F422367

General Info

Members Datasets Scaffolds Average Seq Length
361 226 722 518

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0070900|Ga0496121_0070900_783_2546
Length 587
Sequence MVSSFTFLKSTVAGGRLTPAPRCKISPRNRYLDLCGVRADDRSAEVGAVAGRLAPMPTVREATFDLFREQGMTTIFGNPGSTELPMLADYPADFRYVLGLQEAVVVGMADGFAQASGRTTAVNLHTAPGVGNAMGAIFNAQANHSPLLITAGQQARAQITLQANLTNRDATRMPHPLVKWSYEPPRAEDVPLALAHGIHLAGLAPRGPVFVSLPMDDWDVEVDPADARHAVTRKVTGRAVADPAAVAALAAELDAAQNPVLVAGPDIDTAGGWDSAVALAERQRLPVWASPATGGVRLGFPEDHPNFRGVLPPAIGPVGQTLEGHDLIVVIGSSVFPYYPHIPGPLLPEGARLVAITSDPDEAVRAPMGDAIVADVGLTLAALVEAVPESGRPGPEPNAGPGEMKITDPLDASTVHGALREVLPEDAIVVLESPSSTLALRNQLRISRPGSYYFSAGGGLGFGLAASIGVQIAEPSRPVVCVLGEGSAQYAITAFWSAVAYDVPVTFLVLRNEEYAILKWFAEVGQITGAPGLDLPKLDVAAVAEGYGVTAHRAADRDGVAAALAGALASSKPELVEVPVAPGMSLF

Samples

Sample ID Description Type Environment
1 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
70 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
112 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
113 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
124 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
125 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
126 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
127 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
128 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
129 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
130 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
131 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
132 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
133 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
134 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
135 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
136 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
137 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
138 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
139 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
140 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
141 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
142 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
143 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
144 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
145 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
146 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
147 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
148 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
149 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
150 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
151 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
152 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
153 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
154 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
155 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
156 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
157 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
158 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
159 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
160 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
161 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
162 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
163 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
164 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
165 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
166 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
179 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
180 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
181 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
182 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
183 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
184 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
185 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
198 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
199 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
200 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
201 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
202 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
203 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
205 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
209 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
210 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
211 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
212 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
216 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
217 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
218 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
219 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
220 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
221 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
222 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
223 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
224 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
225 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
226 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.6
Nodule 0
Rhizoplane 14.13
Rhizosphere 79.5
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496121_0070900 3300048924 Bacteria 2804
2 JGI24740J21852_10002646 3300001979 Bacteria 8064
3 JGI24748J21848_1000282 3300002074 Bacteria 5970
4 Ga0070658_10018877 3300005327 Bacteria 5524
5 Ga0070683_100006314 3300005329 Bacteria 9943
6 Ga0070683_100029573 3300005329 Bacteria 4962
7 Ga0070677_10000034 3300005333 Bacteria 41098
8 Ga0070682_100000029 3300005337 Bacteria 183516
9 Ga0070682_100000367 3300005337 Bacteria 30395
10 Ga0068868_100006839 3300005338 Bacteria 8099
11 Ga0068868_100010446 3300005338 Bacteria 6722
12 Ga0068868_100048934 3300005338 Bacteria 3317
13 Ga0070691_10000069 3300005341 Bacteria 28638
14 Ga0070661_100000045 3300005344 Bacteria 94702
15 Ga0070668_100067325 3300005347 Bacteria 2782
16 Ga0070669_100074939 3300005353 Bacteria 2509
17 Ga0070675_100000187 3300005354 Bacteria 38675
18 Ga0070674_100000011 3300005356 Bacteria 134886
19 Ga0070674_100000014 3300005356 Bacteria 100122
20 Ga0070688_100001078 3300005365 Bacteria 13685
21 Ga0070659_100016841 3300005366 Bacteria 5492
22 Ga0070667_100000374 3300005367 Bacteria 48918
23 Ga0070667_100030723 3300005367 Bacteria 4480
24 Ga0070714_100043702 3300005435 Bacteria 3791
25 Ga0070713_100040889 3300005436 Bacteria 3773
26 Ga0070700_100075276 3300005441 Bacteria 2165
27 Ga0070662_100000008 3300005457 Bacteria 168754
28 Ga0070685_10001067 3300005466 Bacteria 14706
29 Ga0070679_100000651 3300005530 Bacteria 29562
30 Ga0070684_100032327 3300005535 Bacteria 4459
31 Ga0068853_100007653 3300005539 Bacteria 8659
32 Ga0070672_100000003 3300005543 Bacteria 159532
33 Ga0070686_100043988 3300005544 Bacteria 2804
34 Ga0070695_100111289 3300005545 Bacteria 1859
35 Ga0070665_100000270 3300005548 Bacteria 85249
36 Ga0070665_100000690 3300005548 Bacteria 45099
37 Ga0070665_100012626 3300005548 Bacteria 8505
38 Ga0070664_100030686 3300005564 Bacteria 4486
39 Ga0068854_100000241 3300005578 Bacteria 37275
40 Ga0068856_100006108 3300005614 Bacteria 11828
41 Ga0068866_10000002 3300005718 Bacteria 394090
42 Ga0068866_10000219 3300005718 Bacteria 27162
43 Ga0068851_10000342 3300005834 Bacteria 21002
44 Ga0068851_10015508 3300005834 Bacteria 3631
45 Ga0068858_100000086 3300005842 Bacteria 96201
46 Ga0068858_100000155 3300005842 Bacteria 72794
47 Ga0068860_100065894 3300005843 Bacteria 3439
48 Ga0068862_100000278 3300005844 Bacteria 57006
49 Ga0081455_10008014 3300005937 Bacteria 11038
50 Ga0081455_10009608 3300005937 Bacteria 9932
51 Ga0081455_10019444 3300005937 Bacteria 6425
52 Ga0081455_10074752 3300005937 Bacteria 2797
53 Ga0081540_1000174 3300005983 Bacteria 67477
54 Ga0081539_10015072 3300005985 Bacteria 5660
55 Ga0070717_10005075 3300006028 Bacteria 9600
56 Ga0075365_10000796 3300006038 Bacteria 12920
57 Ga0075365_10002193 3300006038 Bacteria 9414
58 Ga0075363_100008170 3300006048 Bacteria 4859
59 Ga0070715_10000015 3300006163 Bacteria 152816
60 Ga0070712_100002378 3300006175 Bacteria 11583
61 Ga0070712_100051817 3300006175 Bacteria 2860
62 Ga0075428_100106599 3300006844 Bacteria 3055
63 Ga0075430_100029047 3300006846 Bacteria 4695
64 Ga0075431_100059905 3300006847 Bacteria 3928
65 Ga0075433_10001385 3300006852 Bacteria 17850
66 Ga0068865_100000033 3300006881 Bacteria 84342
67 Ga0111539_10082079 3300009094 Bacteria 3791
68 Ga0111539_10180164 3300009094 Bacteria 2468
69 Ga0105245_10000425 3300009098 Bacteria 39393
70 Ga0105245_10000585 3300009098 Bacteria 33073
71 Ga0105245_10004158 3300009098 Bacteria 12856
72 Ga0105245_10005090 3300009098 Bacteria 11563
73 Ga0105245_10031235 3300009098 Bacteria 4712
74 Ga0105247_10001139 3300009101 Bacteria 19674
75 Ga0105247_10067570 3300009101 Bacteria 2227
76 Ga0114129_10014838 3300009147 Bacteria 11103
77 Ga0114129_10087004 3300009147 Bacteria 4334
78 Ga0105243_10001250 3300009148 Bacteria 22828
79 Ga0105242_10003005 3300009176 Bacteria 13181
80 Ga0105242_10081552 3300009176 Bacteria 2705
81 Ga0105248_10000022 3300009177 Bacteria 275935
82 Ga0105238_10000299 3300009551 Bacteria 54293
83 Ga0105249_10000085 3300009553 Bacteria 133497
84 Ga0105249_10000588 3300009553 Bacteria 33205
85 Ga0105239_10015091 3300010375 Bacteria 8564
86 Ga0105239_10247455 3300010375 Bacteria 2002
87 Ga0157371_10027310 3300013102 Bacteria 4141
88 Ga0157369_10000173 3300013105 Bacteria 90860
89 Ga0157372_10061189 3300013307 Bacteria 4215
90 Ga0157375_10000184 3300013308 Bacteria 58368
91 Ga0157375_10035850 3300013308 Bacteria 4739
92 Ga0163163_10119615 3300014325 Bacteria 2667
93 Ga0157380_10000017 3300014326 Bacteria 119468
94 Ga0157380_10000072 3300014326 Bacteria 56363
95 Ga0157376_10085028 3300014969 Bacteria 2725
96 Ga0163161_10000173 3300017792 Bacteria 59103
97 Ga0213876_10007818 3300021384 Bacteria 5800
98 Ga0209051_1001401 3300025303 Bacteria 20760
99 Ga0207656_10000068 3300025321 Bacteria 39207
100 Ga0207656_10006654 3300025321 Bacteria 4172
101 Ga0207682_10000457 3300025893 Bacteria 18841
102 Ga0207642_10000001 3300025899 Bacteria 714030
103 Ga0207642_10000003 3300025899 Bacteria 650651
104 Ga0207642_10000049 3300025899 Bacteria 34592
105 Ga0207642_10023483 3300025899 Bacteria 2464
106 Ga0207710_10000151 3300025900 Bacteria 77424
107 Ga0207680_10007357 3300025903 Bacteria 5359
108 Ga0207680_10059511 3300025903 Bacteria 2321
109 Ga0207685_10000001 3300025905 Bacteria 604473
110 Ga0207705_10015631 3300025909 Bacteria 5448
111 Ga0207693_10001174 3300025915 Bacteria 23373
112 Ga0207693_10004622 3300025915 Bacteria 11615
113 Ga0207663_10002675 3300025916 Bacteria 8590
114 Ga0207660_10009069 3300025917 Bacteria 6442
115 Ga0207649_10000021 3300025920 Bacteria 209660
116 Ga0207652_10000150 3300025921 Bacteria 75189
117 Ga0207681_10036210 3300025923 Bacteria 3255
118 Ga0207694_10000035 3300025924 Bacteria 195870
119 Ga0207659_10000074 3300025926 Bacteria 63348
120 Ga0207687_10000021 3300025927 Bacteria 226396
121 Ga0207687_10000042 3300025927 Bacteria 108169
122 Ga0207687_10000716 3300025927 Bacteria 22524
123 Ga0207687_10050590 3300025927 Bacteria 2893
124 Ga0207700_10000013 3300025928 Bacteria 230462
125 Ga0207700_10015047 3300025928 Bacteria 5089
126 Ga0207664_10003085 3300025929 Bacteria 11067
127 Ga0207690_10041655 3300025932 Bacteria 3011
128 Ga0207706_10000016 3300025933 Bacteria 170697
129 Ga0207686_10002936 3300025934 Bacteria 9185
130 Ga0207669_10000007 3300025937 Bacteria 169904
131 Ga0207669_10000027 3300025937 Bacteria 91216
132 Ga0207704_10000029 3300025938 Bacteria 120526
133 Ga0207691_10000005 3300025940 Bacteria 163117
134 Ga0207711_10000019 3300025941 Bacteria 412779
135 Ga0207661_10000145 3300025944 Bacteria 45007
136 Ga0207661_10007439 3300025944 Bacteria 7795
137 Ga0207679_10026066 3300025945 Bacteria 4028
138 Ga0207712_10000033 3300025961 Bacteria 209336
139 Ga0207668_10029850 3300025972 Bacteria 3578
140 Ga0207640_10000026 3300025981 Bacteria 142343
141 Ga0207658_10001722 3300025986 Bacteria 16531
142 Ga0207658_10004945 3300025986 Bacteria 9196
143 Ga0207658_10043668 3300025986 Bacteria 3260
144 Ga0207677_10000430 3300026023 Bacteria 28263
145 Ga0207677_10001018 3300026023 Bacteria 15444
146 Ga0207703_10000072 3300026035 Bacteria 120727
147 Ga0207639_10005361 3300026041 Bacteria 8666
148 Ga0207678_10001068 3300026067 Bacteria 25098
149 Ga0207708_10064569 3300026075 Bacteria 2797
150 Ga0207702_10001072 3300026078 Bacteria 28003
151 Ga0207641_10000231 3300026088 Bacteria 72245
152 Ga0207641_10024111 3300026088 Bacteria 5014
153 Ga0268266_10000076 3300028379 Bacteria 217644
154 Ga0268266_10000182 3300028379 Bacteria 111453
155 Ga0268266_10000825 3300028379 Bacteria 40545
156 Ga0268265_10002932 3300028380 Bacteria 12506
157 Ga0265319_1000029 3300028563 Bacteria 131291
158 Ga0265338_10000179 3300028800 Bacteria 117995
159 Ga0265327_10031908 3300031251 Bacteria 2955
160 Ga0307412_10068791 3300031911 Bacteria 2409
161 Ga0307416_100032438 3300032002 Bacteria 3946
162 Ga0307416_100096385 3300032002 Bacteria 2558
163 Ga0307415_100011807 3300032126 Bacteria 5019
164 Ga0316574_0002823 3300035398 Bacteria 8816
165 Ga0373937_0004062 3300036401 Bacteria 12402
166 Ga0395900_0019159 3300037418 Bacteria 6979
167 Ga0395900_0048861 3300037418 Bacteria 4357
168 Ga0395900_0071054 3300037418 Bacteria 3578
169 Ga0395900_0210804 3300037418 Bacteria 1962
170 Ga0395898_0003610 3300037466 Bacteria 17228
171 Ga0395898_0015594 3300037466 Bacteria 7791
172 Ga0395905_0009334 3300037471 Bacteria 9594
173 Ga0395905_0085603 3300037471 Bacteria 2953
174 Ga0395901_0008833 3300038443 Bacteria 10199
175 Ga0395901_0018235 3300038443 Bacteria 7166
176 Ga0395901_0025805 3300038443 Bacteria 6033
177 Ga0395901_0157421 3300038443 Bacteria 2386
178 Ga0436365_0862230 3300039437 Bacteria 9658
179 Ga0466966_0102036 3300044684 Bacteria 1774
180 Ga0466957_0002455 3300044842 Bacteria 9950
181 Ga0466959_0031241 3300045049 Bacteria 3941
182 Ga0466958_0026712 3300045836 Bacteria 3413
183 Ga0466967_0000007 3300045976 Bacteria 135597
184 Ga0466967_0128688 3300045976 Bacteria 2348
185 Ga0495603_0000045 3300046455 Bacteria 53543
186 Ga0495603_0000622 3300046455 Bacteria 19869
187 Ga0495629_0000823 3300046459 Bacteria 25146
188 Ga0495638_0001471 3300046460 Bacteria 21269
189 Ga0495638_0040274 3300046460 Bacteria 2961
190 Ga0495641_0000001 3300046461 Bacteria 485224
191 Ga0495641_0008957 3300046461 Bacteria 6014
192 Ga0495641_0036245 3300046461 Bacteria 2319
193 Ga0495594_0000005 3300046499 Bacteria 175437
194 Ga0495606_0000131 3300046507 Bacteria 127298
195 Ga0495608_0000021 3300046511 Bacteria 168462
196 Ga0495608_0123242 3300046511 Bacteria 1661
197 Ga0495618_0000004 3300046514 Bacteria 245690
198 Ga0495628_0055213 3300046516 Bacteria 3129
199 Ga0495628_0103419 3300046516 Bacteria 2196
200 Ga0495628_0150928 3300046516 Bacteria 1770
201 Ga0495630_0000007 3300046517 Bacteria 376915
202 Ga0495630_0000168 3300046517 Bacteria 51209
203 Ga0495630_0078470 3300046517 Bacteria 2490
204 Ga0495644_0000454 3300046523 Bacteria 17881
205 Ga0495652_0000022 3300046529 Bacteria 178368
206 Ga0495652_0049423 3300046529 Bacteria 3600
207 Ga0495586_0001141 3300046535 Bacteria 14887
208 Ga0495587_0002697 3300046536 Bacteria 11844
209 Ga0495587_0048529 3300046536 Bacteria 2514
210 Ga0495645_0000145 3300046543 Bacteria 48403
211 Ga0495645_0003853 3300046543 Bacteria 10212
212 Ga0495645_0021244 3300046543 Bacteria 4690
213 Ga0495622_0000026 3300046557 Bacteria 137934
214 Ga0495667_0000044 3300046559 Bacteria 121910
215 Ga0495667_0084332 3300046559 Bacteria 2063
216 Ga0495656_0001237 3300046615 Bacteria 8311
217 Ga0495634_0000013 3300046642 Bacteria 130546
218 Ga0495634_0001787 3300046642 Bacteria 18578
219 Ga0495634_0006825 3300046642 Bacteria 8636
220 Ga0495625_0000204 3300046660 Bacteria 94356
221 Ga0495635_0004856 3300046663 Bacteria 9358
222 Ga0495588_0000262 3300046674 Bacteria 42637
223 Ga0495657_0000019 3300046675 Bacteria 168441
224 Ga0495647_0000003 3300046681 Bacteria 145235
225 Ga0495647_0044585 3300046681 Bacteria 1701
226 Ga0495658_0010401 3300046683 Bacteria 4655
227 Ga0495669_0041737 3300046684 Bacteria 2038
228 Ga0495613_0000260 3300046689 Bacteria 49751
229 Ga0495613_0000369 3300046689 Bacteria 39198
230 Ga0495613_0028959 3300046689 Bacteria 4118
231 Ga0495624_0000164 3300046690 Bacteria 48886
232 Ga0495624_0000592 3300046690 Bacteria 28232
233 Ga0495600_0002135 3300046809 Bacteria 11193
234 Ga0495581_0020152 3300047315 Bacteria 3872
235 Ga0495604_0003117 3300047317 Bacteria 13246
236 Ga0495676_0000652 3300047321 Bacteria 28858
237 Ga0495676_0001759 3300047321 Bacteria 18921
238 Ga0495676_0044610 3300047321 Bacteria 3618
239 Ga0495680_0000215 3300047322 Bacteria 63049
240 Ga0495680_0002422 3300047322 Bacteria 19086
241 Ga0495675_0000047 3300047444 Bacteria 82513
242 Ga0495675_0031419 3300047444 Bacteria 3390
243 Ga0495602_0000008 3300048088 Bacteria 260157
244 Ga0495602_0035988 3300048088 Bacteria 4612
245 Ga0495614_0043714 3300048089 Bacteria 1922
246 Ga0496100_0000003 3300048903 Bacteria 360802
247 Ga0496100_0000063 3300048903 Bacteria 60957
248 Ga0496100_0012776 3300048903 Bacteria 4825
249 Ga0496101_0000003 3300048904 Bacteria 406565
250 Ga0496101_0000012 3300048904 Bacteria 268127
251 Ga0496101_0117172 3300048904 Bacteria 2011
252 Ga0496102_0000061 3300048905 Bacteria 167066
253 Ga0496103_0000044 3300048906 Bacteria 167066
254 Ga0496103_0001299 3300048906 Bacteria 17003
255 Ga0496104_0000002 3300048907 Bacteria 686017
256 Ga0496104_0000666 3300048907 Bacteria 29447
257 Ga0496104_0042848 3300048907 Bacteria 4250
258 Ga0496104_0046624 3300048907 Bacteria 4082
259 Ga0496104_0089805 3300048907 Bacteria 2935
260 Ga0496104_0160291 3300048907 Bacteria 2158
261 Ga0496105_0000001 3300048908 Bacteria 1328178
262 Ga0496105_0027286 3300048908 Bacteria 4662
263 Ga0496106_0000015 3300048909 Bacteria 187570
264 Ga0496106_0000020 3300048909 Bacteria 169168
265 Ga0496106_0000160 3300048909 Bacteria 48936
266 Ga0496106_0077891 3300048909 Bacteria 2543
267 Ga0496107_0000008 3300048910 Bacteria 251874
268 Ga0496107_0000014 3300048910 Bacteria 176738
269 Ga0496107_0010497 3300048910 Bacteria 6438
270 Ga0496107_0012183 3300048910 Bacteria 6000
271 Ga0496107_0086142 3300048910 Bacteria 2293
272 Ga0496108_0000025 3300048911 Bacteria 177919
273 Ga0496108_0003574 3300048911 Bacteria 12457
274 Ga0496108_0011967 3300048911 Bacteria 7058
275 Ga0496109_0000025 3300048912 Bacteria 171741
276 Ga0496109_0000046 3300048912 Bacteria 131025
277 Ga0496109_0000852 3300048912 Bacteria 25512
278 Ga0496109_0199577 3300048912 Bacteria 1880
279 Ga0496110_0000004 3300048913 Bacteria 122867
280 Ga0496110_0023543 3300048913 Bacteria 5240
281 Ga0496110_0043422 3300048913 Bacteria 3925
282 Ga0496110_0238133 3300048913 Bacteria 1656
283 Ga0496111_0000007 3300048914 Bacteria 103885
284 Ga0496112_0000003 3300048915 Bacteria 660147
285 Ga0496112_0004814 3300048915 Bacteria 11523
286 Ga0496112_0155395 3300048915 Bacteria 2254
287 Ga0496112_0183592 3300048915 Bacteria 2055
288 Ga0496113_0000019 3300048916 Bacteria 72625
289 Ga0496113_0021805 3300048916 Bacteria 4523
290 Ga0496113_0041732 3300048916 Bacteria 3387
291 Ga0496114_0000010 3300048917 Bacteria 363396
292 Ga0496114_0029526 3300048917 Bacteria 4508
293 Ga0496114_0088959 3300048917 Bacteria 2620
294 Ga0496115_0000004 3300048918 Bacteria 319734
295 Ga0496115_0000082 3300048918 Bacteria 87212
296 Ga0496115_0007671 3300048918 Bacteria 7951
297 Ga0496117_0008745 3300048920 Bacteria 9564
298 Ga0496118_0000151 3300048921 Bacteria 122978
299 Ga0496119_0007231 3300048922 Bacteria 10051
300 Ga0496119_0010891 3300048922 Bacteria 7598
301 Ga0496121_0001675 3300048924 Bacteria 36420
302 Ga0496121_0082008 3300048924 Bacteria 2551
303 Ga0496125_0021984 3300048928 Bacteria 5932
304 Ga0501031_0000089 3300049568 Bacteria 49213
305 Ga0501032_0000662 3300049569 Bacteria 27963
306 Ga0501033_0000176 3300049570 Bacteria 60803
307 Ga0501034_0037709 3300049571 Bacteria 4895
308 Ga0501034_0076171 3300049571 Bacteria 3362
309 Ga0501036_0000070 3300049572 Bacteria 62492
310 Ga0501037_0000223 3300049573 Bacteria 49349
311 Ga0501038_0000217 3300049574 Bacteria 49242
312 Ga0501042_0010111 3300049578 Bacteria 6311
313 Ga0501042_0019867 3300049578 Bacteria 4671
314 Ga0501042_0020498 3300049578 Bacteria 4602
315 Ga0501043_0001388 3300049579 Bacteria 21170
316 Ga0501046_0000152 3300049580 Bacteria 72174
317 Ga0501047_0000063 3300049581 Bacteria 136761
318 Ga0501047_0020678 3300049581 Bacteria 6319
319 Ga0501048_0000084 3300049582 Bacteria 49173
320 Ga0501067_0052708 3300049583 Bacteria 2254
321 Ga0501068_0009979 3300049584 Bacteria 5325
322 Ga0501070_0135871 3300049586 Bacteria 2030
323 Ga0501072_0016476 3300049588 Bacteria 5676
324 Ga0501073_0001355 3300049589 Bacteria 18080
325 Ga0501073_0099656 3300049589 Bacteria 2017
326 Ga0501074_0011739 3300049590 Bacteria 6368
327 Ga0501079_0009531 3300049741 Bacteria 7362
328 Ga0501080_0015334 3300049742 Bacteria 7063
329 Ga0501080_0019445 3300049742 Bacteria 6290
330 Ga0501083_0000394 3300049744 Bacteria 27768
331 Ga0501035_0000194 3300049822 Bacteria 74487
332 Ga0501044_0000331 3300049823 Bacteria 59709
333 nmdc:mga03n38_12689_c1 3300050490 Bacteria 3179
334 nmdc:mga00v17_35318_c2 3300050491 Bacteria 2530
335 nmdc:mga00v17_89406_c1 3300050491 Bacteria 1932
336 nmdc:mga0yw44_10917_c1 3300050492 Bacteria 4658
337 nmdc:mga0yw44_6223_c1 3300050492 Bacteria 5743
338 nmdc:mga0qj67_47587_c1 3300050509 Bacteria 3388
339 nmdc:mga06r32_53342_c1 3300050510 Bacteria 3873
340 nmdc:mga08y16_74129_c1 3300050511 Bacteria 3546
341 nmdc:mga0n895_50043_c1 3300050512 Bacteria 4096
342 nmdc:mga0a205_164936_c1 3300050515 Bacteria 2111
343 nmdc:mga0a205_1_c1 3300050515 Bacteria 62269
344 Ga0495601_0000037 3300053077 Bacteria 81377
345 Ga0495601_0000169 3300053077 Bacteria 35095
346 Ga0495612_0000198 3300053078 Bacteria 25551
347 Ga0495612_0001876 3300053078 Bacteria 8643
348 Ga0495612_0011500 3300053078 Bacteria 3569
349 Ga0495655_0000003 3300053083 Bacteria 303053
350 Ga0495595_0000004 3300053084 Bacteria 260821
351 Ga0495595_0011998 3300053084 Bacteria 3634
352 Ga0495619_0000015 3300053085 Bacteria 252787
353 Ga0495619_0000038 3300053085 Bacteria 121365
354 Ga0495619_0000224 3300053085 Bacteria 41037
355 Ga0495619_0000925 3300053085 Bacteria 19307
356 Ga0500566_0004062 3300053094 Bacteria 8720
357 Ga0500595_009266 3300053119 Bacteria 3980
358 Ga0500614_000804 3300053123 Bacteria 7968
359 Ga0500628_000002 3300053129 Bacteria 357687
360 Ga0501084_0106993 3300054114 Bacteria 2350
361 Ga0501082_0006361 3300060353 Bacteria 10248
362 Ga0496121_0070900
363 JGI24740J21852_10002646
364 JGI24748J21848_1000282
365 Ga0070658_10018877
366 Ga0070683_100006314
367 Ga0070683_100029573
368 Ga0070677_10000034
369 Ga0070682_100000029
370 Ga0070682_100000367
371 Ga0068868_100006839
372 Ga0068868_100010446
373 Ga0068868_100048934
374 Ga0070691_10000069
375 Ga0070661_100000045
376 Ga0070668_100067325
377 Ga0070669_100074939
378 Ga0070675_100000187
379 Ga0070674_100000011
380 Ga0070674_100000014
381 Ga0070688_100001078
382 Ga0070659_100016841
383 Ga0070667_100000374
384 Ga0070667_100030723
385 Ga0070714_100043702
386 Ga0070713_100040889
387 Ga0070700_100075276
388 Ga0070662_100000008
389 Ga0070685_10001067
390 Ga0070679_100000651
391 Ga0070684_100032327
392 Ga0068853_100007653
393 Ga0070672_100000003
394 Ga0070686_100043988
395 Ga0070695_100111289
396 Ga0070665_100000270
397 Ga0070665_100000690
398 Ga0070665_100012626
399 Ga0070664_100030686
400 Ga0068854_100000241
401 Ga0068856_100006108
402 Ga0068866_10000002
403 Ga0068866_10000219
404 Ga0068851_10000342
405 Ga0068851_10015508
406 Ga0068858_100000086
407 Ga0068858_100000155
408 Ga0068860_100065894
409 Ga0068862_100000278
410 Ga0081455_10008014
411 Ga0081455_10009608
412 Ga0081455_10019444
413 Ga0081455_10074752
414 Ga0081540_1000174
415 Ga0081539_10015072
416 Ga0070717_10005075
417 Ga0075365_10000796
418 Ga0075365_10002193
419 Ga0075363_100008170
420 Ga0070715_10000015
421 Ga0070712_100002378
422 Ga0070712_100051817
423 Ga0075428_100106599
424 Ga0075430_100029047
425 Ga0075431_100059905
426 Ga0075433_10001385
427 Ga0068865_100000033
428 Ga0111539_10082079
429 Ga0111539_10180164
430 Ga0105245_10000425
431 Ga0105245_10000585
432 Ga0105245_10004158
433 Ga0105245_10005090
434 Ga0105245_10031235
435 Ga0105247_10001139
436 Ga0105247_10067570
437 Ga0114129_10014838
438 Ga0114129_10087004
439 Ga0105243_10001250
440 Ga0105242_10003005
441 Ga0105242_10081552
442 Ga0105248_10000022
443 Ga0105238_10000299
444 Ga0105249_10000085
445 Ga0105249_10000588
446 Ga0105239_10015091
447 Ga0105239_10247455
448 Ga0157371_10027310
449 Ga0157369_10000173
450 Ga0157372_10061189
451 Ga0157375_10000184
452 Ga0157375_10035850
453 Ga0163163_10119615
454 Ga0157380_10000017
455 Ga0157380_10000072
456 Ga0157376_10085028
457 Ga0163161_10000173
458 Ga0213876_10007818
459 Ga0209051_1001401
460 Ga0207656_10000068
461 Ga0207656_10006654
462 Ga0207682_10000457
463 Ga0207642_10000001
464 Ga0207642_10000003
465 Ga0207642_10000049
466 Ga0207642_10023483
467 Ga0207710_10000151
468 Ga0207680_10007357
469 Ga0207680_10059511
470 Ga0207685_10000001
471 Ga0207705_10015631
472 Ga0207693_10001174
473 Ga0207693_10004622
474 Ga0207663_10002675
475 Ga0207660_10009069
476 Ga0207649_10000021
477 Ga0207652_10000150
478 Ga0207681_10036210
479 Ga0207694_10000035
480 Ga0207659_10000074
481 Ga0207687_10000021
482 Ga0207687_10000042
483 Ga0207687_10000716
484 Ga0207687_10050590
485 Ga0207700_10000013
486 Ga0207700_10015047
487 Ga0207664_10003085
488 Ga0207690_10041655
489 Ga0207706_10000016
490 Ga0207686_10002936
491 Ga0207669_10000007
492 Ga0207669_10000027
493 Ga0207704_10000029
494 Ga0207691_10000005
495 Ga0207711_10000019
496 Ga0207661_10000145
497 Ga0207661_10007439
498 Ga0207679_10026066
499 Ga0207712_10000033
500 Ga0207668_10029850
501 Ga0207640_10000026
502 Ga0207658_10001722
503 Ga0207658_10004945
504 Ga0207658_10043668
505 Ga0207677_10000430
506 Ga0207677_10001018
507 Ga0207703_10000072
508 Ga0207639_10005361
509 Ga0207678_10001068
510 Ga0207708_10064569
511 Ga0207702_10001072
512 Ga0207641_10000231
513 Ga0207641_10024111
514 Ga0268266_10000076
515 Ga0268266_10000182
516 Ga0268266_10000825
517 Ga0268265_10002932
518 Ga0265319_1000029
519 Ga0265338_10000179
520 Ga0265327_10031908
521 Ga0307412_10068791
522 Ga0307416_100032438
523 Ga0307416_100096385
524 Ga0307415_100011807
525 Ga0316574_0002823
526 Ga0373937_0004062
527 Ga0395900_0019159
528 Ga0395900_0048861
529 Ga0395900_0071054
530 Ga0395900_0210804
531 Ga0395898_0003610
532 Ga0395898_0015594
533 Ga0395905_0009334
534 Ga0395905_0085603
535 Ga0395901_0008833
536 Ga0395901_0018235
537 Ga0395901_0025805
538 Ga0395901_0157421
539 Ga0436365_0862230
540 Ga0466966_0102036
541 Ga0466957_0002455
542 Ga0466959_0031241
543 Ga0466958_0026712
544 Ga0466967_0000007
545 Ga0466967_0128688
546 Ga0495603_0000045
547 Ga0495603_0000622
548 Ga0495629_0000823
549 Ga0495638_0001471
550 Ga0495638_0040274
551 Ga0495641_0000001
552 Ga0495641_0008957
553 Ga0495641_0036245
554 Ga0495594_0000005
555 Ga0495606_0000131
556 Ga0495608_0000021
557 Ga0495608_0123242
558 Ga0495618_0000004
559 Ga0495628_0055213
560 Ga0495628_0103419
561 Ga0495628_0150928
562 Ga0495630_0000007
563 Ga0495630_0000168
564 Ga0495630_0078470
565 Ga0495644_0000454
566 Ga0495652_0000022
567 Ga0495652_0049423
568 Ga0495586_0001141
569 Ga0495587_0002697
570 Ga0495587_0048529
571 Ga0495645_0000145
572 Ga0495645_0003853
573 Ga0495645_0021244
574 Ga0495622_0000026
575 Ga0495667_0000044
576 Ga0495667_0084332
577 Ga0495656_0001237
578 Ga0495634_0000013
579 Ga0495634_0001787
580 Ga0495634_0006825
581 Ga0495625_0000204
582 Ga0495635_0004856
583 Ga0495588_0000262
584 Ga0495657_0000019
585 Ga0495647_0000003
586 Ga0495647_0044585
587 Ga0495658_0010401
588 Ga0495669_0041737
589 Ga0495613_0000260
590 Ga0495613_0000369
591 Ga0495613_0028959
592 Ga0495624_0000164
593 Ga0495624_0000592
594 Ga0495600_0002135
595 Ga0495581_0020152
596 Ga0495604_0003117
597 Ga0495676_0000652
598 Ga0495676_0001759
599 Ga0495676_0044610
600 Ga0495680_0000215
601 Ga0495680_0002422
602 Ga0495675_0000047
603 Ga0495675_0031419
604 Ga0495602_0000008
605 Ga0495602_0035988
606 Ga0495614_0043714
607 Ga0496100_0000003
608 Ga0496100_0000063
609 Ga0496100_0012776
610 Ga0496101_0000003
611 Ga0496101_0000012
612 Ga0496101_0117172
613 Ga0496102_0000061
614 Ga0496103_0000044
615 Ga0496103_0001299
616 Ga0496104_0000002
617 Ga0496104_0000666
618 Ga0496104_0042848
619 Ga0496104_0046624
620 Ga0496104_0089805
621 Ga0496104_0160291
622 Ga0496105_0000001
623 Ga0496105_0027286
624 Ga0496106_0000015
625 Ga0496106_0000020
626 Ga0496106_0000160
627 Ga0496106_0077891
628 Ga0496107_0000008
629 Ga0496107_0000014
630 Ga0496107_0010497
631 Ga0496107_0012183
632 Ga0496107_0086142
633 Ga0496108_0000025
634 Ga0496108_0003574
635 Ga0496108_0011967
636 Ga0496109_0000025
637 Ga0496109_0000046
638 Ga0496109_0000852
639 Ga0496109_0199577
640 Ga0496110_0000004
641 Ga0496110_0023543
642 Ga0496110_0043422
643 Ga0496110_0238133
644 Ga0496111_0000007
645 Ga0496112_0000003
646 Ga0496112_0004814
647 Ga0496112_0155395
648 Ga0496112_0183592
649 Ga0496113_0000019
650 Ga0496113_0021805
651 Ga0496113_0041732
652 Ga0496114_0000010
653 Ga0496114_0029526
654 Ga0496114_0088959
655 Ga0496115_0000004
656 Ga0496115_0000082
657 Ga0496115_0007671
658 Ga0496117_0008745
659 Ga0496118_0000151
660 Ga0496119_0007231
661 Ga0496119_0010891
662 Ga0496121_0001675
663 Ga0496121_0082008
664 Ga0496125_0021984
665 Ga0501031_0000089
666 Ga0501032_0000662
667 Ga0501033_0000176
668 Ga0501034_0037709
669 Ga0501034_0076171
670 Ga0501036_0000070
671 Ga0501037_0000223
672 Ga0501038_0000217
673 Ga0501042_0010111
674 Ga0501042_0019867
675 Ga0501042_0020498
676 Ga0501043_0001388
677 Ga0501046_0000152
678 Ga0501047_0000063
679 Ga0501047_0020678
680 Ga0501048_0000084
681 Ga0501067_0052708
682 Ga0501068_0009979
683 Ga0501070_0135871
684 Ga0501072_0016476
685 Ga0501073_0001355
686 Ga0501073_0099656
687 Ga0501074_0011739
688 Ga0501079_0009531
689 Ga0501080_0015334
690 Ga0501080_0019445
691 Ga0501083_0000394
692 Ga0501035_0000194
693 Ga0501044_0000331
694 nmdc:mga03n38_12689_c1
695 nmdc:mga00v17_35318_c2
696 nmdc:mga00v17_89406_c1
697 nmdc:mga0yw44_10917_c1
698 nmdc:mga0yw44_6223_c1
699 nmdc:mga0qj67_47587_c1
700 nmdc:mga06r32_53342_c1
701 nmdc:mga08y16_74129_c1
702 nmdc:mga0n895_50043_c1
703 nmdc:mga0a205_164936_c1
704 nmdc:mga0a205_1_c1
705 Ga0495601_0000037
706 Ga0495601_0000169
707 Ga0495612_0000198
708 Ga0495612_0001876
709 Ga0495612_0011500
710 Ga0495655_0000003
711 Ga0495595_0000004
712 Ga0495595_0011998
713 Ga0495619_0000015
714 Ga0495619_0000038
715 Ga0495619_0000224
716 Ga0495619_0000925
717 Ga0500566_0004062
718 Ga0500595_009266
719 Ga0500614_000804
720 Ga0500628_000002
721 Ga0501084_0106993
722 Ga0501082_0006361

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02776

TPP_enzyme_N

Thiamine pyrophosphate enzyme, N-terminal TPP binding domain

57

173

0.93

PF00205

TPP_enzyme_M

Thiamine pyrophosphate enzyme, central domain

246

383

0.92

PF02775

TPP_enzyme_C

Thiamine pyrophosphate enzyme, C-terminal TPP binding domain

435

578

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6qsi-assembly1.cif.gz_A pseudomonas fluorescens pf-5 thiamine diphosphate-dependent 4-hydroxybenzoylformate decarboxylase 0.937 2 525
4jub-assembly1.cif.gz_C crystal structure of the his70thr mutant of benzoylformate decarboxylase from pseudomonas putida 0.9346 2 526
4mq5-assembly1.cif.gz_A crystal structure of benzoylformate decarboxylase mutant a306f 0.9339 2 526
2v3w-assembly1.cif.gz_A crystal structure of the benzoylformate decarboxylase variant l461a from pseudomonas putida 0.9338 2 527
4k9k-assembly1.cif.gz_A crystal structure of the his281tyr mutant of benzoylformate decarboxylase from pseudomonas putida 0.9337 2 526
ID Description Score Start End Superfamily
4k9lA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.952 187 344 3.40.50.1220
4q9dB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9412 181 344 3.40.50.1220
4q9dB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9357 181 344 3.40.50.1220
4k9qB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9303 181 341 3.40.50.1220
4k9qB03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9252 345 532 3.40.50.970
ID Description Score Start End GO Terms
AF-A0A7W0XKF6-F1-model_v4 Benzoylformate decarboxylase 0.9483 207 530 GO:0000287
GO:0003984
GO:0019752
GO:0030976
GO:0050660
AF-A0A1E7IBG6-F1-model_v4 Benzoylformate decarboxylase 0.947 178 526 GO:0000287
GO:0003984
GO:0030976
GO:0050660
AF-A0A3C0FEI9-F1-model_v4 Thiamine pyrophosphate enzyme TPP-binding domain-containing protein 0.9422 403 526 GO:0000287
GO:0003984
GO:0005948
GO:0009097
GO:0009099
GO:0030976
GO:0050660
AF-A0A533J589-F1-model_v4 deleted 0.9395 119 532
AF-A0A7Z9NRT6-F1-model_v4 Acetolactate synthase large subunit 0.9386 405 525 GO:0000287
GO:0003984
GO:0005948
GO:0009097
GO:0009099
GO:0030976
GO:0050660

Map