0395900_0365755
536 Ga0436364_0473109
537 Ga0436364_0674710
538 Ga0436364_0813769
539 Ga0436364_1485205
540 Ga0395901_0093104
541 Ga0439465_0042533
542 Ga0451837_0052201
543 Ga0439445_0020552
544 Ga0439449_0007924
545 Ga0466969_0008629
546 Ga0466969_0044020
547 Ga0466972_0002149
548 Ga0466972_0008011
549 Ga0466972_0022374
550 Ga0466965_0000195
551 Ga0466965_0003086
552 Ga0466965_0073928
553 Ga0466965_0096120
554 Ga0466966_0013861
555 Ga0466966_0014395
556 Ga0466966_0141169
557 Ga0466961_0047401
558 Ga0466961_0086551
559 Ga0466961_0173454
560 Ga0466963_0001665
561 Ga0466963_0134965
562 Ga0466963_0149617
563 Ga0466963_0268412
564 Ga0453684_0246671
565 Ga0466971_0076382
566 Ga0466971_0088615
567 Ga0466968_0002161
568 Ga0466968_0008849
569 Ga0466970_0004725
570 Ga0466970_0025412
571 Ga0466970_0046457
572 Ga0466970_0080802
573 Ga0466957_0070316
574 Ga0466960_0004045
575 Ga0466960_0011878
576 Ga0466960_0051380
577 Ga0466960_0124714
578 Ga0466960_0132670
579 Ga0466959_0002480
580 Ga0466959_0020369
581 Ga0466959_0166297
582 Ga0466958_0018859
583 Ga0466967_0003549
584 Ga0466967_0054528
585 Ga0466967_0089825
586 Ga0466967_0093188
587 Ga0466967_0146760
588 Ga0466967_0524726
589 Ga0495627_036419
590 Ga0495603_0061275
591 Ga0495641_0081996
592 Ga0495582_0094968
593 Ga0495594_0065951
594 Ga0495645_0085901
595 Ga0495669_0011515
596 Ga0495674_0009769
597 Ga0496100_0419882
598 Ga0496101_0092960
599 Ga0496101_0149581
600 Ga0496102_0026632
601 Ga0496103_0061386
602 Ga0496103_0112864
603 Ga0496103_0193554
604 Ga0496104_0110130
605 Ga0496104_0519103
606 Ga0496105_0178513
607 Ga0496106_0016388
608 Ga0496107_0120429
609 Ga0496108_0267161
610 Ga0496110_0346039
611 Ga0496112_0231072
612 Ga0496113_0074440
613 Ga0496114_0002789
614 Ga0496114_0035800
615 Ga0496114_0050480
616 Ga0496119_0000061
617 Ga0496120_0004587
618 Ga0501031_0002402
619 Ga0501031_0006622
620 Ga0501031_0023342
621 Ga0501031_0173006
622 Ga0501032_0201762
623 Ga0501033_0140462
624 Ga0501036_0016526
625 Ga0501036_0256582
626 Ga0501038_0003732
627 Ga0501038_0007971
628 Ga0501038_0160420
629 Ga0501039_0011200
630 Ga0501039_0249267
631 Ga0501040_0010955
632 Ga0501042_0000189
633 Ga0501042_0021945
634 Ga0501043_0009717
635 Ga0501046_0007188
636 Ga0501047_0017387
637 Ga0501048_0000611
638 Ga0501048_0008025
639 Ga0501067_0010132
640 Ga0501069_0023302
641 Ga0501070_0150382
642 Ga0501071_0006771
643 Ga0501071_0188820
644 Ga0501072_0013272
645 Ga0501075_0020571
646 Ga0501076_0032441
647 Ga0501079_0024925
648 Ga0501080_0055471
649 Ga0501081_0041080
650 Ga0501035_0019082
651 Ga0501035_0130195
652 Ga0501035_0189511
653 Ga0501045_0003098
654 Ga0501045_0115196
655 nmdc:mga07m45_23255_c1
656 nmdc:mga05p37_1192_c1
657 nmdc:mga05p37_238_c1
658 nmdc:mga05p37_266966_c1
659 nmdc:mga09592_222438_c1
660 nmdc:mga09592_555_c1
661 nmdc:mga09592_9836_c1
662 nmdc:mga0qj67_2354_c1
663 nmdc:mga0qj67_4038_c1
664 nmdc:mga06r32_1106_c1
665 nmdc:mga06r32_4598_c1
666 nmdc:mga06r32_8462_c1
667 nmdc:mga08y16_220873_c1
668 nmdc:mga08y16_9945_c1
669 nmdc:mga0n895_77322_c1
670 Ga0495655_0041950
671 Ga0500556_0001233
672 Ga0500593_000080
673 Ga0500577_0004532
674 Ga0501084_0029004
675 Ga0501084_0171759
676 Ga0590075_032616
677 Ga0501082_0035265
678 Ga0530510_0382527
679 2506868263
680 2559429543
681 2583150356
682 2586059084
683 2643893175
684 2643961766
685 2644034096
686 2644089862
687 2644102530
688 2644118193
689 2644319707
690 2644537034
691 2738871306
692 2739203228
693 2740166767
694 2753070679
695 2774902679
696 2776374244
697 2791910610
698 2795794502
699 2809592157
700 2812333837
701 2816427466
702 2855387584
703 2863070974
704 2866552732
705 2866616714
706 2870726762
707 2891327422
708 2899365413
709 2899375254
710 2904770145
711 2904771006
712 2908815049
713 2915773172
714 2917743392
715 2919424467
716 2919436860
717 2928142548
718 2974317191
719 2984525397
720 8003316286
721 8047715556
722 8056211929

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01210

NAD_Gly3P_dh_N

NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus

22

180

0.98

PF07479

NAD_Gly3P_dh_C

NAD-dependent glycerol-3-phosphate dehydrogenase C-terminus

199

341

0.98

PF20618

GPD_NAD_C_bact

Bacterial GPD, NAD-dependent C-terminal

259

326

0.88

PF02558

ApbA

Ketopantoate reductase PanE/ApbA

23

173

0.76

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

22

126

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
4j36-assembly2.cif.gz_B cocrystal structure of kynurenine 3-monooxygenase in complex with upf 648 inhibitor(kmo-394upf) 1.007 2 29
7fgp-assembly1.cif.gz_A crystal structure of aureimonas altamirenisis flavin-containing opine dehydrogenase (fad-bound form) 0.9955 1 28
7fgp-assembly1.cif.gz_B crystal structure of aureimonas altamirenisis flavin-containing opine dehydrogenase (fad-bound form) 0.9948 1 28
3if9-assembly2.cif.gz_D-3 crystal structure of glycine oxidase g51s/a54r/h244a mutant in complex with inhibitor glycolate 0.9942 3 29
3if9-assembly1.cif.gz_B-2 crystal structure of glycine oxidase g51s/a54r/h244a mutant in complex with inhibitor glycolate 0.9871 3 29
ID Description Score Start End Superfamily
4j36B00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 1.007 2 29 3.50.50.60
af_P9WN77_2_187_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9981 2 180 3.40.50.720
af_F6P928_26_379_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9893 3 31 3.50.50.60
af_P9WN77_188_331_1.10.1040.10 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.982 184 328 1.10.1040.10
af_P9WNY9_4_366_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9752 3 28 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A2S9FGE7-F1-model_v4 Glycerol-3-phosphate dehydrogenase (EC 1.1.1.94) 0.9974 7 258 GO:0005829
GO:0005975
GO:0006650
GO:0008654
GO:0046168
GO:0047952
GO:0051287
AF-X8FB33-F1-model_v4 deleted 0.9971 8 187
AF-A0A1A0PI43-F1-model_v4 Glycerol-3-phosphate dehydrogenase (EC 1.1.1.94) 0.9966 9 302 GO:0005829
GO:0005975
GO:0006650
GO:0008654
GO:0046168
GO:0047952
GO:0051287
AF-M3FUW4-F1-model_v4 Glycerol-3-phosphate dehydrogenase (EC 1.1.1.94) 0.9958 77 260 GO:0005829
GO:0005975
GO:0008654
GO:0046168
GO:0047952
GO:0051287
AF-A0A6G3X0G2-F1-model_v4 NAD(P)-binding domain-containing protein 0.995 25 196 GO:0005829
GO:0046168
GO:0047952
GO:0051287

Map