F422347

General Info

Members Datasets Scaffolds Average Seq Length
361 221 722 281

Family's Representative Sequence

Representative Sequence 3300046615|Ga0495656_0094244|Ga0495656_0094244_202_1143
Length 313
Sequence MDGDRRVPIHYLLPDMHPLAPQSTGLGLRRALLDELQSAPAGDFDFLECAPENWIGVGGKFGEALETLAAKHPLVCHGLSLSLGGFAPLDETFLGRVHRFLERHDVALYSEHLSYCADDGQLYDLLPIPFTEEAVHFVAARIRQAQDILGRRIAVENVSYYAAPHQAMREIDFINAVLAEADCDLLLDVNNIHVNAINHRYDAHEFLSRLPGERIAYIHIAGHYDEAEDLKVDTHGAPVKDAVWQLLGAAYAQFGLRPTLLERDFNIPPYAELVAELDTIRSVMRGAVMRRSAMSDEAHDASAGSAQARHVRA

Samples

Sample ID Description Type Environment
1 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
6 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
10 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
42 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
65 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
67 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
109 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
110 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
111 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
112 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
113 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
116 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
117 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
122 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
123 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
124 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
125 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
126 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
127 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
128 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
129 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
130 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
131 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
132 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
133 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
134 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
135 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
136 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
137 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
138 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
139 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
140 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
141 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
142 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
143 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
144 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
145 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
146 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
147 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
148 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
149 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
150 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
151 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
152 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
153 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
158 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
159 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
160 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
161 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
175 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
176 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
177 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
178 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
179 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
180 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
181 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
182 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
183 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
184 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
187 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
188 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
189 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
190 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
191 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
192 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
193 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
194 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
195 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
196 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
197 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
198 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
199 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
200 2639762793 Acinetobacter calcoaceticus GK1 Isolate Rhizosphere
201 2643221559 Lysobacter sp. Root559 Isolate Unclassified
202 2643221573 Lysobacter sp. Root604 Isolate Unclassified
203 2643221586 Lysobacter sp. Root667 Isolate Unclassified
204 2643221593 Lysobacter sp. Root690 Isolate Unclassified
205 2643221612 Lysobacter sp. Root76 Isolate Unclassified
206 2643221695 Lysobacter sp. Root494 Isolate Unclassified
207 2643221720 Lysobacter sp. Root916 Isolate Unclassified
208 2643221727 Lysobacter sp. Root96 Isolate Unclassified
209 2643221728 Lysobacter sp. Root983 Isolate Unclassified
210 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
211 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
212 2916699645 Acinetobacter ursingii M3 Isolate Unclassified
213 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
214 2919506607 Acinetobacter sp. 3657 Isolate Unclassified
215 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
216 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
217 2984568884 Acinetobacter baylyi SORGH_AS893 Isolate Aerial Root
218 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
219 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
220 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
221 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.58
Metatranscriptomes 1.66
Isolates 7.76

Biome Distribution

Category Percentage (%)
Aerial Root 0.28
Bulb 0
Endosphere 10.53
Nodule 0
Rhizoplane 3.05
Rhizosphere 78.95
Stem 0
Stem Tuber 0
Unclassified 0.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495656_0094244 3300046615 Bacteria 1374
2 SwRhRL2b_contig_866076 2162886007 Bacteria 3122
3 JGI25151J46595_10046933 3300003187 Bacteria 1508
4 Ga0055526_1011090 3300003771 Bacteria 4110
5 Ga0055524_1016300 3300003775 Bacteria 2672
6 Ga0055524_1018180 3300003775 Bacteria 2449
7 Ga0055536_1001429 3300003781 Bacteria 14400
8 Ga0055536_1016148 3300003781 Bacteria 2512
9 Ga0055530_10003425 3300003791 Bacteria 9026
10 Ga0055531_10007190 3300003794 Bacteria 6126
11 Ga0055531_10009640 3300003794 Bacteria 4912
12 Ga0055531_10027963 3300003794 Bacteria 1959
13 Ga0058692_1000010 3300003856 Bacteria 326761
14 Ga0065703_1000085 3300005272 Bacteria 35545
15 Ga0065704_10108321 3300005289 Bacteria 2032
16 Ga0070690_100097229 3300005330 Bacteria 1947
17 Ga0070670_100128414 3300005331 Bacteria 2188
18 Ga0070666_10000331 3300005335 Bacteria 29851
19 Ga0070680_100230338 3300005336 Bacteria 1565
20 Ga0070661_100248314 3300005344 Bacteria 1372
21 Ga0070668_100023972 3300005347 Bacteria 4620
22 Ga0070671_100260855 3300005355 Bacteria 1473
23 Ga0070667_100012939 3300005367 Bacteria 6898
24 Ga0070667_100028757 3300005367 Bacteria 4628
25 Ga0070667_100157162 3300005367 Bacteria 2000
26 Ga0070667_100257419 3300005367 Bacteria 1562
27 Ga0070667_100506366 3300005367 Bacteria 1107
28 Ga0070710_10090709 3300005437 Bacteria 1802
29 Ga0070663_100027042 3300005455 Bacteria 3891
30 Ga0070663_100181630 3300005455 Bacteria 1632
31 Ga0070678_100051047 3300005456 Bacteria 2995
32 Ga0068867_100028381 3300005459 Bacteria 4029
33 Ga0068853_100001578 3300005539 Bacteria 16612
34 Ga0068853_100003021 3300005539 Bacteria 12850
35 Ga0068853_100006652 3300005539 Bacteria 9205
36 Ga0068853_100016432 3300005539 Bacteria 6090
37 Ga0070693_100129085 3300005547 Bacteria 1578
38 Ga0070665_100000077 3300005548 Bacteria 188308
39 Ga0070665_100316649 3300005548 Bacteria 1564
40 Ga0070665_100389811 3300005548 Bacteria 1401
41 Ga0070665_100392452 3300005548 Bacteria 1396
42 Ga0068855_100001307 3300005563 Bacteria 30848
43 Ga0068857_100037641 3300005577 Bacteria 4287
44 Ga0068857_100093202 3300005577 Bacteria 2697
45 Ga0068857_100324712 3300005577 Bacteria 1422
46 Ga0068854_100232556 3300005578 Bacteria 1464
47 Ga0068856_100013080 3300005614 Bacteria 8038
48 Ga0068859_100000125 3300005617 Bacteria 72938
49 Ga0068864_100023774 3300005618 Bacteria 5148
50 Ga0068864_100027048 3300005618 Bacteria 4840
51 Ga0068864_100221580 3300005618 Bacteria 1745
52 Ga0068851_10072398 3300005834 Bacteria 1785
53 Ga0068851_10087628 3300005834 Bacteria 1635
54 Ga0068863_100006425 3300005841 Bacteria 11525
55 Ga0068863_100007309 3300005841 Bacteria 10814
56 Ga0068863_100047333 3300005841 Bacteria 4079
57 Ga0068863_100074119 3300005841 Bacteria 3220
58 Ga0068858_100088069 3300005842 Bacteria 2888
59 Ga0068860_100076227 3300005843 Bacteria 3189
60 Ga0068860_100081726 3300005843 Bacteria 3072
61 Ga0068860_100155655 3300005843 Bacteria 2202
62 Ga0068860_100164866 3300005843 Bacteria 2139
63 Ga0068862_100362743 3300005844 Bacteria 1347
64 Ga0097621_100103657 3300006237 Bacteria 2396
65 Ga0068871_100076000 3300006358 Bacteria 2773
66 Ga0068871_100156126 3300006358 Bacteria 1948
67 Ga0068871_100188739 3300006358 Bacteria 1774
68 Ga0097620_100000125 3300006931 Bacteria 72938
69 Ga0105251_10028908 3300009011 Bacteria 2797
70 Ga0105250_10003407 3300009092 Bacteria 7539
71 Ga0105250_10120727 3300009092 Bacteria 1077
72 Ga0105247_10197557 3300009101 Bacteria 1350
73 Ga0105241_10111796 3300009174 Bacteria 2188
74 Ga0105248_10338975 3300009177 Bacteria 1693
75 Ga0105237_10017013 3300009545 Bacteria 7547
76 Ga0105237_10430915 3300009545 Bacteria 1324
77 Ga0105238_10015092 3300009551 Bacteria 7823
78 Ga0105238_10047568 3300009551 Bacteria 4324
79 Ga0105239_10006032 3300010375 Bacteria 14100
80 Ga0105239_10007974 3300010375 Bacteria 12096
81 Ga0105239_10015701 3300010375 Bacteria 8381
82 Ga0105239_10043180 3300010375 Bacteria 4940
83 Ga0105239_10065209 3300010375 Bacteria 3999
84 Ga0105239_10090667 3300010375 Bacteria 3373
85 Ga0105239_10140964 3300010375 Bacteria 2686
86 Ga0105239_10732308 3300010375 Bacteria 1131
87 Ga0157327_1003764 3300012512 Bacteria 1137
88 Ga0157373_10195823 3300013100 Bacteria 1424
89 Ga0157371_10002803 3300013102 Bacteria 16340
90 Ga0157371_10072572 3300013102 Bacteria 2437
91 Ga0157370_10049229 3300013104 Bacteria 4034
92 Ga0157369_10000148 3300013105 Bacteria 100073
93 Ga0157374_10238783 3300013296 Bacteria 1787
94 Ga0157374_10292594 3300013296 Bacteria 1610
95 Ga0157378_10010725 3300013297 Bacteria 8010
96 Ga0157378_10184901 3300013297 Bacteria 1962
97 Ga0157372_10030771 3300013307 Bacteria 5873
98 Ga0157372_10150437 3300013307 Bacteria 2686
99 Ga0157375_10006205 3300013308 Bacteria 10407
100 Ga0163163_10001490 3300014325 Bacteria 19831
101 Ga0163163_10036046 3300014325 Bacteria 4802
102 Ga0157379_10001878 3300014968 Bacteria 17378
103 Ga0157376_10485285 3300014969 Bacteria 1212
104 Ga0183360_10001 3300015689 Bacteria 3943671
105 Ga0163161_10008353 3300017792 Bacteria 7167
106 Ga0206356_11742576 3300020070 Bacteria 1448
107 Ga0207425_1006536 3300025245 Bacteria 3178
108 Ga0209673_1025022 3300025273 Bacteria 1993
109 Ga0209130_1006439 3300025284 Bacteria 3816
110 Ga0209676_1000891 3300025292 Bacteria 38072
111 Ga0209676_1005741 3300025292 Bacteria 6365
112 Ga0209676_1007986 3300025292 Bacteria 4828
113 Ga0209676_1020126 3300025292 Bacteria 2275
114 Ga0209676_1027113 3300025292 Bacteria 1807
115 Ga0209025_1000015 3300025294 Bacteria 808120
116 Ga0209025_1009608 3300025294 Bacteria 6709
117 Ga0209025_1045970 3300025294 Bacteria 1803
118 Ga0209050_1001146 3300025298 Bacteria 31752
119 Ga0209050_1037881 3300025298 Bacteria 1383
120 Ga0209256_1003633 3300025299 Bacteria 10570
121 Ga0209256_1008113 3300025299 Bacteria 4952
122 Ga0209256_1018065 3300025299 Bacteria 2312
123 Ga0209051_1029013 3300025303 Bacteria 2174
124 Ga0209257_1000988 3300025304 Bacteria 38563
125 Ga0209257_1001062 3300025304 Bacteria 36333
126 Ga0209257_1001230 3300025304 Bacteria 31830
127 Ga0209257_1002757 3300025304 Bacteria 16616
128 Ga0209257_1024520 3300025304 Bacteria 2086
129 Ga0207656_10019520 3300025321 Bacteria 2683
130 Ga0207696_1001458 3300025711 Bacteria 12823
131 Ga0207655_1015010 3300025728 Bacteria 4337
132 Ga0207692_10110871 3300025898 Bacteria 1521
133 Ga0207680_10166135 3300025903 Bacteria 1483
134 Ga0207705_10126044 3300025909 Bacteria 1903
135 Ga0207695_10047781 3300025913 Bacteria 4525
136 Ga0207695_10122498 3300025913 Bacteria 2567
137 Ga0207671_10004644 3300025914 Bacteria 13008
138 Ga0207671_10060348 3300025914 Bacteria 2813
139 Ga0207671_10198172 3300025914 Bacteria 1567
140 Ga0207660_10117197 3300025917 Bacteria 2012
141 Ga0207649_10079139 3300025920 Bacteria 2123
142 Ga0207694_10001145 3300025924 Bacteria 23004
143 Ga0207694_10008358 3300025924 Bacteria 7823
144 Ga0207650_10318481 3300025925 Bacteria 1273
145 Ga0207687_10400877 3300025927 Bacteria 1128
146 Ga0207644_10056423 3300025931 Bacteria 2834
147 Ga0207704_10006628 3300025938 Bacteria 5420
148 Ga0207691_10193837 3300025940 Bacteria 1771
149 Ga0207711_10399258 3300025941 Bacteria 1277
150 Ga0207679_10068485 3300025945 Bacteria 2666
151 Ga0207667_10001994 3300025949 Bacteria 25606
152 Ga0207667_10146678 3300025949 Bacteria 2429
153 Ga0207668_10072352 3300025972 Bacteria 2466
154 Ga0207658_10009033 3300025986 Bacteria 6760
155 Ga0207658_10279644 3300025986 Bacteria 1430
156 Ga0207703_10057050 3300026035 Bacteria 3183
157 Ga0207703_10251301 3300026035 Bacteria 1594
158 Ga0207639_10000374 3300026041 Bacteria 30955
159 Ga0207639_10001926 3300026041 Bacteria 13943
160 Ga0207639_10007071 3300026041 Bacteria 7655
161 Ga0207678_10003166 3300026067 Bacteria 14878
162 Ga0207678_10042614 3300026067 Bacteria 3931
163 Ga0207702_10010284 3300026078 Bacteria 7838
164 Ga0207641_10052403 3300026088 Bacteria 3455
165 Ga0207641_10057482 3300026088 Bacteria 3308
166 Ga0207641_10060667 3300026088 Bacteria 3224
167 Ga0207676_10014126 3300026095 Bacteria 5736
168 Ga0207674_10017282 3300026116 Bacteria 7870
169 Ga0207674_10117801 3300026116 Bacteria 2626
170 Ga0207674_10154974 3300026116 Bacteria 2246
171 Ga0207683_10316023 3300026121 Bacteria 1430
172 Ga0209371_1000006 3300027312 Bacteria 1055642
173 Ga0268266_10000001 3300028379 Bacteria 4040580
174 Ga0268266_10185751 3300028379 Bacteria 1895
175 Ga0268265_10126623 3300028380 Bacteria 2115
176 Ga0268265_10164391 3300028380 Bacteria 1890
177 Ga0268264_10013742 3300028381 Bacteria 6659
178 Ga0268264_10208789 3300028381 Bacteria 1791
179 Ga0268264_10390755 3300028381 Bacteria 1334
180 Ga0268256_1000007 3300030500 Bacteria 1055326
181 Ga0307408_100000426 3300031548 Bacteria 37499
182 Ga0307408_100004051 3300031548 Bacteria 9994
183 Ga0307408_100040375 3300031548 Bacteria 3304
184 Ga0307408_100202656 3300031548 Bacteria 1607
185 Ga0307508_10246386 3300031616 Bacteria 1384
186 Ga0316575_10000762 3300031665 Bacteria 9711
187 Ga0316575_10002328 3300031665 Bacteria 6359
188 Ga0316575_10071081 3300031665 Bacteria 1398
189 Ga0316576_10017624 3300031727 Bacteria 4857
190 Ga0307516_10127101 3300031730 Bacteria 2333
191 Ga0307405_10093721 3300031731 Bacteria 1996
192 Ga0307405_10271794 3300031731 Bacteria 1271
193 Ga0307406_10001712 3300031901 Bacteria 12061
194 Ga0307406_10006263 3300031901 Bacteria 6556
195 Ga0307412_10034374 3300031911 Bacteria 3231
196 Ga0307412_10041654 3300031911 Bacteria 2978
197 Ga0307414_10159846 3300032004 Bacteria 1788
198 Ga0316585_10031582 3300032137 Bacteria 1666
199 Ga0316593_10045653 3300032168 Bacteria 1469
200 Ga0316593_10055287 3300032168 Bacteria 1349
201 Ga0316586_1004141 3300033527 Bacteria 1958
202 Ga0316587_1003599 3300033529 Bacteria 2185
203 Ga0316596_1022646 3300033541 Bacteria 1607
204 Ga0316574_0022400 3300035398 Bacteria 3760
205 Ga0316574_0052552 3300035398 Bacteria 2541
206 Ga0316574_0117045 3300035398 Bacteria 1710
207 Ga0316574_0196037 3300035398 Bacteria 1298
208 Ga0316574_0318174 3300035398 Bacteria 988
209 Ga0316582_0014763 3300036647 Bacteria 4445
210 Ga0316582_0107528 3300036647 Bacteria 1853
211 Ga0316582_0131320 3300036647 Bacteria 1682
212 Ga0316584_0005026 3300036712 Bacteria 8816
213 Ga0316584_0021346 3300036712 Bacteria 4706
214 Ga0316584_0035793 3300036712 Bacteria 3683
215 Ga0316584_0410648 3300036712 Bacteria 963
216 Ga0316581_0024254 3300037588 Bacteria 1797
217 Ga0439436_0006361 3300041404 Bacteria 3626
218 Ga0439436_0010500 3300041404 Bacteria 2822
219 Ga0439439_0001798 3300041406 Bacteria 4382
220 Ga0439447_013563 3300041407 Bacteria 2309
221 Ga0439466_0045155 3300041411 Bacteria 1457
222 Ga0451789_0522891 3300041443 Bacteria 1369
223 Ga0451791_0790747 3300041451 Bacteria 4124
224 Ga0451791_0954774 3300041451 Bacteria 1004
225 Ga0451800_0974983 3300041459 Bacteria 1441
226 Ga0451807_0166283 3300041486 Bacteria 2099
227 Ga0451837_0656537 3300041494 Bacteria 2945
228 Ga0451853_2447817 3300041512 Bacteria 2260
229 Ga0451853_3880754 3300041512 Bacteria 2757
230 Ga0439432_000213 3300042006 Bacteria 20721
231 Ga0439432_002010 3300042006 Bacteria 7701
232 Ga0439432_007686 3300042006 Bacteria 3814
233 Ga0439432_043745 3300042006 Bacteria 1412
234 Ga0439449_0002588 3300042007 Bacteria 7057
235 Ga0439449_0010587 3300042007 Bacteria 3484
236 Ga0439452_019570 3300042010 Bacteria 1788
237 Ga0450911_000002 3300042115 Bacteria 277703
238 Ga0450904_000035 3300042139 Bacteria 30443
239 Ga0439446_0000026 3300042156 Bacteria 25155
240 Ga0439459_0004123 3300042438 Bacteria 2326
241 Ga0451577_0038345 3300042876 Bacteria 4310
242 Ga0451577_0494096 3300042876 Bacteria 1111
243 Ga0466972_0001350 3300044658 Bacteria 11881
244 Ga0453684_0000468 3300044712 Bacteria 160571
245 Ga0466970_0003008 3300044765 Bacteria 8177
246 Ga0451576_0000177 3300045051 Bacteria 160589
247 Ga0495643_0013183 3300046522 Bacteria 4958
248 Ga0495663_0001196 3300046525 Bacteria 8365
249 Ga0495621_0092696 3300046539 Bacteria 1140
250 Ga0495656_0005241 3300046615 Bacteria 4468
251 Ga0495656_0022250 3300046615 Bacteria 2480
252 Ga0495670_0090255 3300046691 Bacteria 1568
253 Ga0495670_0154887 3300046691 Bacteria 1202
254 Ga0495671_0009293 3300046692 Bacteria 5494
255 Ga0495636_0009911 3300047318 Bacteria 3752
256 Ga0495636_0018793 3300047318 Bacteria 2773
257 Ga0495685_010164 3300047447 Bacteria 3154
258 Ga0496110_0358097 3300048913 Bacteria 1329
259 Ga0496113_0447573 3300048916 Bacteria 1038
260 Ga0496115_0127697 3300048918 Bacteria 2095
261 Ga0496117_0029087 3300048920 Bacteria 4266
262 Ga0496118_0001297 3300048921 Bacteria 38064
263 Ga0496118_0048094 3300048921 Bacteria 3299
264 Ga0496124_0044338 3300048927 Bacteria 3816
265 Ga0496126_0059203 3300048929 Bacteria 3450
266 Ga0501031_0072566 3300049568 Bacteria 2241
267 Ga0501031_0080898 3300049568 Bacteria 2117
268 Ga0501032_0052504 3300049569 Bacteria 2746
269 Ga0501032_0166857 3300049569 Bacteria 1444
270 Ga0501033_0007083 3300049570 Bacteria 8753
271 Ga0501033_0030118 3300049570 Bacteria 4077
272 Ga0501033_0215961 3300049570 Bacteria 1366
273 Ga0501034_0024148 3300049571 Bacteria 6184
274 Ga0501034_0120206 3300049571 Bacteria 2613
275 Ga0501034_0132671 3300049571 Bacteria 2473
276 Ga0501036_0002681 3300049572 Bacteria 14045
277 Ga0501036_0021518 3300049572 Bacteria 5422
278 Ga0501037_0006486 3300049573 Bacteria 8557
279 Ga0501037_0085210 3300049573 Bacteria 2287
280 Ga0501037_0113131 3300049573 Bacteria 1954
281 Ga0501038_0000458 3300049574 Bacteria 35717
282 Ga0501038_0009912 3300049574 Bacteria 8723
283 Ga0501038_0078736 3300049574 Bacteria 2781
284 Ga0501039_0095035 3300049575 Bacteria 2323
285 Ga0501039_0150918 3300049575 Bacteria 1825
286 Ga0501040_0040055 3300049576 Bacteria 3188
287 Ga0501042_0228118 3300049578 Bacteria 1343
288 Ga0501043_0010475 3300049579 Bacteria 7261
289 Ga0501043_0018803 3300049579 Bacteria 5423
290 Ga0501043_0269529 3300049579 Bacteria 1307
291 Ga0501046_0001514 3300049580 Bacteria 22170
292 Ga0501046_0030480 3300049580 Bacteria 4378
293 Ga0501046_0071887 3300049580 Bacteria 2686
294 Ga0501047_0022611 3300049581 Bacteria 6037
295 Ga0501047_0024837 3300049581 Bacteria 5753
296 Ga0501047_0059948 3300049581 Bacteria 3674
297 Ga0501047_0376087 3300049581 Bacteria 1255
298 Ga0501068_0008363 3300049584 Bacteria 5754
299 Ga0501069_0081979 3300049585 Bacteria 1817
300 Ga0501070_0109600 3300049586 Bacteria 2281
301 Ga0501070_0270439 3300049586 Bacteria 1388
302 Ga0501070_0291326 3300049586 Bacteria 1330
303 Ga0501071_0073641 3300049587 Bacteria 2492
304 Ga0501072_0018206 3300049588 Bacteria 5404
305 Ga0501073_0017308 3300049589 Bacteria 5221
306 Ga0501073_0023149 3300049589 Bacteria 4465
307 Ga0501073_0040205 3300049589 Bacteria 3311
308 Ga0501073_0052662 3300049589 Bacteria 2849
309 Ga0501073_0226740 3300049589 Bacteria 1291
310 Ga0501230_002647 3300049667 Unclassified 2301
311 Ga0501225_0001804 3300049705 Bacteria 6703
312 Ga0501079_0058676 3300049741 Bacteria 2969
313 Ga0501080_0037271 3300049742 Bacteria 4540
314 Ga0501080_0136324 3300049742 Bacteria 2271
315 Ga0501080_0438476 3300049742 Bacteria 1172
316 Ga0501035_0024818 3300049822 Bacteria 5496
317 Ga0501035_0032409 3300049822 Bacteria 4754
318 Ga0501035_0279409 3300049822 Bacteria 1411
319 Ga0501035_0306186 3300049822 Bacteria 1338
320 Ga0501044_0004912 3300049823 Bacteria 14943
321 Ga0501044_0010695 3300049823 Bacteria 9956
322 Ga0501044_0080105 3300049823 Bacteria 3308
323 Ga0501044_0093027 3300049823 Bacteria 3040
324 Ga0501044_0123401 3300049823 Bacteria 2589
325 Ga0501045_0242919 3300049824 Bacteria 1340
326 Ga0500610_0000492 3300053079 Bacteria 12155
327 Ga0500651_0004002 3300053093 Bacteria 8175
328 Ga0500651_0029669 3300053093 Bacteria 3441
329 Ga0500568_0001237 3300053139 Bacteria 16968
330 Ga0500636_0070972 3300053177 Bacteria 2020
331 Ga0501084_0025448 3300054114 Bacteria 4938
332 Ga0500661_002712 3300055283 Bacteria 3344
333 Ga0501082_0015129 3300060353 Bacteria 6647
334 2552748684 2551306352 Bacteria 3873115
335 2554814039 2554235132 Bacteria 6772433
336 2572253442 2571042365 Bacteria 3289345
337 2600442389 2600254954 Bacteria 5100516
338 2602009646 2600255389 Bacteria 5275336
339 2608384666 2606217733 Bacteria 6360972
340 2640733764 2639762793 Bacteria 3943681
341 2643818991 2643221559 Bacteria 4424915
342 2643879512 2643221573 Bacteria 4784121
343 2643941338 2643221586 Bacteria 4446529
344 2643974392 2643221593 Bacteria 6296053
345 2644080417 2643221612 Bacteria 4361984
346 2644528787 2643221695 Bacteria 3441323
347 2644662877 2643221720 Bacteria 4694283
348 2644697030 2643221727 Bacteria 4415595
349 2644698168 2643221728 Bacteria 4797149
350 2808904620 2808606373 Bacteria 4423627
351 2894415484 2894414249 Bacteria 4405451
352 2916703069 2916699645 Bacteria 3568996
353 2919504234 2919501602 Bacteria 5286340
354 2919508409 2919506607 Bacteria 3392955
355 2926065193 2926063275 Bacteria 5285848
356 2941489602 2941489479 Bacteria 6313767
357 2984572384 2984568884 Bacteria 3884413
358 2995950862 2995948881 Bacteria 6358104
359 8003014726 8003014200 Bacteria 4059994
360 8034967091 8034962539 Bacteria 4884839
361 8056123936 8056120720 Bacteria 5758328
362 Ga0495656_0094244
363 SwRhRL2b_contig_866076
364 JGI25151J46595_10046933
365 Ga0055526_1011090
366 Ga0055524_1016300
367 Ga0055524_1018180
368 Ga0055536_1001429
369 Ga0055536_1016148
370 Ga0055530_10003425
371 Ga0055531_10007190
372 Ga0055531_10009640
373 Ga0055531_10027963
374 Ga0058692_1000010
375 Ga0065703_1000085
376 Ga0065704_10108321
377 Ga0070690_100097229
378 Ga0070670_100128414
379 Ga0070666_10000331
380 Ga0070680_100230338
381 Ga0070661_100248314
382 Ga0070668_100023972
383 Ga0070671_100260855
384 Ga0070667_100012939
385 Ga0070667_100028757
386 Ga0070667_100157162
387 Ga0070667_100257419
388 Ga0070667_100506366
389 Ga0070710_10090709
390 Ga0070663_100027042
391 Ga0070663_100181630
392 Ga0070678_100051047
393 Ga0068867_100028381
394 Ga0068853_100001578
395 Ga0068853_100003021
396 Ga0068853_100006652
397 Ga0068853_100016432
398 Ga0070693_100129085
399 Ga0070665_100000077
400 Ga0070665_100316649
401 Ga0070665_100389811
402 Ga0070665_100392452
403 Ga0068855_100001307
404 Ga0068857_100037641
405 Ga0068857_100093202
406 Ga0068857_100324712
407 Ga0068854_100232556
408 Ga0068856_100013080
409 Ga0068859_100000125
410 Ga0068864_100023774
411 Ga0068864_100027048
412 Ga0068864_100221580
413 Ga0068851_10072398
414 Ga0068851_10087628
415 Ga0068863_100006425
416 Ga0068863_100007309
417 Ga0068863_100047333
418 Ga0068863_100074119
419 Ga0068858_100088069
420 Ga0068860_100076227
421 Ga0068860_100081726
422 Ga0068860_100155655
423 Ga0068860_100164866
424 Ga0068862_100362743
425 Ga0097621_100103657
426 Ga0068871_100076000
427 Ga0068871_100156126
428 Ga0068871_100188739
429 Ga0097620_100000125
430 Ga0105251_10028908
431 Ga0105250_10003407
432 Ga0105250_10120727
433 Ga0105247_10197557
434 Ga0105241_10111796
435 Ga0105248_10338975
436 Ga0105237_10017013
437 Ga0105237_10430915
438 Ga0105238_10015092
439 Ga0105238_10047568
440 Ga0105239_10006032
441 Ga0105239_10007974
442 Ga0105239_10015701
443 Ga0105239_10043180
444 Ga0105239_10065209
445 Ga0105239_10090667
446 Ga0105239_10140964
447 Ga0105239_10732308
448 Ga0157327_1003764
449 Ga0157373_10195823
450 Ga0157371_10002803
451 Ga0157371_10072572
452 Ga0157370_10049229
453 Ga0157369_10000148
454 Ga0157374_10238783
455 Ga0157374_10292594
456 Ga0157378_10010725
457 Ga0157378_10184901
458 Ga0157372_10030771
459 Ga0157372_10150437
460 Ga0157375_10006205
461 Ga0163163_10001490
462 Ga0163163_10036046
463 Ga0157379_10001878
464 Ga0157376_10485285
465 Ga0183360_10001
466 Ga0163161_10008353
467 Ga0206356_11742576
468 Ga0207425_1006536
469 Ga0209673_1025022
470 Ga0209130_1006439
471 Ga0209676_1000891
472 Ga0209676_1005741
473 Ga0209676_1007986
474 Ga0209676_1020126
475 Ga0209676_1027113
476 Ga0209025_1000015
477 Ga0209025_1009608
478 Ga0209025_1045970
479 Ga0209050_1001146
480 Ga0209050_1037881
481 Ga0209256_1003633
482 Ga0209256_1008113
483 Ga0209256_1018065
484 Ga0209051_1029013
485 Ga0209257_1000988
486 Ga0209257_1001062
487 Ga0209257_1001230
488 Ga0209257_1002757
489 Ga0209257_1024520
490 Ga0207656_10019520
491 Ga0207696_1001458
492 Ga0207655_1015010
493 Ga0207692_10110871
494 Ga0207680_10166135
495 Ga0207705_10126044
496 Ga0207695_10047781
497 Ga0207695_10122498
498 Ga0207671_10004644
499 Ga0207671_10060348
500 Ga0207671_10198172
501 Ga0207660_10117197
502 Ga0207649_10079139
503 Ga0207694_10001145
504 Ga0207694_10008358
505 Ga0207650_10318481
506 Ga0207687_10400877
507 Ga0207644_10056423
508 Ga0207704_10006628
509 Ga0207691_10193837
510 Ga0207711_10399258
511 Ga0207679_10068485
512 Ga0207667_10001994
513 Ga0207667_10146678
514 Ga0207668_10072352
515 Ga0207658_10009033
516 Ga0207658_10279644
517 Ga0207703_10057050
518 Ga0207703_10251301
519 Ga0207639_10000374
520 Ga0207639_10001926
521 Ga0207639_10007071
522 Ga0207678_10003166
523 Ga0207678_10042614
524 Ga0207702_10010284
525 Ga0207641_10052403
526 Ga0207641_10057482
527 Ga0207641_10060667
528 Ga0207676_10014126
529 Ga0207674_10017282
530 Ga0207674_10117801
531 Ga0207674_10154974
532 Ga0207683_10316023
533 Ga0209371_1000006
534 Ga0268266_10000001
535 Ga0268266_10185751
536 Ga0268265_10126623
537 Ga0268265_10164391
538 Ga0268264_10013742
539 Ga0268264_10208789
540 Ga0268264_10390755
541 Ga0268256_1000007
542 Ga0307408_100000426
543 Ga0307408_100004051
544 Ga0307408_100040375
545 Ga0307408_100202656
546 Ga0307508_10246386
547 Ga0316575_10000762
548 Ga0316575_10002328
549 Ga0316575_10071081
550 Ga0316576_10017624
551 Ga0307516_10127101
552 Ga0307405_10093721
553 Ga0307405_10271794
554 Ga0307406_10001712
555 Ga0307406_10006263
556 Ga0307412_10034374
557 Ga0307412_10041654
558 Ga0307414_10159846
559 Ga0316585_10031582
560 Ga0316593_10045653
561 Ga0316593_10055287
562 Ga0316586_1004141
563 Ga0316587_1003599
564 Ga0316596_1022646
565 Ga0316574_0022400
566 Ga0316574_0052552
567 Ga0316574_0117045
568 Ga0316574_0196037
569 Ga0316574_0318174
570 Ga0316582_0014763
571 Ga0316582_0107528
572 Ga0316582_0131320
573 Ga0316584_0005026
574 Ga0316584_0021346
575 Ga0316584_0035793
576 Ga0316584_0410648
577 Ga0316581_0024254
578 Ga0439436_0006361
579 Ga0439436_0010500
580 Ga0439439_0001798
581 Ga0439447_013563
582 Ga0439466_0045155
583 Ga0451789_0522891
584 Ga0451791_0790747
585 Ga0451791_0954774
586 Ga0451800_0974983
587 Ga0451807_0166283
588 Ga0451837_0656537
589 Ga0451853_2447817
590 Ga0451853_3880754
591 Ga0439432_000213
592 Ga0439432_002010
593 Ga0439432_007686
594 Ga0439432_043745
595 Ga0439449_0002588
596 Ga0439449_0010587
597 Ga0439452_019570
598 Ga0450911_000002
599 Ga0450904_000035
600 Ga0439446_0000026
601 Ga0439459_0004123
602 Ga0451577_0038345
603 Ga0451577_0494096
604 Ga0466972_0001350
605 Ga0453684_0000468
606 Ga0466970_0003008
607 Ga0451576_0000177
608 Ga0495643_0013183
609 Ga0495663_0001196
610 Ga0495621_0092696
611 Ga0495656_0005241
612 Ga0495656_0022250
613 Ga0495670_0090255
614 Ga0495670_0154887
615 Ga0495671_0009293
616 Ga0495636_0009911
617 Ga0495636_0018793
618 Ga0495685_010164
619 Ga0496110_0358097
620 Ga0496113_0447573
621 Ga0496115_0127697
622 Ga0496117_0029087
623 Ga0496118_0001297
624 Ga0496118_0048094
625 Ga0496124_0044338
626 Ga0496126_0059203
627 Ga0501031_0072566
628 Ga0501031_0080898
629 Ga0501032_0052504
630 Ga0501032_0166857
631 Ga0501033_0007083
632 Ga0501033_0030118
633 Ga0501033_0215961
634 Ga0501034_0024148
635 Ga0501034_0120206
636 Ga0501034_0132671
637 Ga0501036_0002681
638 Ga0501036_0021518
639 Ga0501037_0006486
640 Ga0501037_0085210
641 Ga0501037_0113131
642 Ga0501038_0000458
643 Ga0501038_0009912
644 Ga0501038_0078736
645 Ga0501039_0095035
646 Ga0501039_0150918
647 Ga0501040_0040055
648 Ga0501042_0228118
649 Ga0501043_0010475
650 Ga0501043_0018803
651 Ga0501043_0269529
652 Ga0501046_0001514
653 Ga0501046_0030480
654 Ga0501046_0071887
655 Ga0501047_0022611
656 Ga0501047_0024837
657 Ga0501047_0059948
658 Ga0501047_0376087
659 Ga0501068_0008363
660 Ga0501069_0081979
661 Ga0501070_0109600
662 Ga0501070_0270439
663 Ga0501070_0291326
664 Ga0501071_0073641
665 Ga0501072_0018206
666 Ga0501073_0017308
667 Ga0501073_0023149
668 Ga0501073_0040205
669 Ga0501073_0052662
670 Ga0501073_0226740
671 Ga0501230_002647
672 Ga0501225_0001804
673 Ga0501079_0058676
674 Ga0501080_0037271
675 Ga0501080_0136324
676 Ga0501080_0438476
677 Ga0501035_0024818
678 Ga0501035_0032409
679 Ga0501035_0279409
680 Ga0501035_0306186
681 Ga0501044_0004912
682 Ga0501044_0010695
683 Ga0501044_0080105
684 Ga0501044_0093027
685 Ga0501044_0123401
686 Ga0501045_0242919
687 Ga0500610_0000492
688 Ga0500651_0004002
689 Ga0500651_0029669
690 Ga0500568_0001237
691 Ga0500636_0070972
692 Ga0501084_0025448
693 Ga0500661_002712
694 Ga0501082_0015129
695 2552748684
696 2554814039
697 2572253442
698 2600442389
699 2602009646
700 2608384666
701 2640733764
702 2643818991
703 2643879512
704 2643941338
705 2643974392
706 2644080417
707 2644528787
708 2644662877
709 2644697030
710 2644698168
711 2808904620
712 2894415484
713 2916703069
714 2919504234
715 2919508409
716 2926065193
717 2941489602
718 2984572384
719 2995950862
720 8003014726
721 8034967091
722 8056123936

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05114

DUF692

Protein of unknown function (DUF692)

23

285

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bww-assembly1.cif.gz_A crystal structure of a duf692 family protein (hs_1138) from haemophilus somnus 129pt at 2.20 a resolution 0.9342 4 269
3bww-assembly1.cif.gz_A crystal structure of a duf692 family protein (hs_1138) from haemophilus somnus 129pt at 2.20 a resolution 0.8841 4 269
8hci-assembly1.cif.gz_D crystal structure of a holoenzyme fe-free tglhi for pseudomonas syringae peptidyl (s) 2-mercaptoglycine biosynthesis 0.8248 1 271
7fc0-assembly1.cif.gz_B reconstitution of mbnabc complex from rugamonas rubra atcc-43154 (groupiii) 0.8247 5 265
7fc0-assembly1.cif.gz_B reconstitution of mbnabc complex from rugamonas rubra atcc-43154 (groupiii) 0.8131 5 265
ID Description Score Start End Superfamily
3bwwA01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9233 4 269 3.20.20.150
3bwwA01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8761 4 269 3.20.20.150
1qumA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.646 4 266 3.20.20.150
3ayvB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.6335 5 261 3.20.20.150
3u0hB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.631 5 267 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A0F8VS96-F1-model_v4 Uncharacterized protein 0.9867 177 269
AF-A0A290TR95-F1-model_v4 deleted 0.9839 150 270
AF-A0A496WPY4-F1-model_v4 Uncharacterized protein 0.9776 188 269
AF-A0A120AFW0-F1-model_v4 UPF0276 protein AZ78_1185 0.9751 1 270
AF-A0A2E7E568-F1-model_v4 Uncharacterized protein 0.9729 3 269

Map