F422328

General Info

Members Datasets Scaffolds Average Seq Length
361 226 315 261

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0098295|Ga0495638_0098295_130_1005
Length 291
Sequence MTKESLVMTTPTPHVPALPAAPPRVLTIAGSDSGGGAGIQADLKTMLALGAHGMSVLTAVTAQNSLGVQGAWELPAEAVRTQYRSVVDDIGVQAVKTGMLSSPVLVEAVAELLAGTDAPVVVDPVSVSKHGDPLLAEDALDAVRTKLLPVATVATPNLDEVAQLTGLAVTDDDGMRRAAARLLSFGPRWVVVKGGHLPGAAVDLLTDGTEEHWLRAPRHDNRHTHGTGCSLASAVAVGLAQGLPVPESVRLAKEYVTGAIAAGFALGSGIGPVDHGWRLPADRSMATGRQE

Samples

Sample ID Description Type Environment
1 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
2 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
3 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
4 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
5 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
6 2643221548 Streptomyces sp. Root55 Isolate Unclassified
7 2643221578 Streptomyces sp. Root63 Isolate Unclassified
8 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
9 2643221670 Streptomyces sp. Root431 Isolate Unclassified
10 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
11 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
12 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
13 2643221714 Streptomyces sp. Root264 Isolate Unclassified
14 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
15 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
16 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
17 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
18 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
19 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
20 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
21 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
22 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
23 2862574272 Streptomyces sp. AcE210 Isolate Nodule
24 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
25 2867369537 Streptomyces sp. Z26 Isolate Unclassified
26 2867428634 Streptomyces sp. RP5T Isolate Unclassified
27 2867475112 Streptomyces sp. TM32 Isolate Unclassified
28 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
29 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
30 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
31 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
32 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
33 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
34 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
35 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
36 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
37 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
38 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
39 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
40 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
41 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
42 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
43 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
44 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
45 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
46 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
51 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
52 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
54 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
55 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
60 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
61 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
62 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
63 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
64 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
65 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
66 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
67 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
68 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
69 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
70 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
71 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
72 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
73 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
74 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
75 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
76 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
77 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
78 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
79 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
80 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
81 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
82 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
83 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
84 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
85 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
86 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
87 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
88 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
89 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
90 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
91 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
92 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
93 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
94 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
95 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
96 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
97 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
98 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
99 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
100 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
101 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
102 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
103 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
104 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
105 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
106 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
107 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
108 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
109 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
110 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
111 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
112 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
113 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
114 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
115 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
116 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
117 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
118 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
119 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
120 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
121 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
122 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
123 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
124 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
125 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
126 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
127 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
128 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
129 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
130 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
131 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
132 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
133 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
134 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
135 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
136 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
137 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
138 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
139 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
140 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
141 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
142 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
143 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
144 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
145 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
146 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
147 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
148 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
149 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
150 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
151 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
152 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
153 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
154 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
155 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
156 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
157 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
158 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
159 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
160 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
161 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
162 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
163 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
164 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
165 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
166 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
167 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
172 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
188 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
189 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
190 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
191 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
192 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
193 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
194 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
195 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
196 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
197 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
198 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
199 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
200 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
203 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
204 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
205 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
206 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
207 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
208 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
209 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
210 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
211 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
212 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
213 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
214 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
215 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
216 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
217 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
218 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
219 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
220 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
221 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
222 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
223 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
224 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
225 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
226 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.15
Metatranscriptomes 0.83
Isolates 13.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.32
Nodule 0.55
Rhizoplane 0.83
Rhizosphere 83.1
Stem 0
Stem Tuber 0
Unclassified 12.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10014762 3300001990 Bacteria 2533
2 JGI24735J21928_10045616 3300002067 Bacteria 1273
3 JGI24738J21930_10028566 3300002075 Bacteria 1141
4 rootH1_10041734 3300003316 Bacteria 4023
5 rootH1_10041734 3300003323 Bacteria 3489
6 Ga0006562J51391_1089772 3300003578 Bacteria 4850
7 Ga0006562J51391_1119201 3300003578 Bacteria 1060
8 Ga0070714_100034156 3300005435 Bacteria 4258
9 Ga0081455_10116413 3300005937 Bacteria 2114
10 Ga0099826_10060742 3300006948 Bacteria 2460
11 Ga0105246_10031384 3300011119 Bacteria 3516
12 Ga0105246_10362851 3300011119 Bacteria 1191
13 Ga0182007_10000165 3300015262 Bacteria 45550
14 Ga0182005_1008835 3300015265 Bacteria 2958
15 Ga0206353_11381023 3300020082 Bacteria 1843
16 Ga0213875_10121798 3300021388 Bacteria 1219
17 Ga0207426_1004063 3300025302 Bacteria 7387
18 Ga0207426_1020431 3300025302 Bacteria 2301
19 Ga0207647_10039036 3300025904 Bacteria 2999
20 Ga0207664_10007088 3300025929 Bacteria 7768
21 Ga0207709_10076647 3300025935 Bacteria 2141
22 Ga0207667_10133460 3300025949 Bacteria 2557
23 Ga0307517_10000616 3300028786 Bacteria 60799
24 Ga0265338_10152980 3300028800 Bacteria 1790
25 Ga0307511_10111983 3300030521 Bacteria 1732
26 Ga0307512_10005071 3300030522 Bacteria 13997
27 Ga0265325_10022643 3300031241 Bacteria 3439
28 Ga0265325_10087266 3300031241 Bacteria 1542
29 Ga0265331_10174127 3300031250 Bacteria 973
30 Ga0265316_10312290 3300031344 Bacteria 1143
31 Ga0307509_10200860 3300031507 Bacteria 1831
32 Ga0307509_10261120 3300031507 Bacteria 1507
33 Ga0307508_10008024 3300031616 Bacteria 9788
34 Ga0307508_10048153 3300031616 Bacteria 3798
35 Ga0307514_10077210 3300031649 Bacteria 2478
36 Ga0265314_10058837 3300031711 Bacteria 2632
37 Ga0307518_10209598 3300031838 Bacteria 1284
38 Ga0307507_10019522 3300033179 Bacteria 7630
39 Ga0307507_10082750 3300033179 Bacteria 2812
40 Ga0307510_10006792 3300033180 Bacteria 13647
41 Ga0307510_10148684 3300033180 Bacteria 1967
42 Ga0395898_0020289 3300037466 Bacteria 6750
43 Ga0395898_0034889 3300037466 Bacteria 5006
44 Ga0436364_0771821 3300037853 Bacteria 1685
45 Ga0439436_0011648 3300041404 Bacteria 2671
46 Ga0439442_004140 3300042002 Bacteria 2876
47 Ga0439449_0017921 3300042007 Bacteria 2657
48 Ga0439449_0029989 3300042007 Bacteria 2026
49 Ga0439457_005484 3300042014 Bacteria 3190
50 Ga0439462_0011461 3300042015 Bacteria 2257
51 Ga0466969_0002075 3300044656 Bacteria 10698
52 Ga0466969_0008468 3300044656 Bacteria 5456
53 Ga0466972_0126273 3300044658 Bacteria 1205
54 Ga0466965_0000614 3300044683 Bacteria 13014
55 Ga0466965_0154013 3300044683 Bacteria 1202
56 Ga0466965_0431918 3300044683 Bacteria 731
57 Ga0466966_0003912 3300044684 Bacteria 9834
58 Ga0466966_0007105 3300044684 Bacteria 7420
59 Ga0466966_0021365 3300044684 Bacteria 4250
60 Ga0466966_0101938 3300044684 Bacteria 1775
61 Ga0466961_0000389 3300044693 Bacteria 28233
62 Ga0466961_0009582 3300044693 Bacteria 6165
63 Ga0466961_0026189 3300044693 Bacteria 3751
64 Ga0466961_0034458 3300044693 Bacteria 3251
65 Ga0466961_0245302 3300044693 Bacteria 1100
66 Ga0466963_0004618 3300044694 Bacteria 8027
67 Ga0466964_0030885 3300044706 Bacteria 2122
68 Ga0466971_0010491 3300044719 Bacteria 4049
69 Ga0466970_0001377 3300044765 Bacteria 11706
70 Ga0466957_0010382 3300044842 Bacteria 5343
71 Ga0466957_0066017 3300044842 Bacteria 2230
72 Ga0466960_0018298 3300044901 Bacteria 3067
73 Ga0466960_0292106 3300044901 Bacteria 916
74 Ga0466959_0000365 3300045049 Bacteria 26771
75 Ga0466959_0004517 3300045049 Bacteria 9332
76 Ga0466958_0000185 3300045836 Bacteria 22546
77 Ga0466967_0376112 3300045976 Bacteria 1378
78 Ga0495592_0003261 3300046454 Bacteria 11634
79 Ga0495592_0017717 3300046454 Bacteria 5412
80 Ga0495592_0025667 3300046454 Bacteria 4472
81 Ga0495592_0029966 3300046454 Bacteria 4116
82 Ga0495603_0002749 3300046455 Bacteria 10364
83 Ga0495603_0006636 3300046455 Bacteria 6942
84 Ga0495603_0007441 3300046455 Bacteria 6585
85 Ga0495603_0021866 3300046455 Bacteria 3872
86 Ga0495603_0054862 3300046455 Bacteria 2361
87 Ga0495603_0100702 3300046455 Bacteria 1686
88 Ga0495590_0032817 3300046457 Bacteria 1816
89 Ga0495629_0008022 3300046459 Bacteria 7770
90 Ga0495629_0008081 3300046459 Bacteria 7744
91 Ga0495629_0009932 3300046459 Bacteria 6946
92 Ga0495629_0034307 3300046459 Bacteria 3587
93 Ga0495629_0036760 3300046459 Bacteria 3455
94 Ga0495629_0160526 3300046459 Bacteria 1561
95 Ga0495629_0190799 3300046459 Bacteria 1418
96 Ga0495629_0273254 3300046459 Bacteria 1161
97 Ga0495638_0053548 3300046460 Bacteria 2511
98 Ga0495638_0098295 3300046460 Bacteria 1754
99 Ga0495651_0039485 3300046462 Bacteria 3674
100 Ga0495653_0411395 3300046463 Bacteria 857
101 Ga0495580_0064119 3300046472 Bacteria 2576
102 Ga0495582_0030442 3300046473 Bacteria 2963
103 Ga0495582_0054601 3300046473 Bacteria 2203
104 Ga0495605_0005660 3300046474 Bacteria 7263
105 Ga0495662_0001444 3300046476 Bacteria 11755
106 Ga0495662_0011398 3300046476 Bacteria 4345
107 Ga0495662_0014863 3300046476 Bacteria 3782
108 Ga0495662_0040306 3300046476 Bacteria 2255
109 Ga0495664_0000321 3300046477 Bacteria 23117
110 Ga0495664_0001529 3300046477 Bacteria 12232
111 Ga0495584_0062927 3300046491 Bacteria 1865
112 Ga0495594_0010145 3300046499 Bacteria 4882
113 Ga0495607_0032710 3300046501 Bacteria 3171
114 Ga0495606_0005145 3300046507 Bacteria 12685
115 Ga0495608_0004752 3300046511 Bacteria 9724
116 Ga0495608_0027212 3300046511 Bacteria 3892
117 Ga0495610_0119739 3300046512 Bacteria 1155
118 Ga0495616_0026855 3300046513 Bacteria 3058
119 Ga0495616_0178405 3300046513 Bacteria 945
120 Ga0495618_0122496 3300046514 Bacteria 1665
121 Ga0495620_0101654 3300046515 Bacteria 1145
122 Ga0495628_0001058 3300046516 Bacteria 25220
123 Ga0495628_0039915 3300046516 Bacteria 3753
124 Ga0495628_0177525 3300046516 Bacteria 1612
125 Ga0495630_0016999 3300046517 Bacteria 5324
126 Ga0495630_0060075 3300046517 Bacteria 2852
127 Ga0495631_0016003 3300046518 Bacteria 3583
128 Ga0495632_0158896 3300046519 Bacteria 1042
129 Ga0495637_0051750 3300046520 Bacteria 1717
130 Ga0495643_0004497 3300046522 Bacteria 9717
131 Ga0495648_0068173 3300046524 Bacteria 2077
132 Ga0495666_0006306 3300046526 Bacteria 5973
133 Ga0495666_0031312 3300046526 Bacteria 2606
134 Ga0495652_0078373 3300046529 Bacteria 2735
135 Ga0495654_0074969 3300046530 Bacteria 1597
136 Ga0495665_0006543 3300046531 Bacteria 6293
137 Ga0495640_0014815 3300046533 Bacteria 5886
138 Ga0495640_0015224 3300046533 Bacteria 5792
139 Ga0495640_0035840 3300046533 Bacteria 3509
140 Ga0495586_0010052 3300046535 Bacteria 5037
141 Ga0495587_0009945 3300046536 Bacteria 6071
142 Ga0495609_0019598 3300046538 Bacteria 3128
143 Ga0495597_0024655 3300046542 Bacteria 2774
144 Ga0495645_0008953 3300046543 Bacteria 6991
145 Ga0495645_0052093 3300046543 Bacteria 2978
146 Ga0495645_0054678 3300046543 Bacteria 2900
147 Ga0495645_0250387 3300046543 Bacteria 1178
148 Ga0495622_0014142 3300046557 Bacteria 3704
149 Ga0495622_0046989 3300046557 Bacteria 2006
150 Ga0495622_0078377 3300046557 Bacteria 1521
151 Ga0495667_0013977 3300046559 Bacteria 5420
152 Ga0495667_0046099 3300046559 Bacteria 2884
153 Ga0495667_0133646 3300046559 Bacteria 1600
154 Ga0495668_0024736 3300046616 Bacteria 3414
155 Ga0495634_0001805 3300046642 Bacteria 18484
156 Ga0495634_0012045 3300046642 Bacteria 6269
157 Ga0495634_0140358 3300046642 Bacteria 1534
158 Ga0495611_0003698 3300046648 Bacteria 6693
159 Ga0495611_0030465 3300046648 Bacteria 2372
160 Ga0495625_0032751 3300046660 Bacteria 3850
161 Ga0495625_0174928 3300046660 Bacteria 1431
162 Ga0495635_0054070 3300046663 Bacteria 2765
163 Ga0495635_0059434 3300046663 Bacteria 2628
164 Ga0495635_0091660 3300046663 Bacteria 2078
165 Ga0495661_0034760 3300046665 Bacteria 3169
166 Ga0495588_0047905 3300046674 Bacteria 2195
167 Ga0495588_0050265 3300046674 Bacteria 2145
168 Ga0495588_0185012 3300046674 Bacteria 1101
169 Ga0495657_0003418 3300046675 Bacteria 12958
170 Ga0495657_0007518 3300046675 Bacteria 8420
171 Ga0495657_0020355 3300046675 Bacteria 4770
172 Ga0495599_0005135 3300046678 Bacteria 7799
173 Ga0495623_0157998 3300046679 Bacteria 1334
174 Ga0495646_0000324 3300046680 Bacteria 24548
175 Ga0495658_0008765 3300046683 Bacteria 5024
176 Ga0495613_0000764 3300046689 Bacteria 25140
177 Ga0495613_0008459 3300046689 Bacteria 7634
178 Ga0495613_0010964 3300046689 Bacteria 6728
179 Ga0495613_0013055 3300046689 Bacteria 6173
180 Ga0495613_0015577 3300046689 Bacteria 5655
181 Ga0495613_0017682 3300046689 Bacteria 5311
182 Ga0495613_0029756 3300046689 Bacteria 4060
183 Ga0495613_0189172 3300046689 Bacteria 1455
184 Ga0495613_0195396 3300046689 Bacteria 1428
185 Ga0495671_0011115 3300046692 Bacteria 4969
186 Ga0495671_0115869 3300046692 Bacteria 1308
187 Ga0495649_0061829 3300046694 Bacteria 2013
188 Ga0495589_0025200 3300046794 Bacteria 3019
189 Ga0495589_0040939 3300046794 Bacteria 2312
190 Ga0495600_0003746 3300046809 Bacteria 8992
191 Ga0495600_0013881 3300046809 Bacteria 5073
192 Ga0495581_0012921 3300047315 Bacteria 4839
193 Ga0495581_0025831 3300047315 Bacteria 3406
194 Ga0495581_0038231 3300047315 Bacteria 2777
195 Ga0495581_0045945 3300047315 Bacteria 2524
196 Ga0495581_0335098 3300047315 Bacteria 883
197 Ga0495604_0001635 3300047317 Bacteria 18454
198 Ga0495604_0004765 3300047317 Bacteria 10748
199 Ga0495604_0018626 3300047317 Bacteria 5562
200 Ga0495636_0000812 3300047318 Bacteria 11508
201 Ga0495636_0003378 3300047318 Bacteria 6192
202 Ga0495636_0004280 3300047318 Bacteria 5602
203 Ga0495636_0109200 3300047318 Bacteria 1216
204 Ga0495674_0035840 3300047319 Bacteria 4472
205 Ga0495674_0046634 3300047319 Bacteria 3846
206 Ga0495676_0016702 3300047321 Bacteria 6500
207 Ga0495676_0032354 3300047321 Bacteria 4415
208 Ga0495676_0086168 3300047321 Bacteria 2364
209 Ga0495676_0090086 3300047321 Bacteria 2296
210 Ga0495680_0027405 3300047322 Bacteria 4683
211 Ga0495687_008980 3300047443 Bacteria 5650
212 Ga0495687_015942 3300047443 Bacteria 3796
213 Ga0495687_016246 3300047443 Bacteria 3748
214 Ga0495687_061587 3300047443 Bacteria 1543
215 Ga0495687_110364 3300047443 Bacteria 1012
216 Ga0495675_0006726 3300047444 Bacteria 7047
217 Ga0495675_0020401 3300047444 Bacteria 4214
218 Ga0495675_0049759 3300047444 Bacteria 2663
219 Ga0495675_0132235 3300047444 Bacteria 1550
220 Ga0495675_0170976 3300047444 Bacteria 1334
221 Ga0495677_0027814 3300047445 Bacteria 2052
222 Ga0495685_015649 3300047447 Bacteria 2589
223 Ga0495681_0000245 3300047470 Bacteria 45204
224 Ga0495681_0033861 3300047470 Bacteria 2552
225 Ga0495684_0071886 3300047471 Bacteria 2628
226 Ga0495686_0040165 3300047472 Bacteria 2985
227 Ga0495593_0000138 3300047673 Bacteria 35243
228 Ga0495593_0003723 3300047673 Bacteria 9100
229 Ga0495593_0012064 3300047673 Bacteria 4952
230 Ga0495602_0050092 3300048088 Bacteria 3735
231 Ga0495602_0069023 3300048088 Bacteria 3032
232 Ga0495614_0051602 3300048089 Bacteria 1762
233 Ga0495614_0098441 3300048089 Bacteria 1277
234 Ga0495626_0034781 3300048091 Bacteria 2408
235 Ga0496106_0055877 3300048909 Bacteria 2984
236 Ga0496108_0119579 3300048911 Bacteria 2259
237 Ga0496109_0887106 3300048912 Bacteria 830
238 Ga0495678_021207 3300049459 Bacteria 2864
239 Ga0501031_0001482 3300049568 Bacteria 14587
240 Ga0501031_0029479 3300049568 Bacteria 3579
241 Ga0501032_0001172 3300049569 Bacteria 21019
242 Ga0501032_0374154 3300049569 Bacteria 916
243 Ga0501033_0002969 3300049570 Bacteria 14167
244 Ga0501033_0006059 3300049570 Bacteria 9482
245 Ga0501034_0002789 3300049571 Bacteria 20464
246 Ga0501034_0004598 3300049571 Bacteria 15290
247 Ga0501036_0023658 3300049572 Bacteria 5176
248 Ga0501036_0035488 3300049572 Bacteria 4219
249 Ga0501037_0002681 3300049573 Bacteria 12842
250 Ga0501037_0035283 3300049573 Bacteria 3689
251 Ga0501037_0115786 3300049573 Bacteria 1929
252 Ga0501037_0144744 3300049573 Bacteria 1700
253 Ga0501038_0002035 3300049574 Bacteria 18700
254 Ga0501038_0003478 3300049574 Bacteria 14664
255 Ga0501039_0027398 3300049575 Bacteria 4381
256 Ga0501039_0108802 3300049575 Bacteria 2166
257 Ga0501040_0005884 3300049576 Bacteria 7939
258 Ga0501041_0006379 3300049577 Bacteria 6903
259 Ga0501042_0008409 3300049578 Bacteria 6810
260 Ga0501042_0044207 3300049578 Bacteria 3173
261 Ga0501043_0002472 3300049579 Bacteria 15633
262 Ga0501043_0045521 3300049579 Bacteria 3451
263 Ga0501043_0298173 3300049579 Bacteria 1232
264 Ga0501046_0006949 3300049580 Bacteria 9973
265 Ga0501046_0107891 3300049580 Bacteria 2130
266 Ga0501047_0000029 3300049581 Bacteria 218396
267 Ga0501047_0000880 3300049581 Bacteria 30670
268 Ga0501047_0013324 3300049581 Bacteria 7789
269 Ga0501047_0115206 3300049581 Bacteria 2569
270 Ga0501048_0000605 3300049582 Bacteria 25519
271 Ga0501048_0197810 3300049582 Bacteria 1425
272 Ga0501067_0001602 3300049583 Bacteria 12400
273 Ga0501068_0000050 3300049584 Bacteria 45608
274 Ga0501069_0009346 3300049585 Bacteria 5176
275 Ga0501070_0003159 3300049586 Bacteria 14330
276 Ga0501070_0003598 3300049586 Bacteria 13404
277 Ga0501071_0001184 3300049587 Bacteria 14681
278 Ga0501072_0007454 3300049588 Bacteria 8298
279 Ga0501073_0108349 3300049589 Bacteria 1928
280 Ga0501073_0124255 3300049589 Bacteria 1788
281 Ga0501074_0004536 3300049590 Bacteria 9939
282 Ga0501074_0006540 3300049590 Bacteria 8419
283 Ga0501076_0011207 3300049592 Bacteria 6673
284 Ga0501077_0003467 3300049593 Bacteria 9471
285 Ga0501079_0023516 3300049741 Bacteria 4728
286 Ga0501080_0030525 3300049742 Bacteria 5021
287 Ga0501080_0091102 3300049742 Bacteria 2832
288 Ga0501083_0001220 3300049744 Bacteria 17413
289 Ga0501035_0001220 3300049822 Bacteria 26803
290 Ga0501035_0005880 3300049822 Bacteria 11554
291 Ga0501035_0169876 3300049822 Bacteria 1884
292 Ga0501044_0001475 3300049823 Bacteria 27586
293 Ga0501044_0004269 3300049823 Bacteria 16039
294 Ga0501044_0016800 3300049823 Bacteria 7854
295 Ga0501044_0137167 3300049823 Bacteria 2437
296 Ga0501044_0162459 3300049823 Bacteria 2209
297 Ga0501044_0212893 3300049823 Bacteria 1886
298 Ga0501045_0189554 3300049824 Bacteria 1532
299 nmdc:mga06r32_240897_c1 3300050510 Bacteria 1796
300 Ga0495601_0004899 3300053077 Bacteria 7770
301 Ga0495619_0115220 3300053085 Bacteria 1839
302 Ga0500644_0006739 3300053088 Bacteria 2959
303 Ga0500583_0047867 3300053092 Bacteria 1972
304 Ga0500640_001975 3300053095 Bacteria 6582
305 Ga0500660_099133 3300053100 Bacteria 1277
306 Ga0500553_105382 3300053101 Bacteria 1202
307 Ga0500569_020646 3300053109 Bacteria 1731
308 Ga0500573_0025239 3300053140 Bacteria 3417
309 Ga0500600_0077342 3300053149 Bacteria 1808
310 Ga0500624_003237 3300053157 Bacteria 2143
311 Ga0500633_0000496 3300053160 Bacteria 6294
312 Ga0501084_0142213 3300054114 Bacteria 2020
313 Ga0501082_0005576 3300060353 Bacteria 10932
314 Ga0466962_0027782 3300061719 Bacteria 2712
315 Ga0530510_0082890 3300061734 Bacteria 2335

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048912 Ga0496109_0887106 Ga0496109_0887106_29_799 195
2 3300046455 Ga0495603_0007441 Ga0495603_0007441_2242_3039 208
3 3300046459 Ga0495629_0190799 Ga0495629_0190799_520_1317 208
4 3300046692 Ga0495671_0115869 Ga0495671_0115869_145_942 208
5 3300047315 Ga0495581_0045945 Ga0495581_0045945_1566_2363 208
6 3300037466 Ga0395898_0034889 Ga0395898_0034889_1204_2040 210
7 3300047443 Ga0495687_110364 Ga0495687_110364_277_999 211
8 3300044683 Ga0466965_0431918 Ga0466965_0431918_10_711 213
9 3300047443 Ga0495687_061587 Ga0495687_061587_702_1499 213
10 3300015262 Ga0182007_10000165 Ga0182007_100001652 216
11 3300046455 Ga0495603_0100702 Ga0495603_0100702_115_921 216
12 3300046457 Ga0495590_0032817 Ga0495590_0032817_994_1800 216
13 3300046459 Ga0495629_0160526 Ga0495629_0160526_578_1384 216
14 3300046460 Ga0495638_0053548 Ga0495638_0053548_651_1457 216
15 3300046474 Ga0495605_0005660 Ga0495605_0005660_4611_5417 216
16 3300046491 Ga0495584_0062927 Ga0495584_0062927_794_1600 216
17 3300046501 Ga0495607_0032710 Ga0495607_0032710_1726_2532 216
18 3300046507 Ga0495606_0005145 Ga0495606_0005145_7644_8450 216
19 3300046511 Ga0495608_0027212 Ga0495608_0027212_1463_2269 216
20 3300046512 Ga0495610_0119739 Ga0495610_0119739_164_970 216
21 3300046513 Ga0495616_0026855 Ga0495616_0026855_934_1740 216
22 3300046514 Ga0495618_0122496 Ga0495618_0122496_332_1138 216
23 3300046516 Ga0495628_0177525 Ga0495628_0177525_80_886 216
24 3300046518 Ga0495631_0016003 Ga0495631_0016003_1162_1968 216
25 3300046519 Ga0495632_0158896 Ga0495632_0158896_39_845 216
26 3300046520 Ga0495637_0051750 Ga0495637_0051750_859_1665 216
27 3300046526 Ga0495666_0031312 Ga0495666_0031312_1094_1900 216
28 3300046530 Ga0495654_0074969 Ga0495654_0074969_85_891 216
29 3300046538 Ga0495609_0019598 Ga0495609_0019598_442_1248 216
30 3300046542 Ga0495597_0024655 Ga0495597_0024655_11_817 216
31 3300046557 Ga0495622_0014142 Ga0495622_0014142_1843_2649 216
32 3300046616 Ga0495668_0024736 Ga0495668_0024736_2538_3344 216
33 3300046642 Ga0495634_0140358 Ga0495634_0140358_477_1283 216
34 3300046648 Ga0495611_0030465 Ga0495611_0030465_1555_2361 216
35 3300046660 Ga0495625_0032751 Ga0495625_0032751_1618_2424 216
36 3300046663 Ga0495635_0091660 Ga0495635_0091660_808_1614 216
37 3300046665 Ga0495661_0034760 Ga0495661_0034760_435_1241 216
38 3300046674 Ga0495588_0185012 Ga0495588_0185012_248_1054 216
39 3300046689 Ga0495613_0013055 Ga0495613_0013055_1126_1932 216
40 3300046694 Ga0495649_0061829 Ga0495649_0061829_43_849 216
41 3300046794 Ga0495589_0025200 Ga0495589_0025200_1542_2348 216
42 3300047321 Ga0495676_0090086 Ga0495676_0090086_597_1403 216
43 3300047322 Ga0495680_0027405 Ga0495680_0027405_3561_4367 216
44 3300047444 Ga0495675_0132235 Ga0495675_0132235_338_1144 216
45 3300047470 Ga0495681_0033861 Ga0495681_0033861_339_1145 216
46 3300047472 Ga0495686_0040165 Ga0495686_0040165_1925_2731 216
47 3300048091 Ga0495626_0034781 Ga0495626_0034781_912_1718 216
48 3300049459 Ga0495678_021207 Ga0495678_021207_431_1237 216
49 3300046513 Ga0495616_0178405 Ga0495616_0178405_103_909 217
50 3300046515 Ga0495620_0101654 Ga0495620_0101654_301_1095 217
51 3300046522 Ga0495643_0004497 Ga0495643_0004497_5668_6474 217
52 3300046524 Ga0495648_0068173 Ga0495648_0068173_1207_2013 217
53 3300047443 Ga0495687_015942 Ga0495687_015942_2394_3200 217
54 3300047443 Ga0495687_016246 Ga0495687_016246_341_1147 217
55 3300047445 Ga0495677_0027814 Ga0495677_0027814_1230_2036 217
56 3300047447 Ga0495685_015649 Ga0495685_015649_743_1549 217
57 3300046454 Ga0495592_0025667 Ga0495592_0025667_64_783 219
58 3300046459 Ga0495629_0034307 Ga0495629_0034307_208_927 219
59 3300046473 Ga0495582_0030442 Ga0495582_0030442_962_1681 219
60 3300046476 Ga0495662_0014863 Ga0495662_0014863_459_1178 219
61 3300046477 Ga0495664_0000321 Ga0495664_0000321_2796_3515 219
62 3300046517 Ga0495630_0016999 Ga0495630_0016999_3283_4002 219
63 3300046557 Ga0495622_0078377 Ga0495622_0078377_178_897 219
64 3300046559 Ga0495667_0133646 Ga0495667_0133646_176_895 219
65 3300046642 Ga0495634_0001805 Ga0495634_0001805_8979_9698 219
66 3300046663 Ga0495635_0054070 Ga0495635_0054070_712_1431 219
67 3300046675 Ga0495657_0003418 Ga0495657_0003418_679_1398 219
68 3300046680 Ga0495646_0000324 Ga0495646_0000324_12176_12895 219
69 3300046683 Ga0495658_0008765 Ga0495658_0008765_2616_3335 219
70 3300046689 Ga0495613_0000764 Ga0495613_0000764_12226_12945 219
71 3300046809 Ga0495600_0013881 Ga0495600_0013881_1369_2088 219
72 3300047315 Ga0495581_0012921 Ga0495581_0012921_1291_2010 219
73 3300047317 Ga0495604_0004765 Ga0495604_0004765_1298_2017 219
74 3300047319 Ga0495674_0046634 Ga0495674_0046634_703_1422 219
75 3300047673 Ga0495593_0000138 Ga0495593_0000138_25748_26467 219
76 3300048088 Ga0495602_0050092 Ga0495602_0050092_637_1356 219
77 3300049568 Ga0501031_0029479 Ga0501031_0029479_1809_2597 219
78 3300049578 Ga0501042_0044207 Ga0501042_0044207_1548_2351 219
79 3300053095 Ga0500640_001975 Ga0500640_001975_2919_3638 219
80 3300053101 Ga0500553_105382 Ga0500553_105382_264_983 219
81 3300053140 Ga0500573_0025239 Ga0500573_0025239_1701_2420 219
82 3300053157 Ga0500624_003237 Ga0500624_003237_964_1683 219
83 3300025302 Ga0207426_1004063 Ga0207426_10040633 228
84 3300028800 Ga0265338_10152980 Ga0265338_101529802 228
85 3300031241 Ga0265325_10087266 Ga0265325_100872662 228
86 3300031250 Ga0265331_10174127 Ga0265331_101741272 228
87 3300031344 Ga0265316_10312290 Ga0265316_103122902 228
88 3300031711 Ga0265314_10058837 Ga0265314_100588374 228
89 3300049573 Ga0501037_0115786 Ga0501037_0115786_879_1676 229
90 3300049581 Ga0501047_0000029 Ga0501047_0000029_46733_47530 229
91 3300049823 Ga0501044_0162459 Ga0501044_0162459_1049_1840 229
92 3300049823 Ga0501044_0212893 Ga0501044_0212893_578_1375 229
93 iso_pu_bacteria 2997600082 2997603966 229
94 3300046794 Ga0495589_0040939 Ga0495589_0040939_782_1579 230
95 3300047318 Ga0495636_0004280 Ga0495636_0004280_927_1724 230
96 3300031616 Ga0307508_10008024 Ga0307508_100080243 231
97 3300046454 Ga0495592_0003261 Ga0495592_0003261_8390_9193 235
98 3300046455 Ga0495603_0006636 Ga0495603_0006636_6015_6782 235
99 3300046459 Ga0495629_0008081 Ga0495629_0008081_2504_3307 235
100 3300046459 Ga0495629_0009932 Ga0495629_0009932_6037_6804 235
101 3300046462 Ga0495651_0039485 Ga0495651_0039485_33_806 235
102 3300046463 Ga0495653_0411395 Ga0495653_0411395_33_806 235
103 3300046516 Ga0495628_0039915 Ga0495628_0039915_141_944 235
104 3300046529 Ga0495652_0078373 Ga0495652_0078373_1930_2703 235
105 3300046533 Ga0495640_0035840 Ga0495640_0035840_81_884 235
106 3300046675 Ga0495657_0020355 Ga0495657_0020355_2740_3543 235
107 3300046679 Ga0495623_0157998 Ga0495623_0157998_529_1302 235
108 3300046689 Ga0495613_0010964 Ga0495613_0010964_2576_3343 235
109 3300046689 Ga0495613_0015577 Ga0495613_0015577_4485_5288 235
110 3300047315 Ga0495581_0335098 Ga0495581_0335098_55_822 235
111 3300047317 Ga0495604_0001635 Ga0495604_0001635_33_806 235
112 3300047319 Ga0495674_0035840 Ga0495674_0035840_33_806 235
113 3300047321 Ga0495676_0016702 Ga0495676_0016702_133_900 235
114 3300047444 Ga0495675_0049759 Ga0495675_0049759_759_1562 235
115 3300047444 Ga0495675_0170976 Ga0495675_0170976_33_806 235
116 3300048089 Ga0495614_0051602 Ga0495614_0051602_681_1448 235
117 3300048909 Ga0496106_0055877 Ga0496106_0055877_1130_1897 235
118 3300005435 Ga0070714_100034156 Ga0070714_1000341564 236
119 3300025929 Ga0207664_10007088 Ga0207664_100070888 236
120 3300049573 Ga0501037_0035283 Ga0501037_0035283_1451_2233 236
121 3300049579 Ga0501043_0298173 Ga0501043_0298173_261_1043 236
122 3300049581 Ga0501047_0013324 Ga0501047_0013324_6345_7127 236
123 iso_pu_bacteria 2582581313 2585307693 236
124 iso_pu_bacteria 2808606375 2808913834 236
125 iso_pu_bacteria 2954380949 2954383798 236
126 3300046459 Ga0495629_0273254 Ga0495629_0273254_209_982 237
127 3300046674 Ga0495588_0050265 Ga0495588_0050265_860_1633 237
128 3300046692 Ga0495671_0011115 Ga0495671_0011115_2281_3054 237
129 iso_pu_bacteria 2862705112 2862706129 237
130 iso_pu_bacteria 2912723979 2912729963 237
131 iso_pu_bacteria 8008485437 8008487190 237
132 iso_pu_bacteria 8025524527 8025526377 237
133 3300044901 Ga0466960_0292106 Ga0466960_0292106_110_898 238
134 iso_pu_bacteria 2811994917 2812478562 238
135 iso_pu_bacteria 2867369537 2867374031 238
136 iso_pu_bacteria 2867475112 2867475711 238
137 iso_pu_bacteria 2891395885 2891400813 238
138 iso_pu_bacteria 8025478263 8025481134 238
139 iso_pu_bacteria 8054160619 8054165328 238
140 iso_pu_bacteria 8056667051 8056671155 238
141 3300046472 Ga0495580_0064119 Ga0495580_0064119_847_1710 239
142 3300046511 Ga0495608_0004752 Ga0495608_0004752_3205_4053 239
143 3300046531 Ga0495665_0006543 Ga0495665_0006543_5399_6277 239
144 3300046559 Ga0495667_0013977 Ga0495667_0013977_3501_4349 239
145 3300046675 Ga0495657_0007518 Ga0495657_0007518_3906_4754 239
146 3300046689 Ga0495613_0008459 Ga0495613_0008459_2474_3322 239
147 3300047315 Ga0495581_0038231 Ga0495581_0038231_1379_2212 239
148 3300047673 Ga0495593_0003723 Ga0495593_0003723_2619_3467 239
149 3300053085 Ga0495619_0115220 Ga0495619_0115220_793_1641 239
150 iso_pu_bacteria 2582581314 2585320382 239
151 iso_pu_bacteria 2643221587 2643945599 239
152 iso_pu_bacteria 2643221670 2644387105 239
153 iso_pu_bacteria 2643221677 2644434865 239
154 iso_pu_bacteria 2818991472 2819740508 239
155 iso_pu_bacteria 2852635781 2852639673 239
156 iso_pu_bacteria 2918501144 2918506714 239
157 iso_pu_bacteria 2947224130 2947226732 239
158 3300042007 Ga0439449_0029989 Ga0439449_0029989_156_956 240
159 3300044683 Ga0466965_0154013 Ga0466965_0154013_355_1143 240
160 3300044684 Ga0466966_0021365 Ga0466966_0021365_2911_3699 240
161 3300044693 Ga0466961_0009582 Ga0466961_0009582_3715_4503 240
162 3300044693 Ga0466961_0245302 Ga0466961_0245302_217_1029 240
163 3300044901 Ga0466960_0018298 Ga0466960_0018298_1019_1831 240
164 3300046454 Ga0495592_0017717 Ga0495592_0017717_4488_5294 240
165 3300046459 Ga0495629_0036760 Ga0495629_0036760_1496_2293 240
166 3300046473 Ga0495582_0054601 Ga0495582_0054601_52_849 240
167 3300046476 Ga0495662_0011398 Ga0495662_0011398_2859_3656 240
168 3300046476 Ga0495662_0040306 Ga0495662_0040306_358_1155 240
169 3300046533 Ga0495640_0014815 Ga0495640_0014815_3862_4668 240
170 3300046543 Ga0495645_0052093 Ga0495645_0052093_1044_1850 240
171 3300046543 Ga0495645_0054678 Ga0495645_0054678_1696_2493 240
172 3300046543 Ga0495645_0250387 Ga0495645_0250387_137_943 240
173 3300046559 Ga0495667_0046099 Ga0495667_0046099_1456_2262 240
174 3300046674 Ga0495588_0047905 Ga0495588_0047905_1013_1810 240
175 3300046689 Ga0495613_0017682 Ga0495613_0017682_399_1205 240
176 3300046689 Ga0495613_0029756 Ga0495613_0029756_1781_2578 240
177 3300046689 Ga0495613_0189172 Ga0495613_0189172_369_1175 240
178 3300046689 Ga0495613_0195396 Ga0495613_0195396_76_873 240
179 3300047315 Ga0495581_0025831 Ga0495581_0025831_721_1518 240
180 3300047317 Ga0495604_0018626 Ga0495604_0018626_2362_3168 240
181 3300047321 Ga0495676_0086168 Ga0495676_0086168_403_1209 240
182 3300047444 Ga0495675_0006726 Ga0495675_0006726_463_1269 240
183 3300047444 Ga0495675_0020401 Ga0495675_0020401_2730_3527 240
184 3300047673 Ga0495593_0012064 Ga0495593_0012064_2736_3542 240
185 3300048089 Ga0495614_0098441 Ga0495614_0098441_294_1091 240
186 3300048911 Ga0496108_0119579 Ga0496108_0119579_524_1321 240
187 iso_pu_bacteria 2616644814 2616698887 240
188 iso_pu_bacteria 2784132148 2784590590 240
189 3300020082 Ga0206353_11381023 Ga0206353_113810232 241
190 3300044656 Ga0466969_0002075 Ga0466969_0002075_5279_6094 241
191 3300044684 Ga0466966_0003912 Ga0466966_0003912_4286_5101 241
192 3300044684 Ga0466966_0101938 Ga0466966_0101938_683_1471 241
193 3300044693 Ga0466961_0026189 Ga0466961_0026189_1454_2242 241
194 3300044693 Ga0466961_0034458 Ga0466961_0034458_1420_2235 241
195 3300044842 Ga0466957_0066017 Ga0466957_0066017_188_976 241
196 3300045049 Ga0466959_0004517 Ga0466959_0004517_1573_2388 241
197 3300046454 Ga0495592_0029966 Ga0495592_0029966_1241_2059 241
198 3300046455 Ga0495603_0002749 Ga0495603_0002749_3424_4236 241
199 3300046459 Ga0495629_0008022 Ga0495629_0008022_53_865 241
200 3300046476 Ga0495662_0001444 Ga0495662_0001444_5669_6487 241
201 3300046477 Ga0495664_0001529 Ga0495664_0001529_2849_3667 241
202 3300046499 Ga0495594_0010145 Ga0495594_0010145_92_904 241
203 3300046516 Ga0495628_0001058 Ga0495628_0001058_22345_23163 241
204 3300046517 Ga0495630_0060075 Ga0495630_0060075_1634_2452 241
205 3300046526 Ga0495666_0006306 Ga0495666_0006306_2389_3207 241
206 3300046533 Ga0495640_0015224 Ga0495640_0015224_1072_1890 241
207 3300046535 Ga0495586_0010052 Ga0495586_0010052_1207_2025 241
208 3300046536 Ga0495587_0009945 Ga0495587_0009945_2058_2876 241
209 3300046543 Ga0495645_0008953 Ga0495645_0008953_3009_3827 241
210 3300046557 Ga0495622_0046989 Ga0495622_0046989_375_1187 241
211 3300046642 Ga0495634_0012045 Ga0495634_0012045_909_1727 241
212 3300046663 Ga0495635_0059434 Ga0495635_0059434_183_1001 241
213 3300046678 Ga0495599_0005135 Ga0495599_0005135_6060_6878 241
214 3300046809 Ga0495600_0003746 Ga0495600_0003746_5400_6218 241
215 3300047318 Ga0495636_0109200 Ga0495636_0109200_97_909 241
216 3300047321 Ga0495676_0032354 Ga0495676_0032354_2220_3032 241
217 3300047471 Ga0495684_0071886 Ga0495684_0071886_183_1001 241
218 3300048088 Ga0495602_0069023 Ga0495602_0069023_1696_2514 241
219 3300053077 Ga0495601_0004899 Ga0495601_0004899_3179_3997 241
220 iso_pu_bacteria 2582581312 2585297485 241
221 iso_pu_bacteria 2808606982 2811844173 241
222 iso_pu_bacteria 2995463766 2995466991 241
223 3300003316 rootH1_10041734 rootH1_100417345 242
224 3300011119 Ga0105246_10362851 Ga0105246_103628512 242
225 3300021388 Ga0213875_10121798 Ga0213875_101217981 242
226 3300025302 Ga0207426_1020431 Ga0207426_10204312 242
227 3300031241 Ga0265325_10022643 Ga0265325_100226432 242
228 3300031649 Ga0307514_10077210 Ga0307514_100772103 242
229 3300037853 Ga0436364_0771821 Ga0436364_0771821_624_1475 242
230 3300046648 Ga0495611_0003698 Ga0495611_0003698_35_850 242
231 3300047318 Ga0495636_0003378 Ga0495636_0003378_3845_4696 242
232 3300047443 Ga0495687_008980 Ga0495687_008980_4729_5580 242
233 3300050510 nmdc:mga06r32_240897_c1 nmdc:mga06r32_240897_c1_111_908 242
234 iso_pu_bacteria 2616644941 2616903814 242
235 iso_pu_bacteria 2643221548 2643761482 242
236 iso_pu_bacteria 2643221682 2644458817 242
237 iso_pu_bacteria 2862290372 2862294735 242
238 iso_pu_bacteria 2867428634 2867430391 242
239 iso_pu_bacteria 2966598605 2966600646 242
240 iso_pu_bacteria 2990088156 2990092915 242
241 iso_pu_bacteria 3006425503 3006426568 242
242 iso_pu_bacteria 8023623736 8023624802 242
243 iso_pu_bacteria 8025530807 8025532619 242
244 3300044658 Ga0466972_0126273 Ga0466972_0126273_381_1193 243
245 iso_pu_bacteria 2862507626 2862508988 243
246 3300031507 Ga0307509_10200860 Ga0307509_102008602 244
247 3300031507 Ga0307509_10261120 Ga0307509_102611202 244
248 3300031616 Ga0307508_10048153 Ga0307508_100481533 244
249 3300033179 Ga0307507_10019522 Ga0307507_1001952210 244
250 3300033180 Ga0307510_10006792 Ga0307510_100067928 244
251 3300033180 Ga0307510_10148684 Ga0307510_101486841 244
252 3300044656 Ga0466969_0008468 Ga0466969_0008468_2000_2815 244
253 3300044683 Ga0466965_0000614 Ga0466965_0000614_10621_11436 244
254 3300044684 Ga0466966_0007105 Ga0466966_0007105_2817_3632 244
255 3300044693 Ga0466961_0000389 Ga0466961_0000389_344_1159 244
256 3300044694 Ga0466963_0004618 Ga0466963_0004618_2546_3361 244
257 3300044706 Ga0466964_0030885 Ga0466964_0030885_739_1554 244
258 3300044719 Ga0466971_0010491 Ga0466971_0010491_824_1639 244
259 3300044765 Ga0466970_0001377 Ga0466970_0001377_321_1136 244
260 3300044842 Ga0466957_0010382 Ga0466957_0010382_2101_2916 244
261 3300045049 Ga0466959_0000365 Ga0466959_0000365_3917_4732 244
262 3300045836 Ga0466958_0000185 Ga0466958_0000185_12080_12895 244
263 3300045976 Ga0466967_0376112 Ga0466967_0376112_432_1247 244
264 3300049569 Ga0501032_0374154 Ga0501032_0374154_80_889 244
265 3300049570 Ga0501033_0006059 Ga0501033_0006059_108_917 244
266 3300049571 Ga0501034_0002789 Ga0501034_0002789_8257_9066 244
267 3300049572 Ga0501036_0035488 Ga0501036_0035488_85_894 244
268 3300049573 Ga0501037_0144744 Ga0501037_0144744_150_959 244
269 3300049575 Ga0501039_0108802 Ga0501039_0108802_133_942 244
270 3300049579 Ga0501043_0045521 Ga0501043_0045521_1270_2079 244
271 3300049581 Ga0501047_0115206 Ga0501047_0115206_1419_2228 244
272 3300049586 Ga0501070_0003598 Ga0501070_0003598_3305_4114 244
273 3300049590 Ga0501074_0006540 Ga0501074_0006540_3647_4456 244
274 3300049822 Ga0501035_0005880 Ga0501035_0005880_8441_9250 244
275 3300049823 Ga0501044_0004269 Ga0501044_0004269_6834_7643 244
276 3300049823 Ga0501044_0137167 Ga0501044_0137167_385_1194 244
277 3300053088 Ga0500644_0006739 Ga0500644_0006739_470_1264 244
278 3300053092 Ga0500583_0047867 Ga0500583_0047867_929_1723 244
279 3300053100 Ga0500660_099133 Ga0500660_099133_354_1148 244
280 3300061719 Ga0466962_0027782 Ga0466962_0027782_1511_2326 244
281 3300011119 Ga0105246_10031384 Ga0105246_100313842 245
282 3300028786 Ga0307517_10000616 Ga0307517_1000061645 245
283 3300030521 Ga0307511_10111983 Ga0307511_101119832 245
284 3300041404 Ga0439436_0011648 Ga0439436_0011648_143_940 245
285 3300042002 Ga0439442_004140 Ga0439442_004140_1777_2574 245
286 3300042007 Ga0439449_0017921 Ga0439449_0017921_603_1409 245
287 3300042014 Ga0439457_005484 Ga0439457_005484_1732_2529 245
288 3300042015 Ga0439462_0011461 Ga0439462_0011461_477_1274 245
289 3300046455 Ga0495603_0021866 Ga0495603_0021866_431_1276 245
290 3300046455 Ga0495603_0054862 Ga0495603_0054862_913_1758 245
291 3300046660 Ga0495625_0174928 Ga0495625_0174928_189_1034 245
292 iso_pu_bacteria 2643221578 2643899434 245
293 iso_pu_bacteria 2643221673 2644406830 245
294 iso_pu_bacteria 2862574272 2862574786 245
295 iso_pu_bacteria 2946045630 2946047610 245
296 3300003578 Ga0006562J51391_1119201 Ga0006562J51391_11192011 246
297 3300006948 Ga0099826_10060742 Ga0099826_100607422 246
298 3300030522 Ga0307512_10005071 Ga0307512_100050712 246
299 3300033179 Ga0307507_10082750 Ga0307507_100827502 246
300 3300047470 Ga0495681_0000245 Ga0495681_0000245_40525_41358 246
301 3300049822 Ga0501035_0169876 Ga0501035_0169876_520_1332 246
302 3300053109 Ga0500569_020646 Ga0500569_020646_882_1715 246
303 3300053149 Ga0500600_0077342 Ga0500600_0077342_960_1793 246
304 3300053160 Ga0500633_0000496 Ga0500633_0000496_929_1762 246
305 iso_pu_bacteria 3006493962 3006494738 246
306 3300037466 Ga0395898_0020289 Ga0395898_0020289_5848_6666 247
307 3300046460 Ga0495638_0098295 Ga0495638_0098295_130_1005 247
308 3300049568 Ga0501031_0001482 Ga0501031_0001482_1431_2279 247
309 3300049569 Ga0501032_0001172 Ga0501032_0001172_3872_4720 247
310 3300049570 Ga0501033_0002969 Ga0501033_0002969_7423_8271 247
311 3300049571 Ga0501034_0004598 Ga0501034_0004598_9298_10146 247
312 3300049572 Ga0501036_0023658 Ga0501036_0023658_4145_4993 247
313 3300049573 Ga0501037_0002681 Ga0501037_0002681_6850_7698 247
314 3300049574 Ga0501038_0003478 Ga0501038_0003478_4023_4871 247
315 3300049575 Ga0501039_0027398 Ga0501039_0027398_3456_4304 247
316 3300049576 Ga0501040_0005884 Ga0501040_0005884_3456_4304 247
317 3300049577 Ga0501041_0006379 Ga0501041_0006379_333_1181 247
318 3300049578 Ga0501042_0008409 Ga0501042_0008409_5757_6605 247
319 3300049579 Ga0501043_0002472 Ga0501043_0002472_9678_10526 247
320 3300049580 Ga0501046_0006949 Ga0501046_0006949_3980_4828 247
321 3300049581 Ga0501047_0000880 Ga0501047_0000880_11057_11905 247
322 3300049582 Ga0501048_0000605 Ga0501048_0000605_15874_16722 247
323 3300049583 Ga0501067_0001602 Ga0501067_0001602_184_1032 247
324 3300049584 Ga0501068_0000050 Ga0501068_0000050_1709_2557 247
325 3300049585 Ga0501069_0009346 Ga0501069_0009346_4095_4943 247
326 3300049586 Ga0501070_0003159 Ga0501070_0003159_12748_13596 247
327 3300049587 Ga0501071_0001184 Ga0501071_0001184_78_926 247
328 3300049588 Ga0501072_0007454 Ga0501072_0007454_7336_8184 247
329 3300049589 Ga0501073_0124255 Ga0501073_0124255_735_1583 247
330 3300049590 Ga0501074_0004536 Ga0501074_0004536_634_1482 247
331 3300049592 Ga0501076_0011207 Ga0501076_0011207_611_1459 247
332 3300049593 Ga0501077_0003467 Ga0501077_0003467_7099_7947 247
333 3300049741 Ga0501079_0023516 Ga0501079_0023516_3447_4295 247
334 3300049742 Ga0501080_0030525 Ga0501080_0030525_572_1420 247
335 3300049744 Ga0501083_0001220 Ga0501083_0001220_10809_11657 247
336 3300049822 Ga0501035_0001220 Ga0501035_0001220_16392_17240 247
337 3300049823 Ga0501044_0001475 Ga0501044_0001475_16943_17791 247
338 3300049824 Ga0501045_0189554 Ga0501045_0189554_451_1299 247
339 3300054114 Ga0501084_0142213 Ga0501084_0142213_735_1583 247
340 3300060353 Ga0501082_0005576 Ga0501082_0005576_9613_10461 247
341 3300061734 Ga0530510_0082890 Ga0530510_0082890_472_1320 247
342 iso_pu_bacteria 2643221714 2644629796 247
343 iso_pu_bacteria 2808606359 2808844215 247
344 iso_pu_bacteria 2919468124 2919472444 247
345 3300001990 JGI24737J22298_10014762 JGI24737J22298_100147623 248
346 3300002067 JGI24735J21928_10045616 JGI24735J21928_100456162 248
347 3300002075 JGI24738J21930_10028566 JGI24738J21930_100285661 248
348 3300003578 Ga0006562J51391_1089772 Ga0006562J51391_10897722 248
349 3300005937 Ga0081455_10116413 Ga0081455_101164132 248
350 3300015265 Ga0182005_1008835 Ga0182005_10088352 248
351 3300025904 Ga0207647_10039036 Ga0207647_100390362 248
352 3300025935 Ga0207709_10076647 Ga0207709_100766473 248
353 3300025949 Ga0207667_10133460 Ga0207667_101334602 248
354 3300031838 Ga0307518_10209598 Ga0307518_102095982 248
355 3300047318 Ga0495636_0000812 Ga0495636_0000812_8008_8814 248
356 3300049574 Ga0501038_0002035 Ga0501038_0002035_929_1756 248
357 3300049580 Ga0501046_0107891 Ga0501046_0107891_754_1581 248
358 3300049582 Ga0501048_0197810 Ga0501048_0197810_581_1408 248
359 3300049589 Ga0501073_0108349 Ga0501073_0108349_495_1322 248
360 3300049742 Ga0501080_0091102 Ga0501080_0091102_567_1394 248
361 3300049823 Ga0501044_0016800 Ga0501044_0016800_3472_4299 248

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08543

Phos_pyr_kin

Phosphomethylpyrimidine kinase

32

274

0.98

PF00294

PfkB

pfkB family carbohydrate kinase

65

262

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4c5k-assembly2.cif.gz_C structure of the pyridoxal kinase from staphylococcus aureus in complex with adp 0.8788 2 242
2i5b-assembly1.cif.gz_B the crystal structure of an adp complex of bacillus subtilis pyridoxal kinase provides evidence for the parralel emergence of enzyme activity during evolution 0.877 3 243
4c5m-assembly2.cif.gz_C structure of the pyridoxal kinase from staphylococcus aureus in complex with amp-pcp 0.8752 2 242
4c5n-assembly1.cif.gz_A structure of the pyridoxal kinase from staphylococcus aureus in complex with amp-pcp and pyridoxal 0.8746 2 242
4c5m-assembly2.cif.gz_A structure of the pyridoxal kinase from staphylococcus aureus in complex with amp-pcp 0.8688 2 242
ID Description Score Start End Superfamily
af_P9WG77_1_265_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8931 3 241 3.40.1190.20
2i5bB00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.877 3 243 3.40.1190.20
af_O94266_18_315_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8701 1 242 3.40.1190.20
af_C6KT01_294_485_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8663 109 224 3.40.1190.20
af_Q2FWG1_2_274_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8655 4 243 3.40.1190.20
ID Description Score Start End GO Terms
AF-A0A6B3H3U7-F1-model_v4 Bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase 0.9689 111 179 GO:0005829
GO:0008902
GO:0008972
GO:0009228
AF-A0A6B3H3U7-F1-model_v4 Bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase 0.9554 111 179 GO:0005829
GO:0008902
GO:0008972
GO:0009228
AF-A0A538C401-F1-model_v4 Bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase 0.951 110 217 GO:0005829
GO:0008902
GO:0008972
GO:0009228
AF-A0A6G3X160-F1-model_v4 Bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase 0.9501 103 180 GO:0005829
GO:0008902
GO:0008972
GO:0009228
AF-A0A7C4HPI0-F1-model_v4 Pyridoxamine kinase/Phosphomethylpyrimidine kinase domain-containing protein 0.9305 103 224 GO:0005829
GO:0008902
GO:0008972
GO:0009228
GO:0009229

Feature Viewer

pLDDT pTM Quality
73.05 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map