F422702

General Info

Members Datasets Scaffolds Average Seq Length
362 169 724 224

Family's Representative Sequence

Representative Sequence 3300044842|Ga0466957_0117370|Ga0466957_0117370_483_1169
Length 228
Sequence MMRAKPMLWGAAIAIALSSTAAMANVVVVKSLGPSAKAYPPGKTLPSNTKITLQGGDVLTVLGPSSAQTLRGPGNFDASQMSLASASSQRGRFSALRAAEVAHNPSVWDIDVTQSGKVCVANPSKLQLWRPDTTDASSVQISSPDGKTQKLEWAAGKALAAWPTALPIQTGAQYQIEWAETGDKSSLDLVTVSAPADLVGTAQVLIQNGCQNQLDLLVSSASKTGSGQ

Samples

Sample ID Description Type Environment
1 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
76 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
120 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
121 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
122 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
123 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
124 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
130 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
131 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
132 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
133 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
134 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
135 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
136 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
137 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
138 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
139 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
140 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
141 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
142 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
143 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
144 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
145 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
146 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
147 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
148 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
149 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
154 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
162 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
163 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
164 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
165 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
166 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
167 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.07
Metatranscriptomes 1.93
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.63
Rhizosphere 92.82
Stem 0
Stem Tuber 0
Unclassified 11.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466957_0117370 3300044842 Bacteria 1694
2 JGI24741J21665_1001923 3300001915 Bacteria 5607
3 JGI24740J21852_10000589 3300001979 Bacteria 15669
4 JGI24740J21852_10032811 3300001979 Bacteria 1656
5 JGI24737J22298_10000717 3300001990 Bacteria 11659
6 JGI24737J22298_10007191 3300001990 Bacteria 3766
7 JGI24743J22301_10019866 3300001991 Bacteria 1277
8 JGI24735J21928_10005017 3300002067 Bacteria 4406
9 JGI24735J21928_10011173 3300002067 Bacteria 2852
10 JGI24738J21930_10003360 3300002075 Bacteria 4056
11 rootH2_10242183 3300003320 Bacteria 1985
12 Ga0065715_10162571 3300005293 Unclassified 1615
13 Ga0070658_10000205 3300005327 Bacteria 52211
14 Ga0070658_10049126 3300005327 Bacteria 3417
15 Ga0070658_10083456 3300005327 Bacteria 2626
16 Ga0070658_10108640 3300005327 Bacteria 2296
17 Ga0070658_10363748 3300005327 Bacteria 1239
18 Ga0070676_10215632 3300005328 Bacteria 1265
19 Ga0070676_10253939 3300005328 Unclassified 1174
20 Ga0070683_100002492 3300005329 Bacteria 14662
21 Ga0070683_100066511 3300005329 Bacteria 3357
22 Ga0070666_10000168 3300005335 Bacteria 45111
23 Ga0070666_10122415 3300005335 Bacteria 1804
24 Ga0070680_100003746 3300005336 Bacteria 11362
25 Ga0070680_100033201 3300005336 Bacteria 4158
26 Ga0070680_100037371 3300005336 Bacteria 3923
27 Ga0070680_100735750 3300005336 Unclassified 849
28 Ga0070682_100011208 3300005337 Bacteria 5115
29 Ga0070682_100171628 3300005337 Bacteria 1508
30 Ga0068868_100002054 3300005338 Bacteria 13835
31 Ga0068868_100071906 3300005338 Bacteria 2759
32 Ga0070660_100000009 3300005339 Bacteria 145691
33 Ga0070660_100001509 3300005339 Bacteria 15957
34 Ga0070660_100039562 3300005339 Bacteria 3585
35 Ga0070660_100066742 3300005339 Bacteria 2802
36 Ga0070660_100100670 3300005339 Unclassified 2289
37 Ga0070691_10316393 3300005341 Bacteria 857
38 Ga0070661_100000100 3300005344 Bacteria 70585
39 Ga0070661_100004554 3300005344 Bacteria 9537
40 Ga0070661_100070084 3300005344 Bacteria 2578
41 Ga0070661_100090190 3300005344 Bacteria 2270
42 Ga0070661_100170285 3300005344 Bacteria 1653
43 Ga0070661_100243868 3300005344 Unclassified 1384
44 Ga0070661_100246670 3300005344 Unclassified 1377
45 Ga0070692_10005766 3300005345 Bacteria 5321
46 Ga0070692_10150752 3300005345 Bacteria 1324
47 Ga0070668_100696416 3300005347 Bacteria 896
48 Ga0070669_100241891 3300005353 Bacteria 1434
49 Ga0070671_100003268 3300005355 Bacteria 12653
50 Ga0070671_100027694 3300005355 Bacteria 4666
51 Ga0070671_100036477 3300005355 Bacteria 4077
52 Ga0070671_100245719 3300005355 Unclassified 1519
53 Ga0070671_100275099 3300005355 Bacteria 1431
54 Ga0070673_100024937 3300005364 Bacteria 4393
55 Ga0070673_100075351 3300005364 Bacteria 2721
56 Ga0070673_100143721 3300005364 Bacteria 2015
57 Ga0070673_100148638 3300005364 Bacteria 1982
58 Ga0070673_100711903 3300005364 Bacteria 922
59 Ga0070688_100586940 3300005365 Bacteria 851
60 Ga0070659_100000048 3300005366 Bacteria 98245
61 Ga0070659_100017735 3300005366 Bacteria 5362
62 Ga0070659_100026112 3300005366 Bacteria 4492
63 Ga0070659_100031354 3300005366 Bacteria 4116
64 Ga0070659_100093470 3300005366 Bacteria 2413
65 Ga0070659_100135269 3300005366 Bacteria 2004
66 Ga0070667_100003299 3300005367 Bacteria 13798
67 Ga0070667_100003776 3300005367 Bacteria 12872
68 Ga0070714_100005427 3300005435 Bacteria 9730
69 Ga0070714_100005785 3300005435 Bacteria 9481
70 Ga0070714_100190852 3300005435 Unclassified 1869
71 Ga0070713_100026248 3300005436 Bacteria 4571
72 Ga0070713_100033070 3300005436 Bacteria 4139
73 Ga0070663_100003985 3300005455 Bacteria 8618
74 Ga0070663_100009479 3300005455 Bacteria 6030
75 Ga0070678_100108128 3300005456 Bacteria 2170
76 Ga0070678_100316012 3300005456 Bacteria 1332
77 Ga0070678_100617857 3300005456 Unclassified 969
78 Ga0070662_100000035 3300005457 Bacteria 77342
79 Ga0070662_100006246 3300005457 Bacteria 7674
80 Ga0070662_100100460 3300005457 Bacteria 2189
81 Ga0070662_100149286 3300005457 Unclassified 1818
82 Ga0070662_100342669 3300005457 Bacteria 1223
83 Ga0070662_100581071 3300005457 Bacteria 941
84 Ga0070681_10086088 3300005458 Bacteria 3095
85 Ga0070679_100067129 3300005530 Unclassified 3576
86 Ga0070679_100164690 3300005530 Bacteria 2191
87 Ga0070684_100034504 3300005535 Bacteria 4326
88 Ga0068853_100001248 3300005539 Bacteria 18175
89 Ga0068853_100044091 3300005539 Bacteria 3818
90 Ga0068853_100134039 3300005539 Bacteria 2219
91 Ga0068853_100543871 3300005539 Unclassified 1099
92 Ga0070672_100222193 3300005543 Bacteria 1584
93 Ga0070696_100183274 3300005546 Bacteria 1554
94 Ga0070696_100301114 3300005546 Bacteria 1228
95 Ga0070693_100003192 3300005547 Bacteria 7608
96 Ga0070693_100066300 3300005547 Bacteria 2113
97 Ga0070665_100008493 3300005548 Bacteria 10388
98 Ga0070665_100140271 3300005548 Bacteria 2420
99 Ga0070665_100381689 3300005548 Unclassified 1416
100 Ga0068855_100001487 3300005563 Bacteria 29322
101 Ga0068855_100022719 3300005563 Bacteria 7516
102 Ga0068855_100083532 3300005563 Bacteria 3699
103 Ga0068855_100504855 3300005563 Bacteria 1314
104 Ga0070664_100000025 3300005564 Bacteria 93173
105 Ga0070664_100178265 3300005564 Unclassified 1888
106 Ga0070664_100356564 3300005564 Unclassified 1331
107 Ga0068857_100074968 3300005577 Bacteria 3016
108 Ga0068854_100009160 3300005578 Bacteria 6384
109 Ga0068854_100019115 3300005578 Bacteria 4612
110 Ga0068854_100161568 3300005578 Bacteria 1735
111 Ga0068856_100000124 3300005614 Bacteria 77469
112 Ga0068856_100024186 3300005614 Bacteria 5910
113 Ga0068856_100101544 3300005614 Bacteria 2869
114 Ga0068852_100013177 3300005616 Bacteria 6319
115 Ga0068852_100090579 3300005616 Bacteria 2735
116 Ga0068852_100235166 3300005616 Bacteria 1748
117 Ga0068864_100015927 3300005618 Bacteria 6258
118 Ga0068864_100037788 3300005618 Bacteria 4122
119 Ga0068864_100062062 3300005618 Bacteria 3238
120 Ga0068864_100186813 3300005618 Unclassified 1897
121 Ga0068851_10050683 3300005834 Unclassified 2108
122 Ga0068858_100020174 3300005842 Bacteria 6232
123 Ga0068858_100128157 3300005842 Bacteria 2378
124 Ga0068860_100679816 3300005843 Unclassified 1038
125 Ga0070717_10019960 3300006028 Bacteria 5264
126 Ga0070712_100076491 3300006175 Bacteria 2410
127 Ga0097621_100045720 3300006237 Bacteria 3538
128 Ga0097621_100135322 3300006237 Bacteria 2101
129 Ga0097621_100221949 3300006237 Bacteria 1647
130 Ga0068871_100066679 3300006358 Bacteria 2951
131 Ga0068871_100316022 3300006358 Bacteria 1374
132 Ga0068871_100874855 3300006358 Bacteria 832
133 Ga0068865_100361639 3300006881 Bacteria 1179
134 Ga0105245_10723711 3300009098 Bacteria 1030
135 Ga0105241_10007654 3300009174 Bacteria 7941
136 Ga0105248_10000163 3300009177 Bacteria 77658
137 Ga0105248_10056241 3300009177 Bacteria 4414
138 Ga0105248_10060179 3300009177 Bacteria 4264
139 Ga0105238_10028049 3300009551 Bacteria 5736
140 Ga0105238_10217060 3300009551 Unclassified 1889
141 Ga0157373_10034144 3300013100 Bacteria 3654
142 Ga0157373_10062477 3300013100 Bacteria 2638
143 Ga0157373_10076702 3300013100 Bacteria 2359
144 Ga0157373_10115569 3300013100 Bacteria 1886
145 Ga0157373_10132260 3300013100 Bacteria 1754
146 Ga0157373_10136420 3300013100 Bacteria 1725
147 Ga0157373_10236479 3300013100 Bacteria 1291
148 Ga0157371_10002007 3300013102 Bacteria 20125
149 Ga0157371_10010911 3300013102 Bacteria 7045
150 Ga0157371_10018498 3300013102 Bacteria 5149
151 Ga0157371_10339923 3300013102 Bacteria 1092
152 Ga0157370_10032261 3300013104 Bacteria 5115
153 Ga0157369_10010201 3300013105 Bacteria 10718
154 Ga0157374_10009045 3300013296 Bacteria 8537
155 Ga0157374_10068057 3300013296 Bacteria 3349
156 Ga0157374_10079852 3300013296 Bacteria 3101
157 Ga0163162_10064370 3300013306 Bacteria 3712
158 Ga0157372_10016123 3300013307 Bacteria 8017
159 Ga0163163_10000173 3300014325 Bacteria 67717
160 Ga0157377_10214291 3300014745 Bacteria 1229
161 Ga0157379_10027263 3300014968 Bacteria 5086
162 Ga0197907_10008173 3300020069 Unclassified 1380
163 Ga0206352_10238308 3300020078 Bacteria 788
164 Ga0206354_11142318 3300020081 Bacteria 1476
165 Ga0206353_10044027 3300020082 Bacteria 1758
166 Ga0206353_11786651 3300020082 Bacteria 1512
167 Ga0213876_10010916 3300021384 Bacteria 4864
168 Ga0207673_1013489 3300025290 Bacteria 1073
169 Ga0207697_10065280 3300025315 Unclassified 1519
170 Ga0207656_10040785 3300025321 Bacteria 1969
171 Ga0207680_10296416 3300025903 Unclassified 1126
172 Ga0207647_10070577 3300025904 Bacteria 2110
173 Ga0207645_10011848 3300025907 Bacteria 5936
174 Ga0207645_10176183 3300025907 Bacteria 1402
175 Ga0207705_10000114 3300025909 Bacteria 90132
176 Ga0207705_10001917 3300025909 Bacteria 16248
177 Ga0207705_10003511 3300025909 Bacteria 11939
178 Ga0207705_10026263 3300025909 Bacteria 4154
179 Ga0207705_10049349 3300025909 Bacteria 3029
180 Ga0207705_10054575 3300025909 Bacteria 2880
181 Ga0207705_10090915 3300025909 Bacteria 2235
182 Ga0207705_10235281 3300025909 Bacteria 1394
183 Ga0207705_10439604 3300025909 Bacteria 1011
184 Ga0207705_10741449 3300025909 Unclassified 763
185 Ga0207654_10093294 3300025911 Bacteria 1840
186 Ga0207707_10020600 3300025912 Bacteria 5760
187 Ga0207707_10071318 3300025912 Bacteria 3027
188 Ga0207693_10058924 3300025915 Bacteria 3008
189 Ga0207660_10004684 3300025917 Bacteria 8910
190 Ga0207660_10008547 3300025917 Bacteria 6625
191 Ga0207660_10111021 3300025917 Unclassified 2063
192 Ga0207657_10000071 3300025919 Bacteria 93725
193 Ga0207657_10006910 3300025919 Bacteria 11706
194 Ga0207657_10013044 3300025919 Bacteria 8167
195 Ga0207657_10051586 3300025919 Bacteria 3576
196 Ga0207657_10075695 3300025919 Bacteria 2840
197 Ga0207657_10215898 3300025919 Bacteria 1538
198 Ga0207649_10000301 3300025920 Bacteria 37967
199 Ga0207649_10006077 3300025920 Bacteria 6553
200 Ga0207652_10002862 3300025921 Bacteria 14449
201 Ga0207681_10248195 3300025923 Bacteria 1389
202 Ga0207694_10090357 3300025924 Bacteria 2416
203 Ga0207650_10026326 3300025925 Bacteria 4147
204 Ga0207687_10059845 3300025927 Bacteria 2685
205 Ga0207700_10327928 3300025928 Bacteria 1328
206 Ga0207700_10391774 3300025928 Bacteria 1216
207 Ga0207664_10065961 3300025929 Bacteria 2900
208 Ga0207664_10271972 3300025929 Bacteria 1484
209 Ga0207644_10004781 3300025931 Bacteria 8811
210 Ga0207644_10004978 3300025931 Bacteria 8666
211 Ga0207644_10020504 3300025931 Bacteria 4494
212 Ga0207690_10000045 3300025932 Bacteria 116965
213 Ga0207690_10001260 3300025932 Bacteria 16012
214 Ga0207690_10051667 3300025932 Bacteria 2750
215 Ga0207690_10084859 3300025932 Bacteria 2221
216 Ga0207690_10095172 3300025932 Bacteria 2115
217 Ga0207690_10211070 3300025932 Unclassified 1480
218 Ga0207690_10312045 3300025932 Bacteria 1234
219 Ga0207690_10395258 3300025932 Bacteria 1101
220 Ga0207706_10000086 3300025933 Bacteria 95284
221 Ga0207706_10000655 3300025933 Bacteria 36583
222 Ga0207706_10024453 3300025933 Bacteria 5415
223 Ga0207706_10050453 3300025933 Bacteria 3677
224 Ga0207706_10058870 3300025933 Bacteria 3383
225 Ga0207706_10213488 3300025933 Bacteria 1691
226 Ga0207691_10021409 3300025940 Bacteria 6105
227 Ga0207711_10003283 3300025941 Bacteria 14060
228 Ga0207711_10035421 3300025941 Bacteria 4230
229 Ga0207711_10102370 3300025941 Bacteria 2535
230 Ga0207711_10254033 3300025941 Bacteria 1615
231 Ga0207689_10432184 3300025942 Bacteria 1099
232 Ga0207689_10750062 3300025942 Bacteria 824
233 Ga0207661_10001017 3300025944 Bacteria 18588
234 Ga0207661_10052798 3300025944 Bacteria 3249
235 Ga0207679_10000315 3300025945 Bacteria 36328
236 Ga0207679_10181080 3300025945 Bacteria 1743
237 Ga0207667_10001152 3300025949 Bacteria 33245
238 Ga0207667_10066064 3300025949 Bacteria 3771
239 Ga0207667_10468217 3300025949 Bacteria 1280
240 Ga0207667_11126176 3300025949 Bacteria 767
241 Ga0207651_10407555 3300025960 Bacteria 1158
242 Ga0207651_10550400 3300025960 Unclassified 1003
243 Ga0207640_10027211 3300025981 Bacteria 3482
244 Ga0207640_10286339 3300025981 Bacteria 1297
245 Ga0207658_10020002 3300025986 Bacteria 4633
246 Ga0207658_10035645 3300025986 Bacteria 3565
247 Ga0207658_10075063 3300025986 Bacteria 2571
248 Ga0207677_10306835 3300026023 Bacteria 1313
249 Ga0207703_10050253 3300026035 Bacteria 3374
250 Ga0207639_10000330 3300026041 Bacteria 32864
251 Ga0207639_10005870 3300026041 Bacteria 8319
252 Ga0207639_10011769 3300026041 Bacteria 6085
253 Ga0207639_10113305 3300026041 Bacteria 2215
254 Ga0207639_10243286 3300026041 Bacteria 1565
255 Ga0207678_10000311 3300026067 Bacteria 43860
256 Ga0207678_10000860 3300026067 Bacteria 27872
257 Ga0207678_10002439 3300026067 Bacteria 16899
258 Ga0207678_10016206 3300026067 Bacteria 6540
259 Ga0207702_10000254 3300026078 Bacteria 61680
260 Ga0207641_10309020 3300026088 Unclassified 1496
261 Ga0207648_10128530 3300026089 Bacteria 2229
262 Ga0207676_10064832 3300026095 Unclassified 2907
263 Ga0207676_11251460 3300026095 Bacteria 736
264 Ga0207674_10003121 3300026116 Bacteria 20439
265 Ga0207674_10005100 3300026116 Bacteria 15681
266 Ga0207674_10628419 3300026116 Bacteria 1037
267 Ga0207683_10654398 3300026121 Bacteria 973
268 Ga0207698_10000709 3300026142 Bacteria 19311
269 Ga0207698_10008119 3300026142 Bacteria 6617
270 Ga0207698_10047293 3300026142 Bacteria 3258
271 Ga0207698_10135458 3300026142 Unclassified 2112
272 Ga0207698_11087628 3300026142 Bacteria 812
273 Ga0268266_10009531 3300028379 Bacteria 8546
274 Ga0268266_10118004 3300028379 Bacteria 2358
275 Ga0268266_10506322 3300028379 Unclassified 1153
276 Ga0268266_10541306 3300028379 Bacteria 1115
277 Ga0307409_100635766 3300031995 Unclassified 1059
278 Ga0373930_0017291 3300034816 Bacteria 1373
279 Ga0373928_0018897 3300035084 Bacteria 1433
280 Ga0373960_0022629 3300035121 Bacteria 1685
281 Ga0373931_0000615 3300035691 Bacteria 14756
282 Ga0395899_0196171 3300037312 Unclassified 1410
283 Ga0395900_0164258 3300037418 Bacteria 2263
284 Ga0395900_0249890 3300037418 Bacteria 1775
285 Ga0395900_0858281 3300037418 Unclassified 833
286 Ga0395898_0335018 3300037466 Bacteria 1443
287 Ga0395898_0670666 3300037466 Bacteria 979
288 Ga0395905_0143225 3300037471 Unclassified 2249
289 Ga0395905_0181796 3300037471 Bacteria 1974
290 Ga0395905_0243670 3300037471 Bacteria 1679
291 Ga0395905_0282076 3300037471 Bacteria 1547
292 Ga0395905_0551681 3300037471 Bacteria 1054
293 Ga0395905_0746626 3300037471 Bacteria 881
294 Ga0395901_0196502 3300038443 Bacteria 2115
295 Ga0395901_0216286 3300038443 Bacteria 2004
296 Ga0395901_0529943 3300038443 Bacteria 1196
297 Ga0395901_1131884 3300038443 Bacteria 752
298 Ga0466972_0099061 3300044658 Bacteria 1380
299 Ga0466965_0455549 3300044683 Bacteria 713
300 Ga0466966_0021776 3300044684 Bacteria 4208
301 Ga0466966_0077337 3300044684 Bacteria 2077
302 Ga0466963_0024642 3300044694 Bacteria 3830
303 Ga0466964_0061721 3300044706 Bacteria 1561
304 Ga0466964_0112531 3300044706 Bacteria 1216
305 Ga0466971_0099442 3300044719 Bacteria 1336
306 Ga0466957_0004719 3300044842 Bacteria 7631
307 Ga0466957_0052357 3300044842 Bacteria 2485
308 Ga0466960_0304637 3300044901 Unclassified 899
309 Ga0466959_0055897 3300045049 Bacteria 2880
310 Ga0466959_0223053 3300045049 Bacteria 1307
311 Ga0466958_0008138 3300045836 Bacteria 5804
312 Ga0466958_0084393 3300045836 Bacteria 1959
313 Ga0466958_0364371 3300045836 Unclassified 931
314 Ga0466967_0006738 3300045976 Bacteria 8174
315 Ga0466967_0029374 3300045976 Bacteria 4600
316 Ga0466967_0031955 3300045976 Bacteria 4439
317 Ga0466967_0033123 3300045976 Bacteria 4372
318 Ga0466967_0118704 3300045976 Bacteria 2440
319 Ga0466967_0189016 3300045976 Bacteria 1945
320 Ga0495632_0115140 3300046519 Bacteria 1260
321 Ga0495663_0102202 3300046525 Bacteria 945
322 Ga0495642_0057297 3300046528 Bacteria 1611
323 Ga0495654_0173403 3300046530 Bacteria 939
324 Ga0495621_0095775 3300046539 Bacteria 1124
325 Ga0495668_0039854 3300046616 Bacteria 2622
326 Ga0495625_0542937 3300046660 Bacteria 705
327 Ga0495669_0001528 3300046684 Bacteria 9519
328 Ga0495669_0298315 3300046684 Bacteria 776
329 Ga0495660_0190463 3300046810 Bacteria 986
330 Ga0496100_0240720 3300048903 Bacteria 1335
331 Ga0496101_0043158 3300048904 Bacteria 3222
332 Ga0496101_0057924 3300048904 Bacteria 2804
333 Ga0496104_0101331 3300048907 Bacteria 2757
334 Ga0496105_0129423 3300048908 Unclassified 2082
335 Ga0496106_0538246 3300048909 Unclassified 937
336 Ga0496107_0012723 3300048910 Bacteria 5879
337 Ga0496107_0191920 3300048910 Bacteria 1518
338 Ga0496107_0276898 3300048910 Bacteria 1249
339 Ga0496108_0013785 3300048911 Bacteria 6593
340 Ga0496108_0721354 3300048911 Bacteria 864
341 Ga0496109_0067720 3300048912 Bacteria 3271
342 Ga0496109_0085712 3300048912 Bacteria 2908
343 Ga0496110_0371224 3300048913 Bacteria 1304
344 Ga0496111_0013433 3300048914 Bacteria 5573
345 Ga0496111_0251021 3300048914 Bacteria 1313
346 Ga0496112_0006500 3300048915 Bacteria 10275
347 Ga0496112_0060913 3300048915 Bacteria 3719
348 Ga0496112_0321072 3300048915 Bacteria 1493
349 Ga0496112_0326053 3300048915 Unclassified 1479
350 Ga0496113_0008437 3300048916 Bacteria 6713
351 Ga0496114_0000023 3300048917 Bacteria 219092
352 Ga0496114_0239763 3300048917 Bacteria 1594
353 Ga0496115_0019641 3300048918 Bacteria 5202
354 Ga0501067_0039008 3300049583 Unclassified 2637
355 Ga0501074_0182797 3300049590 Bacteria 1495
356 Ga0501080_0085319 3300049742 Bacteria 2934
357 Ga0501044_0530617 3300049823 Bacteria 1076
358 Ga0495655_0044801 3300053083 Bacteria 1146
359 Ga0587075_036720 3300059644 Unclassified 804
360 Ga0587079_069623 3300059647 Unclassified 782
361 Ga0466962_0036454 3300061719 Bacteria 2354
362 Ga0466962_0102580 3300061719 Bacteria 1374
363 Ga0466957_0117370
364 JGI24741J21665_1001923
365 JGI24740J21852_10000589
366 JGI24740J21852_10032811
367 JGI24737J22298_10000717
368 JGI24737J22298_10007191
369 JGI24743J22301_10019866
370 JGI24735J21928_10005017
371 JGI24735J21928_10011173
372 JGI24738J21930_10003360
373 rootH2_10242183
374 Ga0065715_10162571
375 Ga0070658_10000205
376 Ga0070658_10049126
377 Ga0070658_10083456
378 Ga0070658_10108640
379 Ga0070658_10363748
380 Ga0070676_10215632
381 Ga0070676_10253939
382 Ga0070683_100002492
383 Ga0070683_100066511
384 Ga0070666_10000168
385 Ga0070666_10122415
386 Ga0070680_100003746
387 Ga0070680_100033201
388 Ga0070680_100037371
389 Ga0070680_100735750
390 Ga0070682_100011208
391 Ga0070682_100171628
392 Ga0068868_100002054
393 Ga0068868_100071906
394 Ga0070660_100000009
395 Ga0070660_100001509
396 Ga0070660_100039562
397 Ga0070660_100066742
398 Ga0070660_100100670
399 Ga0070691_10316393
400 Ga0070661_100000100
401 Ga0070661_100004554
402 Ga0070661_100070084
403 Ga0070661_100090190
404 Ga0070661_100170285
405 Ga0070661_100243868
406 Ga0070661_100246670
407 Ga0070692_10005766
408 Ga0070692_10150752
409 Ga0070668_100696416
410 Ga0070669_100241891
411 Ga0070671_100003268
412 Ga0070671_100027694
413 Ga0070671_100036477
414 Ga0070671_100245719
415 Ga0070671_100275099
416 Ga0070673_100024937
417 Ga0070673_100075351
418 Ga0070673_100143721
419 Ga0070673_100148638
420 Ga0070673_100711903
421 Ga0070688_100586940
422 Ga0070659_100000048
423 Ga0070659_100017735
424 Ga0070659_100026112
425 Ga0070659_100031354
426 Ga0070659_100093470
427 Ga0070659_100135269
428 Ga0070667_100003299
429 Ga0070667_100003776
430 Ga0070714_100005427
431 Ga0070714_100005785
432 Ga0070714_100190852
433 Ga0070713_100026248
434 Ga0070713_100033070
435 Ga0070663_100003985
436 Ga0070663_100009479
437 Ga0070678_100108128
438 Ga0070678_100316012
439 Ga0070678_100617857
440 Ga0070662_100000035
441 Ga0070662_100006246
442 Ga0070662_100100460
443 Ga0070662_100149286
444 Ga0070662_100342669
445 Ga0070662_100581071
446 Ga0070681_10086088
447 Ga0070679_100067129
448 Ga0070679_100164690
449 Ga0070684_100034504
450 Ga0068853_100001248
451 Ga0068853_100044091
452 Ga0068853_100134039
453 Ga0068853_100543871
454 Ga0070672_100222193
455 Ga0070696_100183274
456 Ga0070696_100301114
457 Ga0070693_100003192
458 Ga0070693_100066300
459 Ga0070665_100008493
460 Ga0070665_100140271
461 Ga0070665_100381689
462 Ga0068855_100001487
463 Ga0068855_100022719
464 Ga0068855_100083532
465 Ga0068855_100504855
466 Ga0070664_100000025
467 Ga0070664_100178265
468 Ga0070664_100356564
469 Ga0068857_100074968
470 Ga0068854_100009160
471 Ga0068854_100019115
472 Ga0068854_100161568
473 Ga0068856_100000124
474 Ga0068856_100024186
475 Ga0068856_100101544
476 Ga0068852_100013177
477 Ga0068852_100090579
478 Ga0068852_100235166
479 Ga0068864_100015927
480 Ga0068864_100037788
481 Ga0068864_100062062
482 Ga0068864_100186813
483 Ga0068851_10050683
484 Ga0068858_100020174
485 Ga0068858_100128157
486 Ga0068860_100679816
487 Ga0070717_10019960
488 Ga0070712_100076491
489 Ga0097621_100045720
490 Ga0097621_100135322
491 Ga0097621_100221949
492 Ga0068871_100066679
493 Ga0068871_100316022
494 Ga0068871_100874855
495 Ga0068865_100361639
496 Ga0105245_10723711
497 Ga0105241_10007654
498 Ga0105248_10000163
499 Ga0105248_10056241
500 Ga0105248_10060179
501 Ga0105238_10028049
502 Ga0105238_10217060
503 Ga0157373_10034144
504 Ga0157373_10062477
505 Ga0157373_10076702
506 Ga0157373_10115569
507 Ga0157373_10132260
508 Ga0157373_10136420
509 Ga0157373_10236479
510 Ga0157371_10002007
511 Ga0157371_10010911
512 Ga0157371_10018498
513 Ga0157371_10339923
514 Ga0157370_10032261
515 Ga0157369_10010201
516 Ga0157374_10009045
517 Ga0157374_10068057
518 Ga0157374_10079852
519 Ga0163162_10064370
520 Ga0157372_10016123
521 Ga0163163_10000173
522 Ga0157377_10214291
523 Ga0157379_10027263
524 Ga0197907_10008173
525 Ga0206352_10238308
526 Ga0206354_11142318
527 Ga0206353_10044027
528 Ga0206353_11786651
529 Ga0213876_10010916
530 Ga0207673_1013489
531 Ga0207697_10065280
532 Ga0207656_10040785
533 Ga0207680_10296416
534 Ga0207647_10070577
535 Ga0207645_10011848
536 Ga0207645_10176183
537 Ga0207705_10000114
538 Ga0207705_10001917
539 Ga0207705_10003511
540 Ga0207705_10026263
541 Ga0207705_10049349
542 Ga0207705_10054575
543 Ga0207705_10090915
544 Ga0207705_10235281
545 Ga0207705_10439604
546 Ga0207705_10741449
547 Ga0207654_10093294
548 Ga0207707_10020600
549 Ga0207707_10071318
550 Ga0207693_10058924
551 Ga0207660_10004684
552 Ga0207660_10008547
553 Ga0207660_10111021
554 Ga0207657_10000071
555 Ga0207657_10006910
556 Ga0207657_10013044
557 Ga0207657_10051586
558 Ga0207657_10075695
559 Ga0207657_10215898
560 Ga0207649_10000301
561 Ga0207649_10006077
562 Ga0207652_10002862
563 Ga0207681_10248195
564 Ga0207694_10090357
565 Ga0207650_10026326
566 Ga0207687_10059845
567 Ga0207700_10327928
568 Ga0207700_10391774
569 Ga0207664_10065961
570 Ga0207664_10271972
571 Ga0207644_10004781
572 Ga0207644_10004978
573 Ga0207644_10020504
574 Ga0207690_10000045
575 Ga0207690_10001260
576 Ga0207690_10051667
577 Ga0207690_10084859
578 Ga0207690_10095172
579 Ga0207690_10211070
580 Ga0207690_10312045
581 Ga0207690_10395258
582 Ga0207706_10000086
583 Ga0207706_10000655
584 Ga0207706_10024453
585 Ga0207706_10050453
586 Ga0207706_10058870
587 Ga0207706_10213488
588 Ga0207691_10021409
589 Ga0207711_10003283
590 Ga0207711_10035421
591 Ga0207711_10102370
592 Ga0207711_10254033
593 Ga0207689_10432184
594 Ga0207689_10750062
595 Ga0207661_10001017
596 Ga0207661_10052798
597 Ga0207679_10000315
598 Ga0207679_10181080
599 Ga0207667_10001152
600 Ga0207667_10066064
601 Ga0207667_10468217
602 Ga0207667_11126176
603 Ga0207651_10407555
604 Ga0207651_10550400
605 Ga0207640_10027211
606 Ga0207640_10286339
607 Ga0207658_10020002
608 Ga0207658_10035645
609 Ga0207658_10075063
610 Ga0207677_10306835
611 Ga0207703_10050253
612 Ga0207639_10000330
613 Ga0207639_10005870
614 Ga0207639_10011769
615 Ga0207639_10113305
616 Ga0207639_10243286
617 Ga0207678_10000311
618 Ga0207678_10000860
619 Ga0207678_10002439
620 Ga0207678_10016206
621 Ga0207702_10000254
622 Ga0207641_10309020
623 Ga0207648_10128530
624 Ga0207676_10064832
625 Ga0207676_11251460
626 Ga0207674_10003121
627 Ga0207674_10005100
628 Ga0207674_10628419
629 Ga0207683_10654398
630 Ga0207698_10000709
631 Ga0207698_10008119
632 Ga0207698_10047293
633 Ga0207698_10135458
634 Ga0207698_11087628
635 Ga0268266_10009531
636 Ga0268266_10118004
637 Ga0268266_10506322
638 Ga0268266_10541306
639 Ga0307409_100635766
640 Ga0373930_0017291
641 Ga0373928_0018897
642 Ga0373960_0022629
643 Ga0373931_0000615
644 Ga0395899_0196171
645 Ga0395900_0164258
646 Ga0395900_0249890
647 Ga0395900_0858281
648 Ga0395898_0335018
649 Ga0395898_0670666
650 Ga0395905_0143225
651 Ga0395905_0181796
652 Ga0395905_0243670
653 Ga0395905_0282076
654 Ga0395905_0551681
655 Ga0395905_0746626
656 Ga0395901_0196502
657 Ga0395901_0216286
658 Ga0395901_0529943
659 Ga0395901_1131884
660 Ga0466972_0099061
661 Ga0466965_0455549
662 Ga0466966_0021776
663 Ga0466966_0077337
664 Ga0466963_0024642
665 Ga0466964_0061721
666 Ga0466964_0112531
667 Ga0466971_0099442
668 Ga0466957_0004719
669 Ga0466957_0052357
670 Ga0466960_0304637
671 Ga0466959_0055897
672 Ga0466959_0223053
673 Ga0466958_0008138
674 Ga0466958_0084393
675 Ga0466958_0364371
676 Ga0466967_0006738
677 Ga0466967_0029374
678 Ga0466967_0031955
679 Ga0466967_0033123
680 Ga0466967_0118704
681 Ga0466967_0189016
682 Ga0495632_0115140
683 Ga0495663_0102202
684 Ga0495642_0057297
685 Ga0495654_0173403
686 Ga0495621_0095775
687 Ga0495668_0039854
688 Ga0495625_0542937
689 Ga0495669_0001528
690 Ga0495669_0298315
691 Ga0495660_0190463
692 Ga0496100_0240720
693 Ga0496101_0043158
694 Ga0496101_0057924
695 Ga0496104_0101331
696 Ga0496105_0129423
697 Ga0496106_0538246
698 Ga0496107_0012723
699 Ga0496107_0191920
700 Ga0496107_0276898
701 Ga0496108_0013785
702 Ga0496108_0721354
703 Ga0496109_0067720
704 Ga0496109_0085712
705 Ga0496110_0371224
706 Ga0496111_0013433
707 Ga0496111_0251021
708 Ga0496112_0006500
709 Ga0496112_0060913
710 Ga0496112_0321072
711 Ga0496112_0326053
712 Ga0496113_0008437
713 Ga0496114_0000023
714 Ga0496114_0239763
715 Ga0496115_0019641
716 Ga0501067_0039008
717 Ga0501074_0182797
718 Ga0501080_0085319
719 Ga0501044_0530617
720 Ga0495655_0044801
721 Ga0587075_036720
722 Ga0587079_069623
723 Ga0466962_0036454
724 Ga0466962_0102580

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f4n-assembly1.cif.gz_B crystal structure of protein mj1651 from methanococcus jannaschii dsm 2661, pfam duf62 0.7814 131 151
2f4n-assembly1.cif.gz_C crystal structure of protein mj1651 from methanococcus jannaschii dsm 2661, pfam duf62 0.7475 130 151
6m7c-assembly1.cif.gz_A crystal structure of c-terminal fragment of pilus adhesin spac from lactobacillus rhamnosus gg 0.7382 136 189
2yn3-assembly3.cif.gz_D structural insight into the giant calcium-binding adhesin siie: implications for the adhesion of salmonella enterica to polarized epithelial cells 0.7174 136 189
4s3r-assembly1.cif.gz_A amylomaltase malq from escherichia coli in complex with the pseudo-heptasaccharide acarviosine-glucose-acarbose 0.7074 113 190
ID Description Score Start End Superfamily
af_P13475_13_104_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.7254 108 188 3.40.50.720
af_P15977_1_137_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7112 116 191 2.60.40.10
af_G5ECX2_917_1013_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7082 135 191 2.60.40.10
af_O50419_75_527_3.30.1490.100 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;DNA polymerase, Y-family, little finger domain 0.7054 132 153 3.30.1490.100
3pjyA00 Mainly Beta;Sandwich;Jelly Rolls;Protein of unknown function DUF192 0.6802 131 151 2.60.120.1140
ID Description Score Start End GO Terms
AF-A0A259GYR1-F1-model_v4 Uncharacterized protein 0.9394 106 224
AF-A0A0Q5VB22-F1-model_v4 SRPBCC family protein 0.8628 108 219
AF-A0A1W9WA74-F1-model_v4 Uncharacterized protein 0.8539 104 217
AF-A0A7V8RFB2-F1-model_v4 Uncharacterized protein 0.8034 23 224
AF-A0A090AHX7-F1-model_v4 Secreted protein 0.8026 106 219

Map