F422367
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 361 | 226 | 722 | 518 |
Family's Representative Sequence
| Representative Sequence | 3300048924|Ga0496121_0070900|Ga0496121_0070900_783_2546 |
| Length | 587 |
| Sequence | MVSSFTFLKSTVAGGRLTPAPRCKISPRNRYLDLCGVRADDRSAEVGAVAGRLAPMPTVREATFDLFREQGMTTIFGNPGSTELPMLADYPADFRYVLGLQEAVVVGMADGFAQASGRTTAVNLHTAPGVGNAMGAIFNAQANHSPLLITAGQQARAQITLQANLTNRDATRMPHPLVKWSYEPPRAEDVPLALAHGIHLAGLAPRGPVFVSLPMDDWDVEVDPADARHAVTRKVTGRAVADPAAVAALAAELDAAQNPVLVAGPDIDTAGGWDSAVALAERQRLPVWASPATGGVRLGFPEDHPNFRGVLPPAIGPVGQTLEGHDLIVVIGSSVFPYYPHIPGPLLPEGARLVAITSDPDEAVRAPMGDAIVADVGLTLAALVEAVPESGRPGPEPNAGPGEMKITDPLDASTVHGALREVLPEDAIVVLESPSSTLALRNQLRISRPGSYYFSAGGGLGFGLAASIGVQIAEPSRPVVCVLGEGSAQYAITAFWSAVAYDVPVTFLVLRNEEYAILKWFAEVGQITGAPGLDLPKLDVAAVAEGYGVTAHRAADRDGVAAALAGALASSKPELVEVPVAPGMSLF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 26 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 32 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 33 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 34 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 35 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 36 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 37 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 38 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 39 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 40 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 41 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 43 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 44 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 47 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 48 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 49 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 50 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 51 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 70 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 112 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 113 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 114 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 115 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 116 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 117 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 118 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 119 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 120 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 121 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 122 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 123 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 124 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 125 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 126 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 127 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 128 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 129 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 166 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 167 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 168 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 169 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 170 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 171 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 172 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 173 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 174 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 175 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 176 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 177 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 178 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 179 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 180 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 181 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 182 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 183 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 184 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 185 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 186 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 193 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 194 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 209 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 210 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 211 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 212 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 213 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 214 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 215 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 216 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 222 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 223 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 224 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 225 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.6 |
| Nodule | 0 |
| Rhizoplane | 14.13 |
| Rhizosphere | 79.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496121_0070900 | 3300048924 | Bacteria | 2804 |
| 2 | JGI24740J21852_10002646 | 3300001979 | Bacteria | 8064 |
| 3 | JGI24748J21848_1000282 | 3300002074 | Bacteria | 5970 |
| 4 | Ga0070658_10018877 | 3300005327 | Bacteria | 5524 |
| 5 | Ga0070683_100006314 | 3300005329 | Bacteria | 9943 |
| 6 | Ga0070683_100029573 | 3300005329 | Bacteria | 4962 |
| 7 | Ga0070677_10000034 | 3300005333 | Bacteria | 41098 |
| 8 | Ga0070682_100000029 | 3300005337 | Bacteria | 183516 |
| 9 | Ga0070682_100000367 | 3300005337 | Bacteria | 30395 |
| 10 | Ga0068868_100006839 | 3300005338 | Bacteria | 8099 |
| 11 | Ga0068868_100010446 | 3300005338 | Bacteria | 6722 |
| 12 | Ga0068868_100048934 | 3300005338 | Bacteria | 3317 |
| 13 | Ga0070691_10000069 | 3300005341 | Bacteria | 28638 |
| 14 | Ga0070661_100000045 | 3300005344 | Bacteria | 94702 |
| 15 | Ga0070668_100067325 | 3300005347 | Bacteria | 2782 |
| 16 | Ga0070669_100074939 | 3300005353 | Bacteria | 2509 |
| 17 | Ga0070675_100000187 | 3300005354 | Bacteria | 38675 |
| 18 | Ga0070674_100000011 | 3300005356 | Bacteria | 134886 |
| 19 | Ga0070674_100000014 | 3300005356 | Bacteria | 100122 |
| 20 | Ga0070688_100001078 | 3300005365 | Bacteria | 13685 |
| 21 | Ga0070659_100016841 | 3300005366 | Bacteria | 5492 |
| 22 | Ga0070667_100000374 | 3300005367 | Bacteria | 48918 |
| 23 | Ga0070667_100030723 | 3300005367 | Bacteria | 4480 |
| 24 | Ga0070714_100043702 | 3300005435 | Bacteria | 3791 |
| 25 | Ga0070713_100040889 | 3300005436 | Bacteria | 3773 |
| 26 | Ga0070700_100075276 | 3300005441 | Bacteria | 2165 |
| 27 | Ga0070662_100000008 | 3300005457 | Bacteria | 168754 |
| 28 | Ga0070685_10001067 | 3300005466 | Bacteria | 14706 |
| 29 | Ga0070679_100000651 | 3300005530 | Bacteria | 29562 |
| 30 | Ga0070684_100032327 | 3300005535 | Bacteria | 4459 |
| 31 | Ga0068853_100007653 | 3300005539 | Bacteria | 8659 |
| 32 | Ga0070672_100000003 | 3300005543 | Bacteria | 159532 |
| 33 | Ga0070686_100043988 | 3300005544 | Bacteria | 2804 |
| 34 | Ga0070695_100111289 | 3300005545 | Bacteria | 1859 |
| 35 | Ga0070665_100000270 | 3300005548 | Bacteria | 85249 |
| 36 | Ga0070665_100000690 | 3300005548 | Bacteria | 45099 |
| 37 | Ga0070665_100012626 | 3300005548 | Bacteria | 8505 |
| 38 | Ga0070664_100030686 | 3300005564 | Bacteria | 4486 |
| 39 | Ga0068854_100000241 | 3300005578 | Bacteria | 37275 |
| 40 | Ga0068856_100006108 | 3300005614 | Bacteria | 11828 |
| 41 | Ga0068866_10000002 | 3300005718 | Bacteria | 394090 |
| 42 | Ga0068866_10000219 | 3300005718 | Bacteria | 27162 |
| 43 | Ga0068851_10000342 | 3300005834 | Bacteria | 21002 |
| 44 | Ga0068851_10015508 | 3300005834 | Bacteria | 3631 |
| 45 | Ga0068858_100000086 | 3300005842 | Bacteria | 96201 |
| 46 | Ga0068858_100000155 | 3300005842 | Bacteria | 72794 |
| 47 | Ga0068860_100065894 | 3300005843 | Bacteria | 3439 |
| 48 | Ga0068862_100000278 | 3300005844 | Bacteria | 57006 |
| 49 | Ga0081455_10008014 | 3300005937 | Bacteria | 11038 |
| 50 | Ga0081455_10009608 | 3300005937 | Bacteria | 9932 |
| 51 | Ga0081455_10019444 | 3300005937 | Bacteria | 6425 |
| 52 | Ga0081455_10074752 | 3300005937 | Bacteria | 2797 |
| 53 | Ga0081540_1000174 | 3300005983 | Bacteria | 67477 |
| 54 | Ga0081539_10015072 | 3300005985 | Bacteria | 5660 |
| 55 | Ga0070717_10005075 | 3300006028 | Bacteria | 9600 |
| 56 | Ga0075365_10000796 | 3300006038 | Bacteria | 12920 |
| 57 | Ga0075365_10002193 | 3300006038 | Bacteria | 9414 |
| 58 | Ga0075363_100008170 | 3300006048 | Bacteria | 4859 |
| 59 | Ga0070715_10000015 | 3300006163 | Bacteria | 152816 |
| 60 | Ga0070712_100002378 | 3300006175 | Bacteria | 11583 |
| 61 | Ga0070712_100051817 | 3300006175 | Bacteria | 2860 |
| 62 | Ga0075428_100106599 | 3300006844 | Bacteria | 3055 |
| 63 | Ga0075430_100029047 | 3300006846 | Bacteria | 4695 |
| 64 | Ga0075431_100059905 | 3300006847 | Bacteria | 3928 |
| 65 | Ga0075433_10001385 | 3300006852 | Bacteria | 17850 |
| 66 | Ga0068865_100000033 | 3300006881 | Bacteria | 84342 |
| 67 | Ga0111539_10082079 | 3300009094 | Bacteria | 3791 |
| 68 | Ga0111539_10180164 | 3300009094 | Bacteria | 2468 |
| 69 | Ga0105245_10000425 | 3300009098 | Bacteria | 39393 |
| 70 | Ga0105245_10000585 | 3300009098 | Bacteria | 33073 |
| 71 | Ga0105245_10004158 | 3300009098 | Bacteria | 12856 |
| 72 | Ga0105245_10005090 | 3300009098 | Bacteria | 11563 |
| 73 | Ga0105245_10031235 | 3300009098 | Bacteria | 4712 |
| 74 | Ga0105247_10001139 | 3300009101 | Bacteria | 19674 |
| 75 | Ga0105247_10067570 | 3300009101 | Bacteria | 2227 |
| 76 | Ga0114129_10014838 | 3300009147 | Bacteria | 11103 |
| 77 | Ga0114129_10087004 | 3300009147 | Bacteria | 4334 |
| 78 | Ga0105243_10001250 | 3300009148 | Bacteria | 22828 |
| 79 | Ga0105242_10003005 | 3300009176 | Bacteria | 13181 |
| 80 | Ga0105242_10081552 | 3300009176 | Bacteria | 2705 |
| 81 | Ga0105248_10000022 | 3300009177 | Bacteria | 275935 |
| 82 | Ga0105238_10000299 | 3300009551 | Bacteria | 54293 |
| 83 | Ga0105249_10000085 | 3300009553 | Bacteria | 133497 |
| 84 | Ga0105249_10000588 | 3300009553 | Bacteria | 33205 |
| 85 | Ga0105239_10015091 | 3300010375 | Bacteria | 8564 |
| 86 | Ga0105239_10247455 | 3300010375 | Bacteria | 2002 |
| 87 | Ga0157371_10027310 | 3300013102 | Bacteria | 4141 |
| 88 | Ga0157369_10000173 | 3300013105 | Bacteria | 90860 |
| 89 | Ga0157372_10061189 | 3300013307 | Bacteria | 4215 |
| 90 | Ga0157375_10000184 | 3300013308 | Bacteria | 58368 |
| 91 | Ga0157375_10035850 | 3300013308 | Bacteria | 4739 |
| 92 | Ga0163163_10119615 | 3300014325 | Bacteria | 2667 |
| 93 | Ga0157380_10000017 | 3300014326 | Bacteria | 119468 |
| 94 | Ga0157380_10000072 | 3300014326 | Bacteria | 56363 |
| 95 | Ga0157376_10085028 | 3300014969 | Bacteria | 2725 |
| 96 | Ga0163161_10000173 | 3300017792 | Bacteria | 59103 |
| 97 | Ga0213876_10007818 | 3300021384 | Bacteria | 5800 |
| 98 | Ga0209051_1001401 | 3300025303 | Bacteria | 20760 |
| 99 | Ga0207656_10000068 | 3300025321 | Bacteria | 39207 |
| 100 | Ga0207656_10006654 | 3300025321 | Bacteria | 4172 |
| 101 | Ga0207682_10000457 | 3300025893 | Bacteria | 18841 |
| 102 | Ga0207642_10000001 | 3300025899 | Bacteria | 714030 |
| 103 | Ga0207642_10000003 | 3300025899 | Bacteria | 650651 |
| 104 | Ga0207642_10000049 | 3300025899 | Bacteria | 34592 |
| 105 | Ga0207642_10023483 | 3300025899 | Bacteria | 2464 |
| 106 | Ga0207710_10000151 | 3300025900 | Bacteria | 77424 |
| 107 | Ga0207680_10007357 | 3300025903 | Bacteria | 5359 |
| 108 | Ga0207680_10059511 | 3300025903 | Bacteria | 2321 |
| 109 | Ga0207685_10000001 | 3300025905 | Bacteria | 604473 |
| 110 | Ga0207705_10015631 | 3300025909 | Bacteria | 5448 |
| 111 | Ga0207693_10001174 | 3300025915 | Bacteria | 23373 |
| 112 | Ga0207693_10004622 | 3300025915 | Bacteria | 11615 |
| 113 | Ga0207663_10002675 | 3300025916 | Bacteria | 8590 |
| 114 | Ga0207660_10009069 | 3300025917 | Bacteria | 6442 |
| 115 | Ga0207649_10000021 | 3300025920 | Bacteria | 209660 |
| 116 | Ga0207652_10000150 | 3300025921 | Bacteria | 75189 |
| 117 | Ga0207681_10036210 | 3300025923 | Bacteria | 3255 |
| 118 | Ga0207694_10000035 | 3300025924 | Bacteria | 195870 |
| 119 | Ga0207659_10000074 | 3300025926 | Bacteria | 63348 |
| 120 | Ga0207687_10000021 | 3300025927 | Bacteria | 226396 |
| 121 | Ga0207687_10000042 | 3300025927 | Bacteria | 108169 |
| 122 | Ga0207687_10000716 | 3300025927 | Bacteria | 22524 |
| 123 | Ga0207687_10050590 | 3300025927 | Bacteria | 2893 |
| 124 | Ga0207700_10000013 | 3300025928 | Bacteria | 230462 |
| 125 | Ga0207700_10015047 | 3300025928 | Bacteria | 5089 |
| 126 | Ga0207664_10003085 | 3300025929 | Bacteria | 11067 |
| 127 | Ga0207690_10041655 | 3300025932 | Bacteria | 3011 |
| 128 | Ga0207706_10000016 | 3300025933 | Bacteria | 170697 |
| 129 | Ga0207686_10002936 | 3300025934 | Bacteria | 9185 |
| 130 | Ga0207669_10000007 | 3300025937 | Bacteria | 169904 |
| 131 | Ga0207669_10000027 | 3300025937 | Bacteria | 91216 |
| 132 | Ga0207704_10000029 | 3300025938 | Bacteria | 120526 |
| 133 | Ga0207691_10000005 | 3300025940 | Bacteria | 163117 |
| 134 | Ga0207711_10000019 | 3300025941 | Bacteria | 412779 |
| 135 | Ga0207661_10000145 | 3300025944 | Bacteria | 45007 |
| 136 | Ga0207661_10007439 | 3300025944 | Bacteria | 7795 |
| 137 | Ga0207679_10026066 | 3300025945 | Bacteria | 4028 |
| 138 | Ga0207712_10000033 | 3300025961 | Bacteria | 209336 |
| 139 | Ga0207668_10029850 | 3300025972 | Bacteria | 3578 |
| 140 | Ga0207640_10000026 | 3300025981 | Bacteria | 142343 |
| 141 | Ga0207658_10001722 | 3300025986 | Bacteria | 16531 |
| 142 | Ga0207658_10004945 | 3300025986 | Bacteria | 9196 |
| 143 | Ga0207658_10043668 | 3300025986 | Bacteria | 3260 |
| 144 | Ga0207677_10000430 | 3300026023 | Bacteria | 28263 |
| 145 | Ga0207677_10001018 | 3300026023 | Bacteria | 15444 |
| 146 | Ga0207703_10000072 | 3300026035 | Bacteria | 120727 |
| 147 | Ga0207639_10005361 | 3300026041 | Bacteria | 8666 |
| 148 | Ga0207678_10001068 | 3300026067 | Bacteria | 25098 |
| 149 | Ga0207708_10064569 | 3300026075 | Bacteria | 2797 |
| 150 | Ga0207702_10001072 | 3300026078 | Bacteria | 28003 |
| 151 | Ga0207641_10000231 | 3300026088 | Bacteria | 72245 |
| 152 | Ga0207641_10024111 | 3300026088 | Bacteria | 5014 |
| 153 | Ga0268266_10000076 | 3300028379 | Bacteria | 217644 |
| 154 | Ga0268266_10000182 | 3300028379 | Bacteria | 111453 |
| 155 | Ga0268266_10000825 | 3300028379 | Bacteria | 40545 |
| 156 | Ga0268265_10002932 | 3300028380 | Bacteria | 12506 |
| 157 | Ga0265319_1000029 | 3300028563 | Bacteria | 131291 |
| 158 | Ga0265338_10000179 | 3300028800 | Bacteria | 117995 |
| 159 | Ga0265327_10031908 | 3300031251 | Bacteria | 2955 |
| 160 | Ga0307412_10068791 | 3300031911 | Bacteria | 2409 |
| 161 | Ga0307416_100032438 | 3300032002 | Bacteria | 3946 |
| 162 | Ga0307416_100096385 | 3300032002 | Bacteria | 2558 |
| 163 | Ga0307415_100011807 | 3300032126 | Bacteria | 5019 |
| 164 | Ga0316574_0002823 | 3300035398 | Bacteria | 8816 |
| 165 | Ga0373937_0004062 | 3300036401 | Bacteria | 12402 |
| 166 | Ga0395900_0019159 | 3300037418 | Bacteria | 6979 |
| 167 | Ga0395900_0048861 | 3300037418 | Bacteria | 4357 |
| 168 | Ga0395900_0071054 | 3300037418 | Bacteria | 3578 |
| 169 | Ga0395900_0210804 | 3300037418 | Bacteria | 1962 |
| 170 | Ga0395898_0003610 | 3300037466 | Bacteria | 17228 |
| 171 | Ga0395898_0015594 | 3300037466 | Bacteria | 7791 |
| 172 | Ga0395905_0009334 | 3300037471 | Bacteria | 9594 |
| 173 | Ga0395905_0085603 | 3300037471 | Bacteria | 2953 |
| 174 | Ga0395901_0008833 | 3300038443 | Bacteria | 10199 |
| 175 | Ga0395901_0018235 | 3300038443 | Bacteria | 7166 |
| 176 | Ga0395901_0025805 | 3300038443 | Bacteria | 6033 |
| 177 | Ga0395901_0157421 | 3300038443 | Bacteria | 2386 |
| 178 | Ga0436365_0862230 | 3300039437 | Bacteria | 9658 |
| 179 | Ga0466966_0102036 | 3300044684 | Bacteria | 1774 |
| 180 | Ga0466957_0002455 | 3300044842 | Bacteria | 9950 |
| 181 | Ga0466959_0031241 | 3300045049 | Bacteria | 3941 |
| 182 | Ga0466958_0026712 | 3300045836 | Bacteria | 3413 |
| 183 | Ga0466967_0000007 | 3300045976 | Bacteria | 135597 |
| 184 | Ga0466967_0128688 | 3300045976 | Bacteria | 2348 |
| 185 | Ga0495603_0000045 | 3300046455 | Bacteria | 53543 |
| 186 | Ga0495603_0000622 | 3300046455 | Bacteria | 19869 |
| 187 | Ga0495629_0000823 | 3300046459 | Bacteria | 25146 |
| 188 | Ga0495638_0001471 | 3300046460 | Bacteria | 21269 |
| 189 | Ga0495638_0040274 | 3300046460 | Bacteria | 2961 |
| 190 | Ga0495641_0000001 | 3300046461 | Bacteria | 485224 |
| 191 | Ga0495641_0008957 | 3300046461 | Bacteria | 6014 |
| 192 | Ga0495641_0036245 | 3300046461 | Bacteria | 2319 |
| 193 | Ga0495594_0000005 | 3300046499 | Bacteria | 175437 |
| 194 | Ga0495606_0000131 | 3300046507 | Bacteria | 127298 |
| 195 | Ga0495608_0000021 | 3300046511 | Bacteria | 168462 |
| 196 | Ga0495608_0123242 | 3300046511 | Bacteria | 1661 |
| 197 | Ga0495618_0000004 | 3300046514 | Bacteria | 245690 |
| 198 | Ga0495628_0055213 | 3300046516 | Bacteria | 3129 |
| 199 | Ga0495628_0103419 | 3300046516 | Bacteria | 2196 |
| 200 | Ga0495628_0150928 | 3300046516 | Bacteria | 1770 |
| 201 | Ga0495630_0000007 | 3300046517 | Bacteria | 376915 |
| 202 | Ga0495630_0000168 | 3300046517 | Bacteria | 51209 |
| 203 | Ga0495630_0078470 | 3300046517 | Bacteria | 2490 |
| 204 | Ga0495644_0000454 | 3300046523 | Bacteria | 17881 |
| 205 | Ga0495652_0000022 | 3300046529 | Bacteria | 178368 |
| 206 | Ga0495652_0049423 | 3300046529 | Bacteria | 3600 |
| 207 | Ga0495586_0001141 | 3300046535 | Bacteria | 14887 |
| 208 | Ga0495587_0002697 | 3300046536 | Bacteria | 11844 |
| 209 | Ga0495587_0048529 | 3300046536 | Bacteria | 2514 |
| 210 | Ga0495645_0000145 | 3300046543 | Bacteria | 48403 |
| 211 | Ga0495645_0003853 | 3300046543 | Bacteria | 10212 |
| 212 | Ga0495645_0021244 | 3300046543 | Bacteria | 4690 |
| 213 | Ga0495622_0000026 | 3300046557 | Bacteria | 137934 |
| 214 | Ga0495667_0000044 | 3300046559 | Bacteria | 121910 |
| 215 | Ga0495667_0084332 | 3300046559 | Bacteria | 2063 |
| 216 | Ga0495656_0001237 | 3300046615 | Bacteria | 8311 |
| 217 | Ga0495634_0000013 | 3300046642 | Bacteria | 130546 |
| 218 | Ga0495634_0001787 | 3300046642 | Bacteria | 18578 |
| 219 | Ga0495634_0006825 | 3300046642 | Bacteria | 8636 |
| 220 | Ga0495625_0000204 | 3300046660 | Bacteria | 94356 |
| 221 | Ga0495635_0004856 | 3300046663 | Bacteria | 9358 |
| 222 | Ga0495588_0000262 | 3300046674 | Bacteria | 42637 |
| 223 | Ga0495657_0000019 | 3300046675 | Bacteria | 168441 |
| 224 | Ga0495647_0000003 | 3300046681 | Bacteria | 145235 |
| 225 | Ga0495647_0044585 | 3300046681 | Bacteria | 1701 |
| 226 | Ga0495658_0010401 | 3300046683 | Bacteria | 4655 |
| 227 | Ga0495669_0041737 | 3300046684 | Bacteria | 2038 |
| 228 | Ga0495613_0000260 | 3300046689 | Bacteria | 49751 |
| 229 | Ga0495613_0000369 | 3300046689 | Bacteria | 39198 |
| 230 | Ga0495613_0028959 | 3300046689 | Bacteria | 4118 |
| 231 | Ga0495624_0000164 | 3300046690 | Bacteria | 48886 |
| 232 | Ga0495624_0000592 | 3300046690 | Bacteria | 28232 |
| 233 | Ga0495600_0002135 | 3300046809 | Bacteria | 11193 |
| 234 | Ga0495581_0020152 | 3300047315 | Bacteria | 3872 |
| 235 | Ga0495604_0003117 | 3300047317 | Bacteria | 13246 |
| 236 | Ga0495676_0000652 | 3300047321 | Bacteria | 28858 |
| 237 | Ga0495676_0001759 | 3300047321 | Bacteria | 18921 |
| 238 | Ga0495676_0044610 | 3300047321 | Bacteria | 3618 |
| 239 | Ga0495680_0000215 | 3300047322 | Bacteria | 63049 |
| 240 | Ga0495680_0002422 | 3300047322 | Bacteria | 19086 |
| 241 | Ga0495675_0000047 | 3300047444 | Bacteria | 82513 |
| 242 | Ga0495675_0031419 | 3300047444 | Bacteria | 3390 |
| 243 | Ga0495602_0000008 | 3300048088 | Bacteria | 260157 |
| 244 | Ga0495602_0035988 | 3300048088 | Bacteria | 4612 |
| 245 | Ga0495614_0043714 | 3300048089 | Bacteria | 1922 |
| 246 | Ga0496100_0000003 | 3300048903 | Bacteria | 360802 |
| 247 | Ga0496100_0000063 | 3300048903 | Bacteria | 60957 |
| 248 | Ga0496100_0012776 | 3300048903 | Bacteria | 4825 |
| 249 | Ga0496101_0000003 | 3300048904 | Bacteria | 406565 |
| 250 | Ga0496101_0000012 | 3300048904 | Bacteria | 268127 |
| 251 | Ga0496101_0117172 | 3300048904 | Bacteria | 2011 |
| 252 | Ga0496102_0000061 | 3300048905 | Bacteria | 167066 |
| 253 | Ga0496103_0000044 | 3300048906 | Bacteria | 167066 |
| 254 | Ga0496103_0001299 | 3300048906 | Bacteria | 17003 |
| 255 | Ga0496104_0000002 | 3300048907 | Bacteria | 686017 |
| 256 | Ga0496104_0000666 | 3300048907 | Bacteria | 29447 |
| 257 | Ga0496104_0042848 | 3300048907 | Bacteria | 4250 |
| 258 | Ga0496104_0046624 | 3300048907 | Bacteria | 4082 |
| 259 | Ga0496104_0089805 | 3300048907 | Bacteria | 2935 |
| 260 | Ga0496104_0160291 | 3300048907 | Bacteria | 2158 |
| 261 | Ga0496105_0000001 | 3300048908 | Bacteria | 1328178 |
| 262 | Ga0496105_0027286 | 3300048908 | Bacteria | 4662 |
| 263 | Ga0496106_0000015 | 3300048909 | Bacteria | 187570 |
| 264 | Ga0496106_0000020 | 3300048909 | Bacteria | 169168 |
| 265 | Ga0496106_0000160 | 3300048909 | Bacteria | 48936 |
| 266 | Ga0496106_0077891 | 3300048909 | Bacteria | 2543 |
| 267 | Ga0496107_0000008 | 3300048910 | Bacteria | 251874 |
| 268 | Ga0496107_0000014 | 3300048910 | Bacteria | 176738 |
| 269 | Ga0496107_0010497 | 3300048910 | Bacteria | 6438 |
| 270 | Ga0496107_0012183 | 3300048910 | Bacteria | 6000 |
| 271 | Ga0496107_0086142 | 3300048910 | Bacteria | 2293 |
| 272 | Ga0496108_0000025 | 3300048911 | Bacteria | 177919 |
| 273 | Ga0496108_0003574 | 3300048911 | Bacteria | 12457 |
| 274 | Ga0496108_0011967 | 3300048911 | Bacteria | 7058 |
| 275 | Ga0496109_0000025 | 3300048912 | Bacteria | 171741 |
| 276 | Ga0496109_0000046 | 3300048912 | Bacteria | 131025 |
| 277 | Ga0496109_0000852 | 3300048912 | Bacteria | 25512 |
| 278 | Ga0496109_0199577 | 3300048912 | Bacteria | 1880 |
| 279 | Ga0496110_0000004 | 3300048913 | Bacteria | 122867 |
| 280 | Ga0496110_0023543 | 3300048913 | Bacteria | 5240 |
| 281 | Ga0496110_0043422 | 3300048913 | Bacteria | 3925 |
| 282 | Ga0496110_0238133 | 3300048913 | Bacteria | 1656 |
| 283 | Ga0496111_0000007 | 3300048914 | Bacteria | 103885 |
| 284 | Ga0496112_0000003 | 3300048915 | Bacteria | 660147 |
| 285 | Ga0496112_0004814 | 3300048915 | Bacteria | 11523 |
| 286 | Ga0496112_0155395 | 3300048915 | Bacteria | 2254 |
| 287 | Ga0496112_0183592 | 3300048915 | Bacteria | 2055 |
| 288 | Ga0496113_0000019 | 3300048916 | Bacteria | 72625 |
| 289 | Ga0496113_0021805 | 3300048916 | Bacteria | 4523 |
| 290 | Ga0496113_0041732 | 3300048916 | Bacteria | 3387 |
| 291 | Ga0496114_0000010 | 3300048917 | Bacteria | 363396 |
| 292 | Ga0496114_0029526 | 3300048917 | Bacteria | 4508 |
| 293 | Ga0496114_0088959 | 3300048917 | Bacteria | 2620 |
| 294 | Ga0496115_0000004 | 3300048918 | Bacteria | 319734 |
| 295 | Ga0496115_0000082 | 3300048918 | Bacteria | 87212 |
| 296 | Ga0496115_0007671 | 3300048918 | Bacteria | 7951 |
| 297 | Ga0496117_0008745 | 3300048920 | Bacteria | 9564 |
| 298 | Ga0496118_0000151 | 3300048921 | Bacteria | 122978 |
| 299 | Ga0496119_0007231 | 3300048922 | Bacteria | 10051 |
| 300 | Ga0496119_0010891 | 3300048922 | Bacteria | 7598 |
| 301 | Ga0496121_0001675 | 3300048924 | Bacteria | 36420 |
| 302 | Ga0496121_0082008 | 3300048924 | Bacteria | 2551 |
| 303 | Ga0496125_0021984 | 3300048928 | Bacteria | 5932 |
| 304 | Ga0501031_0000089 | 3300049568 | Bacteria | 49213 |
| 305 | Ga0501032_0000662 | 3300049569 | Bacteria | 27963 |
| 306 | Ga0501033_0000176 | 3300049570 | Bacteria | 60803 |
| 307 | Ga0501034_0037709 | 3300049571 | Bacteria | 4895 |
| 308 | Ga0501034_0076171 | 3300049571 | Bacteria | 3362 |
| 309 | Ga0501036_0000070 | 3300049572 | Bacteria | 62492 |
| 310 | Ga0501037_0000223 | 3300049573 | Bacteria | 49349 |
| 311 | Ga0501038_0000217 | 3300049574 | Bacteria | 49242 |
| 312 | Ga0501042_0010111 | 3300049578 | Bacteria | 6311 |
| 313 | Ga0501042_0019867 | 3300049578 | Bacteria | 4671 |
| 314 | Ga0501042_0020498 | 3300049578 | Bacteria | 4602 |
| 315 | Ga0501043_0001388 | 3300049579 | Bacteria | 21170 |
| 316 | Ga0501046_0000152 | 3300049580 | Bacteria | 72174 |
| 317 | Ga0501047_0000063 | 3300049581 | Bacteria | 136761 |
| 318 | Ga0501047_0020678 | 3300049581 | Bacteria | 6319 |
| 319 | Ga0501048_0000084 | 3300049582 | Bacteria | 49173 |
| 320 | Ga0501067_0052708 | 3300049583 | Bacteria | 2254 |
| 321 | Ga0501068_0009979 | 3300049584 | Bacteria | 5325 |
| 322 | Ga0501070_0135871 | 3300049586 | Bacteria | 2030 |
| 323 | Ga0501072_0016476 | 3300049588 | Bacteria | 5676 |
| 324 | Ga0501073_0001355 | 3300049589 | Bacteria | 18080 |
| 325 | Ga0501073_0099656 | 3300049589 | Bacteria | 2017 |
| 326 | Ga0501074_0011739 | 3300049590 | Bacteria | 6368 |
| 327 | Ga0501079_0009531 | 3300049741 | Bacteria | 7362 |
| 328 | Ga0501080_0015334 | 3300049742 | Bacteria | 7063 |
| 329 | Ga0501080_0019445 | 3300049742 | Bacteria | 6290 |
| 330 | Ga0501083_0000394 | 3300049744 | Bacteria | 27768 |
| 331 | Ga0501035_0000194 | 3300049822 | Bacteria | 74487 |
| 332 | Ga0501044_0000331 | 3300049823 | Bacteria | 59709 |
| 333 | nmdc:mga03n38_12689_c1 | 3300050490 | Bacteria | 3179 |
| 334 | nmdc:mga00v17_35318_c2 | 3300050491 | Bacteria | 2530 |
| 335 | nmdc:mga00v17_89406_c1 | 3300050491 | Bacteria | 1932 |
| 336 | nmdc:mga0yw44_10917_c1 | 3300050492 | Bacteria | 4658 |
| 337 | nmdc:mga0yw44_6223_c1 | 3300050492 | Bacteria | 5743 |
| 338 | nmdc:mga0qj67_47587_c1 | 3300050509 | Bacteria | 3388 |
| 339 | nmdc:mga06r32_53342_c1 | 3300050510 | Bacteria | 3873 |
| 340 | nmdc:mga08y16_74129_c1 | 3300050511 | Bacteria | 3546 |
| 341 | nmdc:mga0n895_50043_c1 | 3300050512 | Bacteria | 4096 |
| 342 | nmdc:mga0a205_164936_c1 | 3300050515 | Bacteria | 2111 |
| 343 | nmdc:mga0a205_1_c1 | 3300050515 | Bacteria | 62269 |
| 344 | Ga0495601_0000037 | 3300053077 | Bacteria | 81377 |
| 345 | Ga0495601_0000169 | 3300053077 | Bacteria | 35095 |
| 346 | Ga0495612_0000198 | 3300053078 | Bacteria | 25551 |
| 347 | Ga0495612_0001876 | 3300053078 | Bacteria | 8643 |
| 348 | Ga0495612_0011500 | 3300053078 | Bacteria | 3569 |
| 349 | Ga0495655_0000003 | 3300053083 | Bacteria | 303053 |
| 350 | Ga0495595_0000004 | 3300053084 | Bacteria | 260821 |
| 351 | Ga0495595_0011998 | 3300053084 | Bacteria | 3634 |
| 352 | Ga0495619_0000015 | 3300053085 | Bacteria | 252787 |
| 353 | Ga0495619_0000038 | 3300053085 | Bacteria | 121365 |
| 354 | Ga0495619_0000224 | 3300053085 | Bacteria | 41037 |
| 355 | Ga0495619_0000925 | 3300053085 | Bacteria | 19307 |
| 356 | Ga0500566_0004062 | 3300053094 | Bacteria | 8720 |
| 357 | Ga0500595_009266 | 3300053119 | Bacteria | 3980 |
| 358 | Ga0500614_000804 | 3300053123 | Bacteria | 7968 |
| 359 | Ga0500628_000002 | 3300053129 | Bacteria | 357687 |
| 360 | Ga0501084_0106993 | 3300054114 | Bacteria | 2350 |
| 361 | Ga0501082_0006361 | 3300060353 | Bacteria | 10248 |
| 362 | Ga0496121_0070900 | |||
| 363 | JGI24740J21852_10002646 | |||
| 364 | JGI24748J21848_1000282 | |||
| 365 | Ga0070658_10018877 | |||
| 366 | Ga0070683_100006314 | |||
| 367 | Ga0070683_100029573 | |||
| 368 | Ga0070677_10000034 | |||
| 369 | Ga0070682_100000029 | |||
| 370 | Ga0070682_100000367 | |||
| 371 | Ga0068868_100006839 | |||
| 372 | Ga0068868_100010446 | |||
| 373 | Ga0068868_100048934 | |||
| 374 | Ga0070691_10000069 | |||
| 375 | Ga0070661_100000045 | |||
| 376 | Ga0070668_100067325 | |||
| 377 | Ga0070669_100074939 | |||
| 378 | Ga0070675_100000187 | |||
| 379 | Ga0070674_100000011 | |||
| 380 | Ga0070674_100000014 | |||
| 381 | Ga0070688_100001078 | |||
| 382 | Ga0070659_100016841 | |||
| 383 | Ga0070667_100000374 | |||
| 384 | Ga0070667_100030723 | |||
| 385 | Ga0070714_100043702 | |||
| 386 | Ga0070713_100040889 | |||
| 387 | Ga0070700_100075276 | |||
| 388 | Ga0070662_100000008 | |||
| 389 | Ga0070685_10001067 | |||
| 390 | Ga0070679_100000651 | |||
| 391 | Ga0070684_100032327 | |||
| 392 | Ga0068853_100007653 | |||
| 393 | Ga0070672_100000003 | |||
| 394 | Ga0070686_100043988 | |||
| 395 | Ga0070695_100111289 | |||
| 396 | Ga0070665_100000270 | |||
| 397 | Ga0070665_100000690 | |||
| 398 | Ga0070665_100012626 | |||
| 399 | Ga0070664_100030686 | |||
| 400 | Ga0068854_100000241 | |||
| 401 | Ga0068856_100006108 | |||
| 402 | Ga0068866_10000002 | |||
| 403 | Ga0068866_10000219 | |||
| 404 | Ga0068851_10000342 | |||
| 405 | Ga0068851_10015508 | |||
| 406 | Ga0068858_100000086 | |||
| 407 | Ga0068858_100000155 | |||
| 408 | Ga0068860_100065894 | |||
| 409 | Ga0068862_100000278 | |||
| 410 | Ga0081455_10008014 | |||
| 411 | Ga0081455_10009608 | |||
| 412 | Ga0081455_10019444 | |||
| 413 | Ga0081455_10074752 | |||
| 414 | Ga0081540_1000174 | |||
| 415 | Ga0081539_10015072 | |||
| 416 | Ga0070717_10005075 | |||
| 417 | Ga0075365_10000796 | |||
| 418 | Ga0075365_10002193 | |||
| 419 | Ga0075363_100008170 | |||
| 420 | Ga0070715_10000015 | |||
| 421 | Ga0070712_100002378 | |||
| 422 | Ga0070712_100051817 | |||
| 423 | Ga0075428_100106599 | |||
| 424 | Ga0075430_100029047 | |||
| 425 | Ga0075431_100059905 | |||
| 426 | Ga0075433_10001385 | |||
| 427 | Ga0068865_100000033 | |||
| 428 | Ga0111539_10082079 | |||
| 429 | Ga0111539_10180164 | |||
| 430 | Ga0105245_10000425 | |||
| 431 | Ga0105245_10000585 | |||
| 432 | Ga0105245_10004158 | |||
| 433 | Ga0105245_10005090 | |||
| 434 | Ga0105245_10031235 | |||
| 435 | Ga0105247_10001139 | |||
| 436 | Ga0105247_10067570 | |||
| 437 | Ga0114129_10014838 | |||
| 438 | Ga0114129_10087004 | |||
| 439 | Ga0105243_10001250 | |||
| 440 | Ga0105242_10003005 | |||
| 441 | Ga0105242_10081552 | |||
| 442 | Ga0105248_10000022 | |||
| 443 | Ga0105238_10000299 | |||
| 444 | Ga0105249_10000085 | |||
| 445 | Ga0105249_10000588 | |||
| 446 | Ga0105239_10015091 | |||
| 447 | Ga0105239_10247455 | |||
| 448 | Ga0157371_10027310 | |||
| 449 | Ga0157369_10000173 | |||
| 450 | Ga0157372_10061189 | |||
| 451 | Ga0157375_10000184 | |||
| 452 | Ga0157375_10035850 | |||
| 453 | Ga0163163_10119615 | |||
| 454 | Ga0157380_10000017 | |||
| 455 | Ga0157380_10000072 | |||
| 456 | Ga0157376_10085028 | |||
| 457 | Ga0163161_10000173 | |||
| 458 | Ga0213876_10007818 | |||
| 459 | Ga0209051_1001401 | |||
| 460 | Ga0207656_10000068 | |||
| 461 | Ga0207656_10006654 | |||
| 462 | Ga0207682_10000457 | |||
| 463 | Ga0207642_10000001 | |||
| 464 | Ga0207642_10000003 | |||
| 465 | Ga0207642_10000049 | |||
| 466 | Ga0207642_10023483 | |||
| 467 | Ga0207710_10000151 | |||
| 468 | Ga0207680_10007357 | |||
| 469 | Ga0207680_10059511 | |||
| 470 | Ga0207685_10000001 | |||
| 471 | Ga0207705_10015631 | |||
| 472 | Ga0207693_10001174 | |||
| 473 | Ga0207693_10004622 | |||
| 474 | Ga0207663_10002675 | |||
| 475 | Ga0207660_10009069 | |||
| 476 | Ga0207649_10000021 | |||
| 477 | Ga0207652_10000150 | |||
| 478 | Ga0207681_10036210 | |||
| 479 | Ga0207694_10000035 | |||
| 480 | Ga0207659_10000074 | |||
| 481 | Ga0207687_10000021 | |||
| 482 | Ga0207687_10000042 | |||
| 483 | Ga0207687_10000716 | |||
| 484 | Ga0207687_10050590 | |||
| 485 | Ga0207700_10000013 | |||
| 486 | Ga0207700_10015047 | |||
| 487 | Ga0207664_10003085 | |||
| 488 | Ga0207690_10041655 | |||
| 489 | Ga0207706_10000016 | |||
| 490 | Ga0207686_10002936 | |||
| 491 | Ga0207669_10000007 | |||
| 492 | Ga0207669_10000027 | |||
| 493 | Ga0207704_10000029 | |||
| 494 | Ga0207691_10000005 | |||
| 495 | Ga0207711_10000019 | |||
| 496 | Ga0207661_10000145 | |||
| 497 | Ga0207661_10007439 | |||
| 498 | Ga0207679_10026066 | |||
| 499 | Ga0207712_10000033 | |||
| 500 | Ga0207668_10029850 | |||
| 501 | Ga0207640_10000026 | |||
| 502 | Ga0207658_10001722 | |||
| 503 | Ga0207658_10004945 | |||
| 504 | Ga0207658_10043668 | |||
| 505 | Ga0207677_10000430 | |||
| 506 | Ga0207677_10001018 | |||
| 507 | Ga0207703_10000072 | |||
| 508 | Ga0207639_10005361 | |||
| 509 | Ga0207678_10001068 | |||
| 510 | Ga0207708_10064569 | |||
| 511 | Ga0207702_10001072 | |||
| 512 | Ga0207641_10000231 | |||
| 513 | Ga0207641_10024111 | |||
| 514 | Ga0268266_10000076 | |||
| 515 | Ga0268266_10000182 | |||
| 516 | Ga0268266_10000825 | |||
| 517 | Ga0268265_10002932 | |||
| 518 | Ga0265319_1000029 | |||
| 519 | Ga0265338_10000179 | |||
| 520 | Ga0265327_10031908 | |||
| 521 | Ga0307412_10068791 | |||
| 522 | Ga0307416_100032438 | |||
| 523 | Ga0307416_100096385 | |||
| 524 | Ga0307415_100011807 | |||
| 525 | Ga0316574_0002823 | |||
| 526 | Ga0373937_0004062 | |||
| 527 | Ga0395900_0019159 | |||
| 528 | Ga0395900_0048861 | |||
| 529 | Ga0395900_0071054 | |||
| 530 | Ga0395900_0210804 | |||
| 531 | Ga0395898_0003610 | |||
| 532 | Ga0395898_0015594 | |||
| 533 | Ga0395905_0009334 | |||
| 534 | Ga0395905_0085603 | |||
| 535 | Ga0395901_0008833 | |||
| 536 | Ga0395901_0018235 | |||
| 537 | Ga0395901_0025805 | |||
| 538 | Ga0395901_0157421 | |||
| 539 | Ga0436365_0862230 | |||
| 540 | Ga0466966_0102036 | |||
| 541 | Ga0466957_0002455 | |||
| 542 | Ga0466959_0031241 | |||
| 543 | Ga0466958_0026712 | |||
| 544 | Ga0466967_0000007 | |||
| 545 | Ga0466967_0128688 | |||
| 546 | Ga0495603_0000045 | |||
| 547 | Ga0495603_0000622 | |||
| 548 | Ga0495629_0000823 | |||
| 549 | Ga0495638_0001471 | |||
| 550 | Ga0495638_0040274 | |||
| 551 | Ga0495641_0000001 | |||
| 552 | Ga0495641_0008957 | |||
| 553 | Ga0495641_0036245 | |||
| 554 | Ga0495594_0000005 | |||
| 555 | Ga0495606_0000131 | |||
| 556 | Ga0495608_0000021 | |||
| 557 | Ga0495608_0123242 | |||
| 558 | Ga0495618_0000004 | |||
| 559 | Ga0495628_0055213 | |||
| 560 | Ga0495628_0103419 | |||
| 561 | Ga0495628_0150928 | |||
| 562 | Ga0495630_0000007 | |||
| 563 | Ga0495630_0000168 | |||
| 564 | Ga0495630_0078470 | |||
| 565 | Ga0495644_0000454 | |||
| 566 | Ga0495652_0000022 | |||
| 567 | Ga0495652_0049423 | |||
| 568 | Ga0495586_0001141 | |||
| 569 | Ga0495587_0002697 | |||
| 570 | Ga0495587_0048529 | |||
| 571 | Ga0495645_0000145 | |||
| 572 | Ga0495645_0003853 | |||
| 573 | Ga0495645_0021244 | |||
| 574 | Ga0495622_0000026 | |||
| 575 | Ga0495667_0000044 | |||
| 576 | Ga0495667_0084332 | |||
| 577 | Ga0495656_0001237 | |||
| 578 | Ga0495634_0000013 | |||
| 579 | Ga0495634_0001787 | |||
| 580 | Ga0495634_0006825 | |||
| 581 | Ga0495625_0000204 | |||
| 582 | Ga0495635_0004856 | |||
| 583 | Ga0495588_0000262 | |||
| 584 | Ga0495657_0000019 | |||
| 585 | Ga0495647_0000003 | |||
| 586 | Ga0495647_0044585 | |||
| 587 | Ga0495658_0010401 | |||
| 588 | Ga0495669_0041737 | |||
| 589 | Ga0495613_0000260 | |||
| 590 | Ga0495613_0000369 | |||
| 591 | Ga0495613_0028959 | |||
| 592 | Ga0495624_0000164 | |||
| 593 | Ga0495624_0000592 | |||
| 594 | Ga0495600_0002135 | |||
| 595 | Ga0495581_0020152 | |||
| 596 | Ga0495604_0003117 | |||
| 597 | Ga0495676_0000652 | |||
| 598 | Ga0495676_0001759 | |||
| 599 | Ga0495676_0044610 | |||
| 600 | Ga0495680_0000215 | |||
| 601 | Ga0495680_0002422 | |||
| 602 | Ga0495675_0000047 | |||
| 603 | Ga0495675_0031419 | |||
| 604 | Ga0495602_0000008 | |||
| 605 | Ga0495602_0035988 | |||
| 606 | Ga0495614_0043714 | |||
| 607 | Ga0496100_0000003 | |||
| 608 | Ga0496100_0000063 | |||
| 609 | Ga0496100_0012776 | |||
| 610 | Ga0496101_0000003 | |||
| 611 | Ga0496101_0000012 | |||
| 612 | Ga0496101_0117172 | |||
| 613 | Ga0496102_0000061 | |||
| 614 | Ga0496103_0000044 | |||
| 615 | Ga0496103_0001299 | |||
| 616 | Ga0496104_0000002 | |||
| 617 | Ga0496104_0000666 | |||
| 618 | Ga0496104_0042848 | |||
| 619 | Ga0496104_0046624 | |||
| 620 | Ga0496104_0089805 | |||
| 621 | Ga0496104_0160291 | |||
| 622 | Ga0496105_0000001 | |||
| 623 | Ga0496105_0027286 | |||
| 624 | Ga0496106_0000015 | |||
| 625 | Ga0496106_0000020 | |||
| 626 | Ga0496106_0000160 | |||
| 627 | Ga0496106_0077891 | |||
| 628 | Ga0496107_0000008 | |||
| 629 | Ga0496107_0000014 | |||
| 630 | Ga0496107_0010497 | |||
| 631 | Ga0496107_0012183 | |||
| 632 | Ga0496107_0086142 | |||
| 633 | Ga0496108_0000025 | |||
| 634 | Ga0496108_0003574 | |||
| 635 | Ga0496108_0011967 | |||
| 636 | Ga0496109_0000025 | |||
| 637 | Ga0496109_0000046 | |||
| 638 | Ga0496109_0000852 | |||
| 639 | Ga0496109_0199577 | |||
| 640 | Ga0496110_0000004 | |||
| 641 | Ga0496110_0023543 | |||
| 642 | Ga0496110_0043422 | |||
| 643 | Ga0496110_0238133 | |||
| 644 | Ga0496111_0000007 | |||
| 645 | Ga0496112_0000003 | |||
| 646 | Ga0496112_0004814 | |||
| 647 | Ga0496112_0155395 | |||
| 648 | Ga0496112_0183592 | |||
| 649 | Ga0496113_0000019 | |||
| 650 | Ga0496113_0021805 | |||
| 651 | Ga0496113_0041732 | |||
| 652 | Ga0496114_0000010 | |||
| 653 | Ga0496114_0029526 | |||
| 654 | Ga0496114_0088959 | |||
| 655 | Ga0496115_0000004 | |||
| 656 | Ga0496115_0000082 | |||
| 657 | Ga0496115_0007671 | |||
| 658 | Ga0496117_0008745 | |||
| 659 | Ga0496118_0000151 | |||
| 660 | Ga0496119_0007231 | |||
| 661 | Ga0496119_0010891 | |||
| 662 | Ga0496121_0001675 | |||
| 663 | Ga0496121_0082008 | |||
| 664 | Ga0496125_0021984 | |||
| 665 | Ga0501031_0000089 | |||
| 666 | Ga0501032_0000662 | |||
| 667 | Ga0501033_0000176 | |||
| 668 | Ga0501034_0037709 | |||
| 669 | Ga0501034_0076171 | |||
| 670 | Ga0501036_0000070 | |||
| 671 | Ga0501037_0000223 | |||
| 672 | Ga0501038_0000217 | |||
| 673 | Ga0501042_0010111 | |||
| 674 | Ga0501042_0019867 | |||
| 675 | Ga0501042_0020498 | |||
| 676 | Ga0501043_0001388 | |||
| 677 | Ga0501046_0000152 | |||
| 678 | Ga0501047_0000063 | |||
| 679 | Ga0501047_0020678 | |||
| 680 | Ga0501048_0000084 | |||
| 681 | Ga0501067_0052708 | |||
| 682 | Ga0501068_0009979 | |||
| 683 | Ga0501070_0135871 | |||
| 684 | Ga0501072_0016476 | |||
| 685 | Ga0501073_0001355 | |||
| 686 | Ga0501073_0099656 | |||
| 687 | Ga0501074_0011739 | |||
| 688 | Ga0501079_0009531 | |||
| 689 | Ga0501080_0015334 | |||
| 690 | Ga0501080_0019445 | |||
| 691 | Ga0501083_0000394 | |||
| 692 | Ga0501035_0000194 | |||
| 693 | Ga0501044_0000331 | |||
| 694 | nmdc:mga03n38_12689_c1 | |||
| 695 | nmdc:mga00v17_35318_c2 | |||
| 696 | nmdc:mga00v17_89406_c1 | |||
| 697 | nmdc:mga0yw44_10917_c1 | |||
| 698 | nmdc:mga0yw44_6223_c1 | |||
| 699 | nmdc:mga0qj67_47587_c1 | |||
| 700 | nmdc:mga06r32_53342_c1 | |||
| 701 | nmdc:mga08y16_74129_c1 | |||
| 702 | nmdc:mga0n895_50043_c1 | |||
| 703 | nmdc:mga0a205_164936_c1 | |||
| 704 | nmdc:mga0a205_1_c1 | |||
| 705 | Ga0495601_0000037 | |||
| 706 | Ga0495601_0000169 | |||
| 707 | Ga0495612_0000198 | |||
| 708 | Ga0495612_0001876 | |||
| 709 | Ga0495612_0011500 | |||
| 710 | Ga0495655_0000003 | |||
| 711 | Ga0495595_0000004 | |||
| 712 | Ga0495595_0011998 | |||
| 713 | Ga0495619_0000015 | |||
| 714 | Ga0495619_0000038 | |||
| 715 | Ga0495619_0000224 | |||
| 716 | Ga0495619_0000925 | |||
| 717 | Ga0500566_0004062 | |||
| 718 | Ga0500595_009266 | |||
| 719 | Ga0500614_000804 | |||
| 720 | Ga0500628_000002 | |||
| 721 | Ga0501084_0106993 | |||
| 722 | Ga0501082_0006361 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6qsi-assembly1.cif.gz_A | pseudomonas fluorescens pf-5 thiamine diphosphate-dependent 4-hydroxybenzoylformate decarboxylase | 0.937 | 2 | 525 |
| 4jub-assembly1.cif.gz_C | crystal structure of the his70thr mutant of benzoylformate decarboxylase from pseudomonas putida | 0.9346 | 2 | 526 |
| 4mq5-assembly1.cif.gz_A | crystal structure of benzoylformate decarboxylase mutant a306f | 0.9339 | 2 | 526 |
| 2v3w-assembly1.cif.gz_A | crystal structure of the benzoylformate decarboxylase variant l461a from pseudomonas putida | 0.9338 | 2 | 527 |
| 4k9k-assembly1.cif.gz_A | crystal structure of the his281tyr mutant of benzoylformate decarboxylase from pseudomonas putida | 0.9337 | 2 | 526 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4k9lA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain | 0.952 | 187 | 344 | 3.40.50.1220 |
| 4q9dB02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain | 0.9412 | 181 | 344 | 3.40.50.1220 |
| 4q9dB02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain | 0.9357 | 181 | 344 | 3.40.50.1220 |
| 4k9qB02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain | 0.9303 | 181 | 341 | 3.40.50.1220 |
| 4k9qB03 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.9252 | 345 | 532 | 3.40.50.970 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W0XKF6-F1-model_v4 | Benzoylformate decarboxylase | 0.9483 | 207 | 530 |
GO:0000287
GO:0003984 GO:0019752 GO:0030976 GO:0050660 |
| AF-A0A1E7IBG6-F1-model_v4 | Benzoylformate decarboxylase | 0.947 | 178 | 526 |
GO:0000287
GO:0003984 GO:0030976 GO:0050660 |
| AF-A0A3C0FEI9-F1-model_v4 | Thiamine pyrophosphate enzyme TPP-binding domain-containing protein | 0.9422 | 403 | 526 |
GO:0000287
GO:0003984 GO:0005948 GO:0009097 GO:0009099 GO:0030976 GO:0050660 |
| AF-A0A533J589-F1-model_v4 | deleted | 0.9395 | 119 | 532 |
|
| AF-A0A7Z9NRT6-F1-model_v4 | Acetolactate synthase large subunit | 0.9386 | 405 | 525 |
GO:0000287
GO:0003984 GO:0005948 GO:0009097 GO:0009099 GO:0030976 GO:0050660 |