F422646

General Info

Members Datasets Scaffolds Average Seq Length
362 192 724 77

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10750344|Ga0265338_107503441
Length 72
Sequence MNTILFYTQITVSIALIALIALQQRGTALGSGFGGGGEVYSTKRGAQKKIYYATVALATVFLVLGVLSILLP

Samples

Sample ID Description Type Environment
1 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
61 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
100 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
103 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
104 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
105 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
106 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
107 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
108 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
109 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
110 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
111 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
112 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
113 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
114 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
115 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
116 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
117 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
118 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
123 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
124 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
125 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
126 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
127 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
128 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
129 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
130 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
131 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
132 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
133 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
134 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
135 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
136 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
137 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
138 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
139 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
140 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
141 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
142 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
143 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
144 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
145 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
146 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
147 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
148 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
149 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
150 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
151 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
152 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
153 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
158 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
164 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
165 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
166 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
167 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
168 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
169 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
170 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
171 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
172 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
173 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
174 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
175 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
176 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
177 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
178 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
179 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
180 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
181 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
182 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
183 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
184 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
185 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
186 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
187 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
188 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
189 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
190 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
191 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
192 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.31
Nodule 0
Rhizoplane 1.1
Rhizosphere 71.55
Stem 0
Stem Tuber 0
Unclassified 18.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265338_10750344 3300028800 Unclassified 671
2 MBSR1b_contig_11665901 2162886012 Bacteria 4654
3 JGI24741J21665_1016996 3300001915 Bacteria 1180
4 JGI24746J21847_1058675 3300001977 Unclassified 549
5 JGI24740J21852_10006976 3300001979 Bacteria 4633
6 JGI24740J21852_10012810 3300001979 Unclassified 3151
7 JGI24740J21852_10019268 3300001979 Unclassified 2407
8 JGI24739J22299_10003423 3300001989 Bacteria 6052
9 JGI24739J22299_10164144 3300001989 Bacteria 655
10 JGI24737J22298_10000544 3300001990 Bacteria 13236
11 JGI24743J22301_10018922 3300001991 Unclassified 1305
12 JGI24735J21928_10000064 3300002067 Bacteria 43570
13 JGI24738J21930_10010600 3300002075 Bacteria 2047
14 JGI24738J21930_10024081 3300002075 Bacteria 1253
15 JGI24033J26618_1078421 3300002155 Unclassified 504
16 rootH1_10004333 3300003316 Bacteria 78263
17 rootH2_10000763 3300003320 Bacteria 99150
18 rootL2_10070140 3300003322 Bacteria 7953
19 rootH1_10057568 3300003323 Bacteria 35750
20 rootH1_10219268 3300003323 Bacteria 1723
21 rootH1_10257271 3300003323 Bacteria 1453
22 JGI25405J52794_10007324 3300003911 Bacteria 2034
23 Ga0065715_10000332 3300005293 Bacteria 14723
24 Ga0070658_10000024 3300005327 Bacteria 175873
25 Ga0070676_10815632 3300005328 Unclassified 689
26 Ga0070683_100002969 3300005329 Bacteria 13602
27 Ga0070683_100733255 3300005329 Bacteria 947
28 Ga0070670_100791102 3300005331 Unclassified 856
29 Ga0070660_100000668 3300005339 Bacteria 22691
30 Ga0070660_100135689 3300005339 Bacteria 1971
31 Ga0070661_100092360 3300005344 Bacteria 2242
32 Ga0070675_100119719 3300005354 Bacteria 2236
33 Ga0070659_100012655 3300005366 Bacteria 6259
34 Ga0070659_100106567 3300005366 Bacteria 2259
35 Ga0070708_100045545 3300005445 Bacteria 3865
36 Ga0070662_100007067 3300005457 Bacteria 7264
37 Ga0070685_10311960 3300005466 Unclassified 1063
38 Ga0070679_100318266 3300005530 Bacteria 1505
39 Ga0070684_100213808 3300005535 Bacteria 1758
40 Ga0070684_100459168 3300005535 Unclassified 1178
41 Ga0070672_101868230 3300005543 Unclassified 540
42 Ga0070704_101163498 3300005549 Unclassified 702
43 Ga0068855_100000002 3300005563 Bacteria 616881
44 Ga0068855_100000005 3300005563 Bacteria 337711
45 Ga0070664_100000060 3300005564 Bacteria 67487
46 Ga0070664_100146953 3300005564 Bacteria 2079
47 Ga0070664_100854154 3300005564 Bacteria 852
48 Ga0068857_100000228 3300005577 Bacteria 37447
49 Ga0068857_100000533 3300005577 Bacteria 27507
50 Ga0068857_100002914 3300005577 Bacteria 14100
51 Ga0068857_100116852 3300005577 Unclassified 2400
52 Ga0068854_100071497 3300005578 Bacteria 2538
53 Ga0068856_100000027 3300005614 Bacteria 133290
54 Ga0068856_100000029 3300005614 Bacteria 130205
55 Ga0068852_100000001 3300005616 Bacteria 716526
56 Ga0068852_100000108 3300005616 Bacteria 55450
57 Ga0068852_100146035 3300005616 Bacteria 2194
58 Ga0068852_101552319 3300005616 Bacteria 684
59 Ga0068860_100154897 3300005843 Bacteria 2208
60 Ga0081455_10000001 3300005937 Bacteria 603871
61 Ga0075365_10000136 3300006038 Bacteria 22872
62 Ga0075365_10007432 3300006038 Bacteria 6134
63 Ga0075365_10012256 3300006038 Bacteria 5082
64 Ga0075365_10030445 3300006038 Bacteria 3457
65 Ga0075365_10040572 3300006038 Bacteria 3036
66 Ga0075365_10252548 3300006038 Bacteria 1239
67 Ga0075368_10003067 3300006042 Bacteria 5532
68 Ga0075368_10045097 3300006042 Bacteria 1741
69 Ga0075363_100004130 3300006048 Bacteria 6304
70 Ga0075364_10000490 3300006051 Bacteria 20091
71 Ga0075364_10004451 3300006051 Bacteria 8062
72 Ga0075364_10324783 3300006051 Unclassified 1048
73 Ga0075362_10017756 3300006177 Bacteria 2935
74 Ga0075362_10037149 3300006177 Bacteria 2134
75 Ga0075367_10010354 3300006178 Bacteria 4897
76 Ga0075367_10083331 3300006178 Bacteria 1937
77 Ga0075369_10001180 3300006186 Bacteria 8838
78 Ga0075369_10007297 3300006186 Bacteria 4204
79 Ga0075366_10004453 3300006195 Bacteria 7521
80 Ga0075366_10006983 3300006195 Bacteria 6216
81 Ga0097621_100000001 3300006237 Bacteria 632268
82 Ga0097621_100034958 3300006237 Unclassified 4012
83 Ga0075370_10031821 3300006353 Unclassified 2946
84 Ga0075370_10049664 3300006353 Unclassified 2378
85 Ga0075370_10408903 3300006353 Unclassified 814
86 Ga0075370_10499553 3300006353 Bacteria 734
87 Ga0068871_100000002 3300006358 Bacteria 152322
88 Ga0075428_100010097 3300006844 Bacteria 10488
89 Ga0068865_100002555 3300006881 Bacteria 10795
90 Ga0068865_101105484 3300006881 Unclassified 698
91 Ga0105240_10000004 3300009093 Bacteria 708156
92 Ga0105240_10000050 3300009093 Bacteria 236144
93 Ga0105240_10001680 3300009093 Bacteria 37545
94 Ga0105240_10004431 3300009093 Bacteria 21407
95 Ga0105245_10061196 3300009098 Bacteria 3393
96 Ga0105247_11542512 3300009101 Unclassified 543
97 Ga0105241_10074822 3300009174 Bacteria 2638
98 Ga0105241_10123186 3300009174 Bacteria 2091
99 Ga0105241_10690000 3300009174 Bacteria 931
100 Ga0105241_11995574 3300009174 Unclassified 571
101 Ga0105241_12428753 3300009174 Unclassified 524
102 Ga0105237_10000001 3300009545 Bacteria 1009213
103 Ga0105237_10000002 3300009545 Bacteria 702357
104 Ga0105237_10083729 3300009545 Unclassified 3180
105 Ga0105238_10052245 3300009551 Unclassified 4108
106 Ga0105238_10059303 3300009551 Bacteria 3834
107 Ga0105238_10384346 3300009551 Unclassified 1395
108 Ga0105032_100001 3300009979 Bacteria 472394
109 Ga0105032_100015 3300009979 Bacteria 54103
110 Ga0105032_101013 3300009979 Bacteria 2617
111 Ga0105032_118586 3300009979 Unclassified 544
112 Ga0105028_100211 3300009993 Bacteria 6354
113 Ga0105028_100866 3300009993 Bacteria 3218
114 Ga0105239_10000301 3300010375 Bacteria 73122
115 Ga0105239_10007702 3300010375 Bacteria 12330
116 Ga0105239_10019597 3300010375 Bacteria 7465
117 Ga0105246_10000820 3300011119 Bacteria 17684
118 Ga0105246_10002176 3300011119 Bacteria 11822
119 Ga0105246_10004048 3300011119 Bacteria 8907
120 Ga0157317_1018356 3300012475 Bacteria 604
121 Ga0157373_10018348 3300013100 Bacteria 5096
122 Ga0157373_10020170 3300013100 Unclassified 4848
123 Ga0157373_10024866 3300013100 Bacteria 4336
124 Ga0157371_10012282 3300013102 Bacteria 6553
125 Ga0157371_10089559 3300013102 Bacteria 2179
126 Ga0157371_10233382 3300013102 Bacteria 1322
127 Ga0157371_10765136 3300013102 Bacteria 726
128 Ga0157370_10000168 3300013104 Bacteria 80700
129 Ga0157370_10000220 3300013104 Bacteria 72815
130 Ga0157370_10003836 3300013104 Bacteria 17529
131 Ga0157370_10107483 3300013104 Unclassified 2609
132 Ga0157370_10266880 3300013104 Bacteria 1581
133 Ga0157369_10000003 3300013105 Bacteria 507337
134 Ga0157369_10000075 3300013105 Bacteria 136520
135 Ga0157369_10000190 3300013105 Bacteria 85077
136 Ga0157369_10004021 3300013105 Bacteria 17435
137 Ga0157369_10012190 3300013105 Bacteria 9759
138 Ga0157369_10022076 3300013105 Bacteria 7112
139 Ga0157369_11687636 3300013105 Unclassified 644
140 Ga0157374_10003201 3300013296 Bacteria 13754
141 Ga0157374_10461444 3300013296 Bacteria 1272
142 Ga0157374_10476085 3300013296 Bacteria 1252
143 Ga0157372_10000002 3300013307 Bacteria 687862
144 Ga0157372_10000160 3300013307 Bacteria 73603
145 Ga0157372_10775388 3300013307 Bacteria 1115
146 Ga0157372_11895671 3300013307 Unclassified 685
147 Ga0157375_10615909 3300013308 Bacteria 1244
148 Ga0157377_10000386 3300014745 Bacteria 19230
149 Ga0157376_10000083 3300014969 Bacteria 71608
150 Ga0207688_10503843 3300025901 Unclassified 758
151 Ga0207647_10000338 3300025904 Bacteria 38215
152 Ga0207647_10811601 3300025904 Unclassified 502
153 Ga0207645_10739224 3300025907 Unclassified 669
154 Ga0207705_10000047 3300025909 Bacteria 175887
155 Ga0207654_10029597 3300025911 Bacteria 3000
156 Ga0207654_10033513 3300025911 Bacteria 2847
157 Ga0207654_10410222 3300025911 Bacteria 943
158 Ga0207654_11328418 3300025911 Unclassified 524
159 Ga0207695_10000009 3300025913 Bacteria 1034276
160 Ga0207695_10000158 3300025913 Bacteria 201891
161 Ga0207695_10002701 3300025913 Bacteria 25866
162 Ga0207695_10005824 3300025913 Bacteria 16207
163 Ga0207671_10000003 3300025914 Bacteria 1065461
164 Ga0207671_10000008 3300025914 Bacteria 798229
165 Ga0207671_10411835 3300025914 Bacteria 1075
166 Ga0207657_10000125 3300025919 Bacteria 76937
167 Ga0207657_10011496 3300025919 Bacteria 8789
168 Ga0207649_10568511 3300025920 Unclassified 869
169 Ga0207694_10036289 3300025924 Bacteria 3783
170 Ga0207694_10187345 3300025924 Bacteria 1680
171 Ga0207650_10422018 3300025925 Unclassified 1107
172 Ga0207659_10144600 3300025926 Bacteria 1850
173 Ga0207687_10109548 3300025927 Bacteria 2046
174 Ga0207690_10012572 3300025932 Bacteria 5067
175 Ga0207690_10021271 3300025932 Bacteria 4021
176 Ga0207706_10000090 3300025933 Bacteria 93774
177 Ga0207704_10002258 3300025938 Bacteria 8658
178 Ga0207661_10001040 3300025944 Bacteria 18449
179 Ga0207661_10163638 3300025944 Bacteria 1932
180 Ga0207679_10005154 3300025945 Bacteria 8184
181 Ga0207679_10121946 3300025945 Bacteria 2077
182 Ga0207679_11419472 3300025945 Bacteria 637
183 Ga0207667_10000005 3300025949 Bacteria 715503
184 Ga0207667_10000027 3300025949 Bacteria 337700
185 Ga0207667_10008899 3300025949 Bacteria 11882
186 Ga0207668_12150167 3300025972 Bacteria 502
187 Ga0207640_10016132 3300025981 Bacteria 4338
188 Ga0207678_10779888 3300026067 Unclassified 843
189 Ga0207702_10000015 3300026078 Bacteria 250830
190 Ga0207702_10000034 3300026078 Bacteria 164965
191 Ga0207702_10000057 3300026078 Bacteria 131118
192 Ga0207674_10000439 3300026116 Bacteria 53818
193 Ga0207674_10009026 3300026116 Bacteria 11453
194 Ga0207674_10011456 3300026116 Bacteria 9964
195 Ga0207674_10135623 3300026116 Unclassified 2423
196 Ga0207698_10000001 3300026142 Bacteria 625389
197 Ga0207698_10000048 3300026142 Bacteria 90201
198 Ga0207698_11436752 3300026142 Bacteria 705
199 Ga0209813_10044902 3300027866 Unclassified 1359
200 Ga0209813_10053589 3300027866 Bacteria 1268
201 Ga0209974_10311020 3300027876 Bacteria 605
202 Ga0268264_10125487 3300028381 Bacteria 2268
203 Ga0316177_1024066 3300030731 Bacteria 737
204 Ga0316176_1101171 3300030732 Bacteria 1703
205 Ga0316176_1170597 3300030732 Bacteria 897
206 Ga0314311_1010899 3300030733 Bacteria 840
207 Ga0314311_1132456 3300030733 Bacteria 1197
208 Ga0314311_1216955 3300030733 Bacteria 500
209 Ga0316179_1046099 3300030734 Bacteria 16583
210 Ga0316179_1050430 3300030734 Bacteria 631
211 Ga0316178_1159180 3300030735 Bacteria 1526
212 Ga0316180_1052434 3300030736 Bacteria 3544
213 Ga0316180_1132908 3300030736 Bacteria 778
214 Ga0316183_1004646 3300030742 Bacteria 12131
215 Ga0316183_1012734 3300030742 Bacteria 1452
216 Ga0316183_1033452 3300030742 Bacteria 939
217 Ga0316183_1069536 3300030742 Bacteria 4475
218 Ga0316183_1154109 3300030742 Bacteria 763
219 Ga0316183_1189043 3300030742 Bacteria 1698
220 Ga0316181_1194858 3300030744 Bacteria 547
221 Ga0316181_1237308 3300030744 Bacteria 996
222 Ga0316182_1058508 3300030745 Bacteria 14754
223 Ga0316182_1083110 3300030745 Bacteria 723
224 Ga0316182_1088257 3300030745 Bacteria 7604
225 Ga0316182_1244816 3300030745 Bacteria 31106
226 Ga0316182_1257460 3300030745 Bacteria 4203
227 Ga0316182_1296081 3300030745 Bacteria 6405
228 Ga0316182_1400159 3300030745 Bacteria 2597
229 Ga0307516_10037612 3300031730 Bacteria 4836
230 Ga0307405_10146186 3300031731 Bacteria 1656
231 Ga0307413_10951943 3300031824 Unclassified 733
232 Ga0307413_11748864 3300031824 Bacteria 555
233 Ga0307406_10000001 3300031901 Bacteria 638191
234 Ga0307406_10000649 3300031901 Bacteria 19756
235 Ga0307412_10013764 3300031911 Bacteria 4752
236 Ga0307414_12039249 3300032004 Unclassified 536
237 Ga0395899_0020776 3300037312 Bacteria 4979
238 Ga0395899_0036885 3300037312 Unclassified 3666
239 Ga0395900_0000001 3300037418 Bacteria 931146
240 Ga0395898_0000002 3300037466 Bacteria 931013
241 Ga0395905_0356262 3300037471 Bacteria 1356
242 Ga0395901_0000006 3300038443 Bacteria 514112
243 Ga0439436_0053098 3300041404 Bacteria 1142
244 Ga0439438_009638 3300041405 Bacteria 3113
245 Ga0439447_039395 3300041407 Bacteria 1157
246 Ga0439461_0001995 3300041410 Bacteria 3228
247 Ga0439461_0004581 3300041410 Bacteria 2316
248 Ga0439466_0045005 3300041411 Bacteria 1460
249 Ga0439465_0215151 3300041413 Bacteria 703
250 Ga0451833_1358405 3300041491 Bacteria 739
251 Ga0451837_0391449 3300041494 Bacteria 567
252 Ga0451841_1164690 3300041498 Unclassified 731
253 Ga0439442_064085 3300042002 Unclassified 780
254 Ga0439442_091573 3300042002 Bacteria 654
255 Ga0439445_0002562 3300042004 Bacteria 4046
256 Ga0439432_019930 3300042006 Bacteria 2231
257 Ga0439432_032262 3300042006 Bacteria 1690
258 Ga0439463_016849 3300042016 Unclassified 1808
259 Ga0439463_048356 3300042016 Bacteria 1084
260 Ga0450919_008119 3300042121 Unclassified 1220
261 Ga0450920_000612 3300042122 Bacteria 5690
262 Ga0450906_001220 3300042145 Bacteria 5677
263 Ga0439446_0000003 3300042156 Bacteria 158513
264 Ga0439446_0007890 3300042156 Bacteria 2811
265 Ga0439446_0044912 3300042156 Bacteria 1308
266 Ga0450909_003301 3300042185 Bacteria 2296
267 Ga0439434_0000762 3300042435 Bacteria 9239
268 Ga0439434_0070285 3300042435 Unclassified 1101
269 Ga0439434_0102832 3300042435 Unclassified 921
270 Ga0439464_0000154 3300042439 Bacteria 11289
271 Ga0439464_0170800 3300042439 Unclassified 686
272 Ga0450918_000179 3300042531 Bacteria 14151
273 Ga0450918_013224 3300042531 Bacteria 1436
274 Ga0466972_0013340 3300044658 Bacteria 4126
275 Ga0453684_0084966 3300044712 Bacteria 3934
276 Ga0466960_1054417 3300044901 Unclassified 501
277 Ga0451576_0007988 3300045051 Bacteria 12514
278 Ga0451576_0135099 3300045051 Bacteria 2572
279 Ga0451576_0409463 3300045051 Bacteria 1422
280 Ga0451576_0634715 3300045051 Bacteria 1122
281 Ga0495590_0049729 3300046457 Bacteria 1463
282 Ga0495638_0000132 3300046460 Bacteria 120039
283 Ga0495638_0001142 3300046460 Bacteria 25656
284 Ga0495671_0062965 3300046692 Bacteria 1827
285 Ga0495660_0000005 3300046810 Bacteria 574567
286 Ga0495660_0061837 3300046810 Bacteria 2008
287 Ga0495672_0258237 3300047320 Bacteria 842
288 Ga0495615_0286671 3300048090 Unclassified 530
289 Ga0496109_1147745 3300048912 Unclassified 714
290 Ga0496110_0296605 3300048913 Bacteria 1473
291 Ga0496113_0040885 3300048916 Bacteria 3419
292 Ga0496115_0000001 3300048918 Bacteria 367230
293 Ga0496125_0135689 3300048928 Unclassified 1722
294 Ga0501032_0389830 3300049569 Bacteria 895
295 Ga0501034_0000028 3300049571 Bacteria 255803
296 Ga0501034_0006531 3300049571 Bacteria 12535
297 Ga0501037_0000001 3300049573 Bacteria 753276
298 Ga0501038_0038766 3300049574 Unclassified 4171
299 Ga0501043_0908702 3300049579 Bacteria 631
300 Ga0501070_1437241 3300049586 Unclassified 523
301 nmdc:mga03683_4844_c1 3300050489 Bacteria 3079
302 nmdc:mga03683_6088_c1 3300050489 Unclassified 4113
303 nmdc:mga03n38_51223_c1 3300050490 Unclassified 1843
304 nmdc:mga00v17_267_c1 3300050491 Bacteria 30663
305 nmdc:mga00v17_397_c1 3300050491 Bacteria 24523
306 nmdc:mga0yw44_15066_c1 3300050492 Bacteria 4128
307 nmdc:mga0yw44_1_c1 3300050492 Bacteria 702221
308 nmdc:mga0yw44_430345_c1 3300050492 Bacteria 894
309 nmdc:mga0yw44_4_c1 3300050492 Bacteria 450247
310 nmdc:mga0yw44_610923_c1 3300050492 Unclassified 741
311 nmdc:mga0yw44_68_c1 3300050492 Bacteria 37827
312 nmdc:mga0yw44_73_c1 3300050492 Bacteria 36385
313 nmdc:mga0k408_33754_c1 3300050493 Unclassified 1224
314 nmdc:mga0k408_376132_c1 3300050493 Bacteria 846
315 nmdc:mga0k408_994_c1 3300050493 Bacteria 15601
316 nmdc:mga06z11_63174_c1 3300050494 Bacteria 1937
317 nmdc:mga06z11_769_c1 3300050494 Bacteria 11696
318 nmdc:mga04h51_1412_c1 3300050495 Bacteria 5551
319 nmdc:mga04h51_33581_c1 3300050495 Bacteria 1634
320 nmdc:mga07m45_16882_c1 3300050496 Bacteria 3913
321 nmdc:mga07m45_201814_c1 3300050496 Bacteria 806
322 nmdc:mga07m45_205878_c1 3300050496 Bacteria 1144
323 nmdc:mga07m45_249_c3 3300050496 Bacteria 11602
324 nmdc:mga07m45_48645_c1 3300050496 Unclassified 2385
325 nmdc:mga07m45_5064_c1 3300050496 Bacteria 6516
326 nmdc:mga07m45_61248_c2 3300050496 Bacteria 1509
327 nmdc:mga0sz30_73518_c1 3300050516 Unclassified 1474
328 nmdc:mga0sz30_8336_c1 3300050516 Bacteria 3910
329 Ga0500643_000367 3300053087 Bacteria 35713
330 Ga0500643_004043 3300053087 Bacteria 6769
331 Ga0500643_009204 3300053087 Bacteria 3794
332 Ga0500644_0009922 3300053088 Unclassified 2562
333 Ga0500644_0157249 3300053088 Bacteria 916
334 Ga0500646_0000007 3300053090 Bacteria 115744
335 Ga0500646_0019866 3300053090 Bacteria 1780
336 Ga0500583_0020476 3300053092 Unclassified 2732
337 Ga0500651_0000001 3300053093 Bacteria 529808
338 Ga0500651_0000257 3300053093 Bacteria 31829
339 Ga0500641_0000001 3300053096 Bacteria 1115973
340 Ga0500650_0064833 3300053098 Unclassified 1707
341 Ga0500650_0094945 3300053098 Bacteria 1396
342 Ga0500650_0310039 3300053098 Bacteria 697
343 Ga0500554_031563 3300053102 Bacteria 1566
344 Ga0500555_000009 3300053103 Bacteria 263998
345 Ga0500562_000001 3300053108 Bacteria 1178987
346 Ga0500569_000037 3300053109 Bacteria 25656
347 Ga0500594_0000018 3300053118 Bacteria 61549
348 Ga0500595_175346 3300053119 Unclassified 595
349 Ga0500652_000001 3300053131 Bacteria 946868
350 Ga0500655_003534 3300053133 Bacteria 2822
351 Ga0500577_0000148 3300053142 Bacteria 17230
352 Ga0500577_0128069 3300053142 Bacteria 1062
353 Ga0500577_0281648 3300053142 Bacteria 724
354 Ga0500588_0000054 3300053146 Bacteria 19939
355 Ga0500604_0015844 3300053151 Bacteria 2069
356 Ga0500604_0029805 3300053151 Bacteria 1593
357 Ga0500616_0000012 3300053153 Bacteria 681798
358 Ga0500616_0006934 3300053153 Bacteria 7304
359 Ga0500616_0050046 3300053153 Bacteria 2208
360 Ga0500570_004016 3300053724 Bacteria 7682
361 Ga0500570_144852 3300053724 Unclassified 862
362 Ga0500570_172925 3300053724 Unclassified 715
363 Ga0265338_10750344
364 MBSR1b_contig_11665901
365 JGI24741J21665_1016996
366 JGI24746J21847_1058675
367 JGI24740J21852_10006976
368 JGI24740J21852_10012810
369 JGI24740J21852_10019268
370 JGI24739J22299_10003423
371 JGI24739J22299_10164144
372 JGI24737J22298_10000544
373 JGI24743J22301_10018922
374 JGI24735J21928_10000064
375 JGI24738J21930_10010600
376 JGI24738J21930_10024081
377 JGI24033J26618_1078421
378 rootH1_10004333
379 rootH2_10000763
380 rootL2_10070140
381 rootH1_10057568
382 rootH1_10219268
383 rootH1_10257271
384 JGI25405J52794_10007324
385 Ga0065715_10000332
386 Ga0070658_10000024
387 Ga0070676_10815632
388 Ga0070683_100002969
389 Ga0070683_100733255
390 Ga0070670_100791102
391 Ga0070660_100000668
392 Ga0070660_100135689
393 Ga0070661_100092360
394 Ga0070675_100119719
395 Ga0070659_100012655
396 Ga0070659_100106567
397 Ga0070708_100045545
398 Ga0070662_100007067
399 Ga0070685_10311960
400 Ga0070679_100318266
401 Ga0070684_100213808
402 Ga0070684_100459168
403 Ga0070672_101868230
404 Ga0070704_101163498
405 Ga0068855_100000002
406 Ga0068855_100000005
407 Ga0070664_100000060
408 Ga0070664_100146953
409 Ga0070664_100854154
410 Ga0068857_100000228
411 Ga0068857_100000533
412 Ga0068857_100002914
413 Ga0068857_100116852
414 Ga0068854_100071497
415 Ga0068856_100000027
416 Ga0068856_100000029
417 Ga0068852_100000001
418 Ga0068852_100000108
419 Ga0068852_100146035
420 Ga0068852_101552319
421 Ga0068860_100154897
422 Ga0081455_10000001
423 Ga0075365_10000136
424 Ga0075365_10007432
425 Ga0075365_10012256
426 Ga0075365_10030445
427 Ga0075365_10040572
428 Ga0075365_10252548
429 Ga0075368_10003067
430 Ga0075368_10045097
431 Ga0075363_100004130
432 Ga0075364_10000490
433 Ga0075364_10004451
434 Ga0075364_10324783
435 Ga0075362_10017756
436 Ga0075362_10037149
437 Ga0075367_10010354
438 Ga0075367_10083331
439 Ga0075369_10001180
440 Ga0075369_10007297
441 Ga0075366_10004453
442 Ga0075366_10006983
443 Ga0097621_100000001
444 Ga0097621_100034958
445 Ga0075370_10031821
446 Ga0075370_10049664
447 Ga0075370_10408903
448 Ga0075370_10499553
449 Ga0068871_100000002
450 Ga0075428_100010097
451 Ga0068865_100002555
452 Ga0068865_101105484
453 Ga0105240_10000004
454 Ga0105240_10000050
455 Ga0105240_10001680
456 Ga0105240_10004431
457 Ga0105245_10061196
458 Ga0105247_11542512
459 Ga0105241_10074822
460 Ga0105241_10123186
461 Ga0105241_10690000
462 Ga0105241_11995574
463 Ga0105241_12428753
464 Ga0105237_10000001
465 Ga0105237_10000002
466 Ga0105237_10083729
467 Ga0105238_10052245
468 Ga0105238_10059303
469 Ga0105238_10384346
470 Ga0105032_100001
471 Ga0105032_100015
472 Ga0105032_101013
473 Ga0105032_118586
474 Ga0105028_100211
475 Ga0105028_100866
476 Ga0105239_10000301
477 Ga0105239_10007702
478 Ga0105239_10019597
479 Ga0105246_10000820
480 Ga0105246_10002176
481 Ga0105246_10004048
482 Ga0157317_1018356
483 Ga0157373_10018348
484 Ga0157373_10020170
485 Ga0157373_10024866
486 Ga0157371_10012282
487 Ga0157371_10089559
488 Ga0157371_10233382
489 Ga0157371_10765136
490 Ga0157370_10000168
491 Ga0157370_10000220
492 Ga0157370_10003836
493 Ga0157370_10107483
494 Ga0157370_10266880
495 Ga0157369_10000003
496 Ga0157369_10000075
497 Ga0157369_10000190
498 Ga0157369_10004021
499 Ga0157369_10012190
500 Ga0157369_10022076
501 Ga0157369_11687636
502 Ga0157374_10003201
503 Ga0157374_10461444
504 Ga0157374_10476085
505 Ga0157372_10000002
506 Ga0157372_10000160
507 Ga0157372_10775388
508 Ga0157372_11895671
509 Ga0157375_10615909
510 Ga0157377_10000386
511 Ga0157376_10000083
512 Ga0207688_10503843
513 Ga0207647_10000338
514 Ga0207647_10811601
515 Ga0207645_10739224
516 Ga0207705_10000047
517 Ga0207654_10029597
518 Ga0207654_10033513
519 Ga0207654_10410222
520 Ga0207654_11328418
521 Ga0207695_10000009
522 Ga0207695_10000158
523 Ga0207695_10002701
524 Ga0207695_10005824
525 Ga0207671_10000003
526 Ga0207671_10000008
527 Ga0207671_10411835
528 Ga0207657_10000125
529 Ga0207657_10011496
530 Ga0207649_10568511
531 Ga0207694_10036289
532 Ga0207694_10187345
533 Ga0207650_10422018
534 Ga0207659_10144600
535 Ga0207687_10109548
536 Ga0207690_10012572
537 Ga0207690_10021271
538 Ga0207706_10000090
539 Ga0207704_10002258
540 Ga0207661_10001040
541 Ga0207661_10163638
542 Ga0207679_10005154
543 Ga0207679_10121946
544 Ga0207679_11419472
545 Ga0207667_10000005
546 Ga0207667_10000027
547 Ga0207667_10008899
548 Ga0207668_12150167
549 Ga0207640_10016132
550 Ga0207678_10779888
551 Ga0207702_10000015
552 Ga0207702_10000034
553 Ga0207702_10000057
554 Ga0207674_10000439
555 Ga0207674_10009026
556 Ga0207674_10011456
557 Ga0207674_10135623
558 Ga0207698_10000001
559 Ga0207698_10000048
560 Ga0207698_11436752
561 Ga0209813_10044902
562 Ga0209813_10053589
563 Ga0209974_10311020
564 Ga0268264_10125487
565 Ga0316177_1024066
566 Ga0316176_1101171
567 Ga0316176_1170597
568 Ga0314311_1010899
569 Ga0314311_1132456
570 Ga0314311_1216955
571 Ga0316179_1046099
572 Ga0316179_1050430
573 Ga0316178_1159180
574 Ga0316180_1052434
575 Ga0316180_1132908
576 Ga0316183_1004646
577 Ga0316183_1012734
578 Ga0316183_1033452
579 Ga0316183_1069536
580 Ga0316183_1154109
581 Ga0316183_1189043
582 Ga0316181_1194858
583 Ga0316181_1237308
584 Ga0316182_1058508
585 Ga0316182_1083110
586 Ga0316182_1088257
587 Ga0316182_1244816
588 Ga0316182_1257460
589 Ga0316182_1296081
590 Ga0316182_1400159
591 Ga0307516_10037612
592 Ga0307405_10146186
593 Ga0307413_10951943
594 Ga0307413_11748864
595 Ga0307406_10000001
596 Ga0307406_10000649
597 Ga0307412_10013764
598 Ga0307414_12039249
599 Ga0395899_0020776
600 Ga0395899_0036885
601 Ga0395900_0000001
602 Ga0395898_0000002
603 Ga0395905_0356262
604 Ga0395901_0000006
605 Ga0439436_0053098
606 Ga0439438_009638
607 Ga0439447_039395
608 Ga0439461_0001995
609 Ga0439461_0004581
610 Ga0439466_0045005
611 Ga0439465_0215151
612 Ga0451833_1358405
613 Ga0451837_0391449
614 Ga0451841_1164690
615 Ga0439442_064085
616 Ga0439442_091573
617 Ga0439445_0002562
618 Ga0439432_019930
619 Ga0439432_032262
620 Ga0439463_016849
621 Ga0439463_048356
622 Ga0450919_008119
623 Ga0450920_000612
624 Ga0450906_001220
625 Ga0439446_0000003
626 Ga0439446_0007890
627 Ga0439446_0044912
628 Ga0450909_003301
629 Ga0439434_0000762
630 Ga0439434_0070285
631 Ga0439434_0102832
632 Ga0439464_0000154
633 Ga0439464_0170800
634 Ga0450918_000179
635 Ga0450918_013224
636 Ga0466972_0013340
637 Ga0453684_0084966
638 Ga0466960_1054417
639 Ga0451576_0007988
640 Ga0451576_0135099
641 Ga0451576_0409463
642 Ga0451576_0634715
643 Ga0495590_0049729
644 Ga0495638_0000132
645 Ga0495638_0001142
646 Ga0495671_0062965
647 Ga0495660_0000005
648 Ga0495660_0061837
649 Ga0495672_0258237
650 Ga0495615_0286671
651 Ga0496109_1147745
652 Ga0496110_0296605
653 Ga0496113_0040885
654 Ga0496115_0000001
655 Ga0496125_0135689
656 Ga0501032_0389830
657 Ga0501034_0000028
658 Ga0501034_0006531
659 Ga0501037_0000001
660 Ga0501038_0038766
661 Ga0501043_0908702
662 Ga0501070_1437241
663 nmdc:mga03683_4844_c1
664 nmdc:mga03683_6088_c1
665 nmdc:mga03n38_51223_c1
666 nmdc:mga00v17_267_c1
667 nmdc:mga00v17_397_c1
668 nmdc:mga0yw44_15066_c1
669 nmdc:mga0yw44_1_c1
670 nmdc:mga0yw44_430345_c1
671 nmdc:mga0yw44_4_c1
672 nmdc:mga0yw44_610923_c1
673 nmdc:mga0yw44_68_c1
674 nmdc:mga0yw44_73_c1
675 nmdc:mga0k408_33754_c1
676 nmdc:mga0k408_376132_c1
677 nmdc:mga0k408_994_c1
678 nmdc:mga06z11_63174_c1
679 nmdc:mga06z11_769_c1
680 nmdc:mga04h51_1412_c1
681 nmdc:mga04h51_33581_c1
682 nmdc:mga07m45_16882_c1
683 nmdc:mga07m45_201814_c1
684 nmdc:mga07m45_205878_c1
685 nmdc:mga07m45_249_c3
686 nmdc:mga07m45_48645_c1
687 nmdc:mga07m45_5064_c1
688 nmdc:mga07m45_61248_c2
689 nmdc:mga0sz30_73518_c1
690 nmdc:mga0sz30_8336_c1
691 Ga0500643_000367
692 Ga0500643_004043
693 Ga0500643_009204
694 Ga0500644_0009922
695 Ga0500644_0157249
696 Ga0500646_0000007
697 Ga0500646_0019866
698 Ga0500583_0020476
699 Ga0500651_0000001
700 Ga0500651_0000257
701 Ga0500641_0000001
702 Ga0500650_0064833
703 Ga0500650_0094945
704 Ga0500650_0310039
705 Ga0500554_031563
706 Ga0500555_000009
707 Ga0500562_000001
708 Ga0500569_000037
709 Ga0500594_0000018
710 Ga0500595_175346
711 Ga0500652_000001
712 Ga0500655_003534
713 Ga0500577_0000148
714 Ga0500577_0128069
715 Ga0500577_0281648
716 Ga0500588_0000054
717 Ga0500604_0015844
718 Ga0500604_0029805
719 Ga0500616_0000012
720 Ga0500616_0006934
721 Ga0500616_0050046
722 Ga0500570_004016
723 Ga0500570_144852
724 Ga0500570_172925

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03840

SecG

Preprotein translocase SecG subunit

4

71

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ja6-assembly1.cif.gz_I cryo-electron tomography and all-atom molecular dynamics simulations reveal a novel kinase conformational switch in bacterial chemotaxis signaling 0.8745 3 70
3g6b-assembly1.cif.gz_B crystal structure of a soluble chemoreceptor from thermotoga maritima asn217ile mutant 0.8744 2 66
3g67-assembly1.cif.gz_B crystal structure of a soluble chemoreceptor from thermotoga maritima 0.8732 2 66
8j2f-assembly1.cif.gz_B human neutral shpingomyelinase 0.8604 4 70
4biu-assembly1.cif.gz_D crystal structure of cpxahdc (orthorhombic form 1) 0.8247 4 66
ID Description Score Start End Superfamily
af_A4I5B8_20_195_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.897 4 69 1.20.140.150
af_A0A2R8QKJ7_123_359_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.8803 4 71 1.20.1270.60
af_Q10NB6_155_261_1.20.5.110 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.8752 4 71 1.20.5.110
af_Q9VBM6_98_233_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8749 4 70 1.10.287.70
af_A0A1D6JY39_152_277_1.20.5.110 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.8748 4 71 1.20.5.110
ID Description Score Start End GO Terms
AF-A0A522KGV2-F1-model_v4 Protoporphyrinogen IX oxidase 0.921 2 70 GO:0005886
GO:0006782
GO:0016491
GO:0046872
AF-A0A832EC29-F1-model_v4 deleted 0.9039 4 71
AF-A0A3D9RYY7-F1-model_v4 Uncharacterized protein 0.9021 2 71 GO:0016020
AF-A0A496NW45-F1-model_v4 deleted 0.8976 4 70
AF-A0A6A4H7K5-F1-model_v4 HAT C-terminal dimerisation domain-containing protein 0.8965 3 71

Map