F422822

General Info

Members Datasets Scaffolds Average Seq Length
362 271 267 222

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2990088156|2990089242
Length 248
Sequence PRRRTAPPLPRATDREGLLPFMTTRVIIVDDQAMVRAGFAALLSAQSDIDVVGEAPDGAQGVDLCRRTHPDVVLMDVRMPEMDGLEAARKLLDPGSAGGSAHRPRVLMLTTFDVDDYVYEALRAGASGFLLKDAPPADLIAAVRIVAEGEALLAPSVTRRLIADFARQRPAPRASRNLQLNGLTDRETEVLELLARGRSNSEIADSLVLAEQTVKTHVSRIFTKLRLRDRAQAVIFAYESGLISPGEG

Samples

Sample ID Description Type Environment
1 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
2 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
3 2547132424 Nocardia nova SH22a Isolate Unclassified
4 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
5 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
6 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
7 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
8 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
9 2643221549 Agromyces sp. Root1464 Isolate Unclassified
10 2643221553 Microbacterium sp. Root553 Isolate Unclassified
11 2643221578 Streptomyces sp. Root63 Isolate Unclassified
12 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
13 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
14 2643221619 Agromyces sp. Root81 Isolate Unclassified
15 2643221630 Microbacterium sp. Root322 Isolate Unclassified
16 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
17 2643221670 Streptomyces sp. Root431 Isolate Unclassified
18 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
19 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
20 2643221692 Nocardia sp. Root136 Isolate Unclassified
21 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
22 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
23 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
24 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
25 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
26 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
27 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
28 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
29 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
30 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
31 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
32 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
33 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
34 2808606372 Agromyces sp. 23-23 Isolate Unclassified
35 2808606448 Streptomyces sp. 193411 Isolate Unclassified
36 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
37 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
38 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
39 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
40 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
41 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
42 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
43 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
44 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
45 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
46 2862574272 Streptomyces sp. AcE210 Isolate Nodule
47 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
48 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
49 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
50 2867475112 Streptomyces sp. TM32 Isolate Unclassified
51 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
52 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
53 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
54 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
55 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
56 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
57 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
58 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
59 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
60 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
61 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
62 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
63 2922554459 Rhodococcus sp. 66b Isolate Unclassified
64 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
65 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
66 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
67 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
68 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
69 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
70 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
71 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
72 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
73 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
74 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
75 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
76 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
77 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
78 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
79 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
80 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
81 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
83 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
84 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
85 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
86 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
87 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
88 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
89 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
90 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
91 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
92 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
93 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
94 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
95 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
96 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
107 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
121 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
122 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
123 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
124 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
125 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
126 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
127 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
128 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
129 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
130 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
133 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
134 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
135 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
136 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
142 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
143 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
144 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
145 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
146 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
147 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
148 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
149 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
150 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
151 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
152 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
153 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
154 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
155 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
156 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
157 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
158 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
159 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
160 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
161 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
162 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
163 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
164 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
165 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
166 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
167 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
168 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
169 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
170 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
171 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
172 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
173 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
174 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
175 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
176 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
177 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
178 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
179 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
180 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
181 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
182 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
183 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
184 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
185 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
186 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
187 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
188 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
189 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
190 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
191 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
192 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
193 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
194 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
195 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
196 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
197 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
198 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
199 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
200 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
201 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
202 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
203 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
204 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
205 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
206 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
207 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
208 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
209 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
210 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
211 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
212 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
213 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
216 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
217 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
218 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
219 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
220 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
221 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
222 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
223 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
224 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
225 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
226 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
227 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
228 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
229 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
230 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
243 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
244 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
245 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
246 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
247 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
250 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
251 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
252 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
253 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
254 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
255 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
256 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
257 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
258 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
259 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
260 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
261 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
262 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
263 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
264 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
265 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
266 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
267 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
268 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
269 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
270 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
271 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 73.76
Metatranscriptomes 0
Isolates 26.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.25
Nodule 0.28
Rhizoplane 1.66
Rhizosphere 68.78
Stem 0
Stem Tuber 0
Unclassified 24.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1001514 3300002738 Bacteria 8109
2 JGI25406J46586_10001416 3300003203 Bacteria 11321
3 Ga0070658_10249360 3300005327 Bacteria 1506
4 Ga0070668_100000538 3300005347 Bacteria 25255
5 Ga0070668_100096384 3300005347 Bacteria 2338
6 Ga0070709_10010598 3300005434 Bacteria 5109
7 Ga0070714_100039420 3300005435 Bacteria 3977
8 Ga0070713_100150897 3300005436 Bacteria 2067
9 Ga0070711_100032502 3300005439 Bacteria 3469
10 Ga0070663_100151601 3300005455 Bacteria 1778
11 Ga0068853_100086233 3300005539 Bacteria 2753
12 Ga0068855_100064295 3300005563 Bacteria 4279
13 Ga0068870_10077915 3300005840 Bacteria 1824
14 Ga0081539_10000301 3300005985 Bacteria 111476
15 Ga0075363_100038549 3300006048 Bacteria 2514
16 Ga0075363_100127890 3300006048 Bacteria 1423
17 Ga0075364_10027186 3300006051 Bacteria 3653
18 Ga0075364_10172956 3300006051 Bacteria 1460
19 Ga0075364_10248552 3300006051 Bacteria 1209
20 Ga0070712_100015525 3300006175 Bacteria 4910
21 Ga0075370_10024790 3300006353 Bacteria 3316
22 Ga0075370_10239973 3300006353 Bacteria 1073
23 Ga0105243_10134350 3300009148 Bacteria 2103
24 Ga0105243_10399043 3300009148 Bacteria 1277
25 Ga0105248_10050547 3300009177 Bacteria 4663
26 Ga0105246_10101964 3300011119 Bacteria 2091
27 Ga0157369_10019540 3300013105 Bacteria 7580
28 Ga0171462_1003 3300013250 Bacteria 853796
29 Ga0163162_10010162 3300013306 Bacteria 9143
30 Ga0157375_10656598 3300013308 Bacteria 1205
31 Ga0157380_10071864 3300014326 Bacteria 2800
32 Ga0163161_10283429 3300017792 Bacteria 1300
33 Ga0209646_1000071 3300025246 Bacteria 228702
34 Ga0207426_1002223 3300025302 Bacteria 12988
35 Ga0207426_1002269 3300025302 Bacteria 12687
36 Ga0207426_1007175 3300025302 Bacteria 4705
37 Ga0207692_10037772 3300025898 Bacteria 2364
38 Ga0207699_10009377 3300025906 Bacteria 4871
39 Ga0207693_10011314 3300025915 Bacteria 7224
40 Ga0207663_10026056 3300025916 Bacteria 3389
41 Ga0207700_10132561 3300025928 Bacteria 2037
42 Ga0207664_10029177 3300025929 Bacteria 4200
43 Ga0207709_10077450 3300025935 Bacteria 2131
44 Ga0207709_10460548 3300025935 Bacteria 985
45 Ga0207665_10024887 3300025939 Bacteria 3948
46 Ga0207711_10015846 3300025941 Bacteria 6254
47 Ga0207667_10049323 3300025949 Bacteria 4446
48 Ga0207639_10087411 3300026041 Bacteria 2485
49 Ga0207674_10482125 3300026116 Bacteria 1199
50 Ga0307515_10123442 3300028794 Bacteria 2913
51 Ga0307512_10022520 3300030522 Bacteria 5658
52 Ga0316177_1000768 3300030731 Bacteria 1304
53 Ga0314311_1209641 3300030733 Bacteria 1099
54 Ga0265327_10000018 3300031251 Bacteria 439197
55 Ga0307513_10000209 3300031456 Bacteria 84521
56 Ga0307508_10033750 3300031616 Bacteria 4617
57 Ga0307508_10049385 3300031616 Bacteria 3747
58 Ga0307514_10011042 3300031649 Bacteria 7527
59 Ga0307514_10052063 3300031649 Bacteria 3168
60 Ga0316576_10255785 3300031727 Bacteria 1314
61 Ga0316578_10035416 3300031728 Bacteria 2870
62 Ga0307516_10156001 3300031730 Bacteria 2038
63 Ga0307405_10204827 3300031731 Bacteria 1436
64 Ga0307413_10085488 3300031824 Bacteria 2037
65 Ga0307413_10123408 3300031824 Bacteria 1759
66 Ga0307413_10172640 3300031824 Bacteria 1532
67 Ga0307410_10033372 3300031852 Bacteria 3323
68 Ga0307406_10000186 3300031901 Bacteria 37012
69 Ga0307406_10004232 3300031901 Bacteria 7805
70 Ga0307406_10387897 3300031901 Bacteria 1103
71 Ga0307407_10318351 3300031903 Bacteria 1091
72 Ga0307407_10549925 3300031903 Bacteria 853
73 Ga0307412_10194251 3300031911 Bacteria 1537
74 Ga0307412_10320079 3300031911 Bacteria 1234
75 Ga0307409_100271114 3300031995 Bacteria 1563
76 Ga0307416_100109114 3300032002 Bacteria 2433
77 Ga0307416_100255484 3300032002 Bacteria 1709
78 Ga0307414_10047789 3300032004 Bacteria 2948
79 Ga0307414_10085052 3300032004 Bacteria 2329
80 Ga0307414_10887084 3300032004 Bacteria 817
81 Ga0307411_10086133 3300032005 Bacteria 2179
82 Ga0307411_10581534 3300032005 Bacteria 960
83 Ga0307415_100311057 3300032126 Bacteria 1309
84 Ga0307415_100570149 3300032126 Bacteria 1002
85 Ga0316584_0204294 3300036712 Bacteria 1456
86 Ga0316584_0233921 3300036712 Bacteria 1346
87 Ga0439436_0113873 3300041404 Bacteria 755
88 Ga0439461_0005702 3300041410 Bacteria 2137
89 Ga0439466_0044537 3300041411 Bacteria 1469
90 Ga0439466_0045497 3300041411 Bacteria 1451
91 Ga0439465_0009666 3300041413 Bacteria 3038
92 Ga0451837_1604259 3300041494 Bacteria 2051
93 Ga0451841_1228916 3300041498 Bacteria 1827
94 Ga0451853_0427946 3300041512 Bacteria 5269
95 Ga0451853_2011437 3300041512 Bacteria 1775
96 Ga0451853_2447084 3300041512 Bacteria 1175
97 Ga0439431_0006320 3300041997 Bacteria 2617
98 Ga0439445_0003733 3300042004 Bacteria 3420
99 Ga0439445_0012081 3300042004 Bacteria 2069
100 Ga0450894_000025 3300042131 Bacteria 21540
101 Ga0450899_002559 3300042135 Bacteria 1962
102 Ga0450906_001225 3300042145 Bacteria 5666
103 Ga0439458_0034069 3300042157 Bacteria 1221
104 Ga0439434_0038280 3300042435 Bacteria 1469
105 Ga0466969_0003499 3300044656 Bacteria 8336
106 Ga0466972_0001339 3300044658 Bacteria 11933
107 Ga0466966_0009770 3300044684 Bacteria 6359
108 Ga0466961_0042364 3300044693 Bacteria 2918
109 Ga0466961_0065616 3300044693 Bacteria 2307
110 Ga0466968_0001375 3300044735 Bacteria 8700
111 Ga0466970_0065141 3300044765 Bacteria 1955
112 Ga0466959_0127269 3300045049 Bacteria 1807
113 Ga0466959_0174058 3300045049 Bacteria 1508
114 Ga0466959_0325389 3300045049 Bacteria 1050
115 Ga0466958_0198318 3300045836 Bacteria 1277
116 Ga0495617_011520 3300046452 Bacteria 3016
117 Ga0495617_134566 3300046452 Bacteria 791
118 Ga0495627_000896 3300046453 Bacteria 20918
119 Ga0495603_0001858 3300046455 Bacteria 12437
120 Ga0495603_0013958 3300046455 Bacteria 4857
121 Ga0495629_0003234 3300046459 Bacteria 12340
122 Ga0495629_0173527 3300046459 Bacteria 1495
123 Ga0495638_0372794 3300046460 Bacteria 748
124 Ga0495641_0040752 3300046461 Bacteria 2159
125 Ga0495582_0031643 3300046473 Bacteria 2909
126 Ga0495605_0001273 3300046474 Bacteria 16702
127 Ga0495605_0088753 3300046474 Bacteria 1436
128 Ga0495639_0125856 3300046475 Bacteria 1225
129 Ga0495584_0024254 3300046491 Bacteria 3076
130 Ga0495585_0014744 3300046492 Bacteria 4546
131 Ga0495585_0116665 3300046492 Bacteria 1415
132 Ga0495585_0236785 3300046492 Bacteria 915
133 Ga0495594_0024856 3300046499 Bacteria 3220
134 Ga0495594_0031444 3300046499 Bacteria 2877
135 Ga0495607_0128389 3300046501 Bacteria 1322
136 Ga0495583_0062518 3300046506 Bacteria 1657
137 Ga0495606_0003756 3300046507 Bacteria 15803
138 Ga0495610_0018258 3300046512 Bacteria 3967
139 Ga0495616_0003184 3300046513 Bacteria 10583
140 Ga0495620_0013370 3300046515 Bacteria 4203
141 Ga0495620_0020728 3300046515 Bacteria 3206
142 Ga0495631_0001857 3300046518 Bacteria 12478
143 Ga0495632_0070071 3300046519 Bacteria 1687
144 Ga0495648_0025851 3300046524 Bacteria 3965
145 Ga0495666_0000670 3300046526 Bacteria 15493
146 Ga0495640_0108544 3300046533 Bacteria 1815
147 Ga0495609_0126433 3300046538 Bacteria 1097
148 Ga0495597_0002113 3300046542 Bacteria 13167
149 Ga0495622_0048079 3300046557 Bacteria 1982
150 Ga0495633_0038179 3300046558 Bacteria 2295
151 Ga0495668_0002532 3300046616 Bacteria 14898
152 Ga0495668_0008011 3300046616 Bacteria 6657
153 Ga0495634_0039164 3300046642 Bacteria 3229
154 Ga0495625_0066822 3300046660 Bacteria 2532
155 Ga0495625_0073435 3300046660 Bacteria 2397
156 Ga0495661_0027290 3300046665 Bacteria 3667
157 Ga0495658_0075706 3300046683 Bacteria 1965
158 Ga0495613_0000689 3300046689 Bacteria 26707
159 Ga0495613_0030429 3300046689 Bacteria 4010
160 Ga0495613_0091412 3300046689 Bacteria 2204
161 Ga0495613_0130039 3300046689 Bacteria 1803
162 Ga0495670_0034904 3300046691 Bacteria 2506
163 Ga0495671_0293590 3300046692 Bacteria 782
164 Ga0495589_0000944 3300046794 Bacteria 17813
165 Ga0495589_0014763 3300046794 Bacteria 4019
166 Ga0495589_0040926 3300046794 Bacteria 2312
167 Ga0495660_0023956 3300046810 Bacteria 3478
168 Ga0495660_0078916 3300046810 Bacteria 1729
169 Ga0495581_0085294 3300047315 Bacteria 1830
170 Ga0495636_0064341 3300047318 Bacteria 1556
171 Ga0495672_0199111 3300047320 Bacteria 1003
172 Ga0495676_0001253 3300047321 Bacteria 21780
173 Ga0495676_0002844 3300047321 Bacteria 15596
174 Ga0495676_0022395 3300047321 Bacteria 5496
175 Ga0495683_0053000 3300047323 Bacteria 2023
176 Ga0495683_0143521 3300047323 Bacteria 1117
177 Ga0495687_020377 3300047443 Bacteria 3231
178 Ga0495687_063320 3300047443 Bacteria 1514
179 Ga0495677_0185117 3300047445 Bacteria 808
180 Ga0495685_001656 3300047447 Bacteria 6871
181 Ga0495685_002921 3300047447 Bacteria 5406
182 Ga0495685_003985 3300047447 Bacteria 4746
183 Ga0495685_023068 3300047447 Bacteria 2141
184 Ga0495685_097046 3300047447 Bacteria 974
185 Ga0495686_0015207 3300047472 Bacteria 5266
186 Ga0495593_0051463 3300047673 Bacteria 2179
187 Ga0495614_0000585 3300048089 Bacteria 15189
188 Ga0495614_0001241 3300048089 Bacteria 10972
189 Ga0495626_0009254 3300048091 Bacteria 5331
190 Ga0496102_0144085 3300048905 Bacteria 2235
191 Ga0496108_0061247 3300048911 Bacteria 3166
192 Ga0496113_0066370 3300048916 Bacteria 2733
193 Ga0496114_0073517 3300048917 Bacteria 2877
194 Ga0496114_0154201 3300048917 Bacteria 1994
195 Ga0496116_0086867 3300048919 Bacteria 1916
196 Ga0496117_0002993 3300048920 Bacteria 20350
197 Ga0496118_0011693 3300048921 Bacteria 8531
198 Ga0496118_0109171 3300048921 Bacteria 1842
199 Ga0496119_0006517 3300048922 Bacteria 10774
200 Ga0496119_0026124 3300048922 Bacteria 4057
201 Ga0496120_0001029 3300048923 Bacteria 37294
202 Ga0496120_0022674 3300048923 Bacteria 3947
203 Ga0496121_0452194 3300048924 Bacteria 827
204 Ga0496122_0000071 3300048925 Bacteria 222537
205 Ga0496122_0082125 3300048925 Bacteria 2240
206 Ga0496122_0147142 3300048925 Bacteria 1462
207 Ga0496123_0000006 3300048926 Bacteria 647258
208 Ga0496124_0006427 3300048927 Bacteria 12812
209 Ga0496124_0076566 3300048927 Bacteria 2761
210 Ga0496125_0004742 3300048928 Bacteria 15494
211 Ga0496125_0014945 3300048928 Bacteria 7538
212 Ga0496125_0017407 3300048928 Bacteria 6852
213 Ga0496125_0047268 3300048928 Bacteria 3601
214 Ga0496125_0071556 3300048928 Bacteria 2708
215 Ga0496126_0005581 3300048929 Bacteria 14314
216 Ga0496126_0312224 3300048929 Bacteria 1294
217 Ga0496126_0504708 3300048929 Bacteria 966
218 Ga0495678_034377 3300049459 Bacteria 2086
219 Ga0501031_0003784 3300049568 Bacteria 9738
220 Ga0501032_0004546 3300049569 Bacteria 10437
221 Ga0501032_0254263 3300049569 Bacteria 1140
222 Ga0501033_0039025 3300049570 Bacteria 3547
223 Ga0501033_0046997 3300049570 Bacteria 3210
224 Ga0501033_0058168 3300049570 Bacteria 2856
225 Ga0501034_0002190 3300049571 Bacteria 24184
226 Ga0501034_0485682 3300049571 Bacteria 1150
227 Ga0501034_0897654 3300049571 Bacteria 774
228 Ga0501036_0019710 3300049572 Bacteria 5663
229 Ga0501037_0005388 3300049573 Bacteria 9313
230 Ga0501037_0163807 3300049573 Bacteria 1584
231 Ga0501037_0309050 3300049573 Bacteria 1096
232 Ga0501038_0001296 3300049574 Bacteria 22769
233 Ga0501038_0070866 3300049574 Bacteria 2958
234 Ga0501038_0118275 3300049574 Bacteria 2188
235 Ga0501042_0022823 3300049578 Bacteria 4372
236 Ga0501042_0025439 3300049578 Bacteria 4158
237 Ga0501043_0007412 3300049579 Bacteria 8705
238 Ga0501043_0221812 3300049579 Bacteria 1462
239 Ga0501046_0019689 3300049580 Bacteria 5593
240 Ga0501047_0011825 3300049581 Bacteria 8255
241 Ga0501047_0078921 3300049581 Bacteria 3165
242 Ga0501047_0108740 3300049581 Bacteria 2655
243 Ga0501048_0007309 3300049582 Bacteria 8372
244 Ga0501069_0587916 3300049585 Bacteria 668
245 Ga0501070_0000473 3300049586 Bacteria 36519
246 Ga0501070_0130781 3300049586 Bacteria 2074
247 Ga0501073_0024661 3300049589 Bacteria 4319
248 Ga0501080_0240841 3300049742 Bacteria 1651
249 Ga0501080_0517251 3300049742 Bacteria 1065
250 Ga0501083_0000229 3300049744 Bacteria 35953
251 Ga0501083_0038761 3300049744 Bacteria 3238
252 Ga0501035_0034685 3300049822 Bacteria 4583
253 Ga0501035_0067684 3300049822 Bacteria 3168
254 Ga0501044_0007278 3300049823 Bacteria 12163
255 Ga0501044_0064347 3300049823 Bacteria 3744
256 Ga0501044_0204507 3300049823 Bacteria 1931
257 Ga0501044_0874250 3300049823 Bacteria 775
258 Ga0501045_0178342 3300049824 Bacteria 1583
259 nmdc:mga00v17_121934_c1 3300050491 Bacteria 1660
260 nmdc:mga00v17_151765_c1 3300050491 Bacteria 1489
261 nmdc:mga00v17_2315_c2 3300050491 Bacteria 3684
262 nmdc:mga07m45_326775_c1 3300050496 Bacteria 891
263 Ga0500553_033411 3300053101 Bacteria 2560
264 Ga0500568_0000041 3300053139 Bacteria 130271
265 Ga0500568_0049769 3300053139 Bacteria 1653
266 Ga0500600_0099755 3300053149 Bacteria 1534
267 Ga0500616_0000972 3300053153 Bacteria 30963

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300030733 Ga0314311_1209641 Ga0314311_12096412 190
2 3300041494 Ga0451837_1604259 Ga0451837_1604259_1422_2027 197
3 3300005347 Ga0070668_100096384 Ga0070668_1000963842 198
4 3300049570 Ga0501033_0058168 Ga0501033_0058168_595_1296 201
5 3300005539 Ga0068853_100086233 Ga0068853_1000862333 207
6 3300026041 Ga0207639_10087411 Ga0207639_100874113 207
7 3300032004 Ga0307414_10887084 Ga0307414_108870841 207
8 3300046459 Ga0495629_0173527 Ga0495629_0173527_35_676 207
9 3300046499 Ga0495594_0031444 Ga0495594_0031444_35_676 207
10 3300046515 Ga0495620_0013370 Ga0495620_0013370_35_676 207
11 3300046616 Ga0495668_0008011 Ga0495668_0008011_4843_5469 207
12 3300048911 Ga0496108_0061247 Ga0496108_0061247_1261_1887 207
13 3300048925 Ga0496122_0147142 Ga0496122_0147142_30_656 207
14 3300048928 Ga0496125_0014945 Ga0496125_0014945_2263_2889 207
15 3300049578 Ga0501042_0022823 Ga0501042_0022823_1623_2309 207
16 3300045836 Ga0466958_0198318 Ga0466958_0198318_632_1258 208
17 3300049585 Ga0501069_0587916 Ga0501069_0587916_13_648 208
18 iso_pu_bacteria 2867346516 2867347087 208
19 3300048928 Ga0496125_0017407 Ga0496125_0017407_2725_3396 209
20 3300048929 Ga0496126_0312224 Ga0496126_0312224_97_768 209
21 iso_pu_bacteria 2738541272 2738696945 210
22 iso_pu_bacteria 2738543027 2739324121 210
23 iso_pu_bacteria 2758568522 2760305133 210
24 iso_pu_bacteria 2758568621 2760621059 210
25 3300005563 Ga0068855_100064295 Ga0068855_1000642952 211
26 3300025949 Ga0207667_10049323 Ga0207667_100493235 211
27 3300031824 Ga0307413_10085488 Ga0307413_100854883 211
28 iso_pu_bacteria 8003314358 8003321549 211
29 3300049744 Ga0501083_0000229 Ga0501083_0000229_28343_29014 212
30 3300049823 Ga0501044_0874250 Ga0501044_0874250_68_763 212
31 iso_pu_bacteria 2751185725 2753038371 212
32 iso_pu_bacteria 2751185792 2753326882 212
33 iso_pu_bacteria 2929212328 2929214736 212
34 3300003203 JGI25406J46586_10001416 JGI25406J46586_1000141610 213
35 3300005985 Ga0081539_10000301 Ga0081539_1000030176 213
36 iso_pu_bacteria 2818991472 2819742245 213
37 iso_pu_bacteria 2842888712 2842888981 213
38 3300006353 Ga0075370_10239973 Ga0075370_102399732 214
39 3300017792 Ga0163161_10283429 Ga0163161_102834292 214
40 3300030731 Ga0316177_1000768 Ga0316177_10007682 214
41 3300047445 Ga0495677_0185117 Ga0495677_0185117_24_692 214
42 3300050496 nmdc:mga07m45_326775_c1 nmdc:mga07m45_326775_c1_17_688 214
43 3300053139 Ga0500568_0049769 Ga0500568_0049769_389_1039 214
44 3300053149 Ga0500600_0099755 Ga0500600_0099755_430_1080 214
45 iso_pu_bacteria 2547132424 2548697991 214
46 iso_pu_bacteria 2919713450 2919715823 214
47 3300005347 Ga0070668_100000538 Ga0070668_1000005388 215
48 iso_pu_bacteria 2515154155 2515854604 215
49 iso_pu_bacteria 2565956761 2566993144 215
50 iso_pu_bacteria 2738543034 2739362269 215
51 iso_pu_bacteria 2873151551 2873156756 215
52 iso_pu_bacteria 2902810491 2902817048 215
53 iso_pu_bacteria 2904535858 2904538862 215
54 iso_pu_bacteria 2904765812 2904770171 215
55 iso_pu_bacteria 2908811453 2908815022 215
56 iso_pu_bacteria 2922554459 2922556841 215
57 3300026116 Ga0207674_10482125 Ga0207674_104821252 216
58 3300031251 Ga0265327_10000018 Ga0265327_1000001883 216
59 3300031727 Ga0316576_10255785 Ga0316576_102557852 216
60 3300031728 Ga0316578_10035416 Ga0316578_100354162 216
61 3300031903 Ga0307407_10549925 Ga0307407_105499252 216
62 3300032005 Ga0307411_10086133 Ga0307411_100861332 216
63 3300032005 Ga0307411_10581534 Ga0307411_105815342 216
64 3300032126 Ga0307415_100311057 Ga0307415_1003110571 216
65 3300036712 Ga0316584_0204294 Ga0316584_0204294_732_1400 216
66 3300036712 Ga0316584_0233921 Ga0316584_0233921_100_768 216
67 3300041512 Ga0451853_2011437 Ga0451853_2011437_319_981 216
68 3300044693 Ga0466961_0065616 Ga0466961_0065616_933_1646 216
69 3300045049 Ga0466959_0127269 Ga0466959_0127269_726_1457 216
70 3300045049 Ga0466959_0174058 Ga0466959_0174058_794_1492 216
71 3300049744 Ga0501083_0038761 Ga0501083_0038761_1563_2321 216
72 iso_pu_bacteria 2551306166 2552109674 216
73 iso_pu_bacteria 2643221692 2644513154 216
74 iso_pu_bacteria 8056667051 8056673407 216
75 3300005434 Ga0070709_10010598 Ga0070709_100105982 217
76 3300005435 Ga0070714_100039420 Ga0070714_1000394202 217
77 3300005436 Ga0070713_100150897 Ga0070713_1001508972 217
78 3300005439 Ga0070711_100032502 Ga0070711_1000325021 217
79 3300006175 Ga0070712_100015525 Ga0070712_1000155252 217
80 3300013306 Ga0163162_10010162 Ga0163162_100101626 217
81 3300025898 Ga0207692_10037772 Ga0207692_100377721 217
82 3300025906 Ga0207699_10009377 Ga0207699_100093775 217
83 3300025915 Ga0207693_10011314 Ga0207693_100113142 217
84 3300025916 Ga0207663_10026056 Ga0207663_100260561 217
85 3300025928 Ga0207700_10132561 Ga0207700_101325612 217
86 3300025929 Ga0207664_10029177 Ga0207664_100291775 217
87 3300025939 Ga0207665_10024887 Ga0207665_100248872 217
88 3300041410 Ga0439461_0005702 Ga0439461_0005702_278_943 217
89 3300041411 Ga0439466_0044537 Ga0439466_0044537_655_1320 217
90 3300041411 Ga0439466_0045497 Ga0439466_0045497_655_1314 217
91 3300041413 Ga0439465_0009666 Ga0439465_0009666_2240_2899 217
92 3300041997 Ga0439431_0006320 Ga0439431_0006320_980_1645 217
93 3300042004 Ga0439445_0003733 Ga0439445_0003733_2403_3068 217
94 3300042004 Ga0439445_0012081 Ga0439445_0012081_290_949 217
95 3300042435 Ga0439434_0038280 Ga0439434_0038280_353_1018 217
96 iso_pu_bacteria 2547132111 2547409944 217
97 iso_pu_bacteria 2554235005 2554258751 217
98 iso_pu_bacteria 2616644941 2616899738 217
99 iso_pu_bacteria 2643221578 2643897650 217
100 iso_pu_bacteria 2643221587 2643944880 217
101 iso_pu_bacteria 2643221601 2644018864 217
102 iso_pu_bacteria 2643221631 2644179999 217
103 iso_pu_bacteria 2643221670 2644385171 217
104 iso_pu_bacteria 2643221673 2644408796 217
105 iso_pu_bacteria 2643221677 2644431779 217
106 iso_pu_bacteria 2784132148 2784589173 217
107 iso_pu_bacteria 2791355406 2793982050 217
108 iso_pu_bacteria 2808606448 2809232781 217
109 iso_pu_bacteria 2811994917 2812476747 217
110 iso_pu_bacteria 2818991463 2819693847 217
111 iso_pu_bacteria 2862178590 2862182680 217
112 iso_pu_bacteria 2862290372 2862295886 217
113 iso_pu_bacteria 2862574272 2862582606 217
114 iso_pu_bacteria 2862705112 2862710015 217
115 iso_pu_bacteria 2863404153 2863408705 217
116 iso_pu_bacteria 2867475112 2867479611 217
117 iso_pu_bacteria 2875391855 2875393601 217
118 iso_pu_bacteria 2891554331 2891558340 217
119 iso_pu_bacteria 2912757875 2912759766 217
120 iso_pu_bacteria 2918501144 2918503628 217
121 iso_pu_bacteria 2939582691 2939586628 217
122 iso_pu_bacteria 2946045630 2946051082 217
123 iso_pu_bacteria 2947224130 2947226300 217
124 iso_pu_bacteria 2966598605 2966603475 217
125 iso_pu_bacteria 2997451912 2997456354 217
126 iso_pu_bacteria 2997600082 2997602203 217
127 iso_pu_bacteria 3006486233 3006491092 217
128 iso_pu_bacteria 8023623736 8023631659 217
129 iso_pu_bacteria 8025478263 8025481314 217
130 iso_pu_bacteria 8025530807 8025531158 217
131 iso_pu_bacteria 8047893842 8047899236 217
132 iso_pu_bacteria 8048127548 8048129464 217
133 iso_pu_bacteria 8048356638 8048359683 217
134 iso_pu_bacteria 8048369669 8048376198 217
135 iso_pu_bacteria 8048379754 8048385257 217
136 iso_pu_bacteria 8054160619 8054164953 217
137 iso_pu_bacteria 8056447290 8056449452 217
138 3300009177 Ga0105248_10050547 Ga0105248_100505475 218
139 3300025941 Ga0207711_10015846 Ga0207711_100158466 218
140 3300047320 Ga0495672_0199111 Ga0495672_0199111_265_933 218
141 iso_pu_bacteria 2643221724 2644680384 218
142 iso_pu_bacteria 2728369380 2730229837 218
143 iso_pu_bacteria 2852646457 2852647463 218
144 iso_pu_bacteria 2857723135 2857724013 218
145 iso_pu_bacteria 2857729791 2857731192 218
146 iso_pu_bacteria 2928121344 2928122250 218
147 iso_pu_bacteria 2945968032 2945971977 218
148 iso_pu_bacteria 2946033335 2946033645 218
149 3300006048 Ga0075363_100038549 Ga0075363_1000385492 219
150 3300006048 Ga0075363_100127890 Ga0075363_1001278902 219
151 3300006353 Ga0075370_10024790 Ga0075370_100247902 219
152 3300031456 Ga0307513_10000209 Ga0307513_100002091 219
153 3300031649 Ga0307514_10011042 Ga0307514_100110422 219
154 3300031730 Ga0307516_10156001 Ga0307516_101560012 219
155 3300031731 Ga0307405_10204827 Ga0307405_102048272 219
156 3300031824 Ga0307413_10172640 Ga0307413_101726401 219
157 3300032126 Ga0307415_100570149 Ga0307415_1005701492 219
158 3300041512 Ga0451853_2447084 Ga0451853_2447084_38_715 219
159 3300046452 Ga0495617_011520 Ga0495617_011520_299_976 219
160 3300046455 Ga0495603_0013958 Ga0495603_0013958_2091_2768 219
161 3300046461 Ga0495641_0040752 Ga0495641_0040752_1110_1787 219
162 3300046473 Ga0495582_0031643 Ga0495582_0031643_1263_1940 219
163 3300046474 Ga0495605_0001273 Ga0495605_0001273_3453_4130 219
164 3300046475 Ga0495639_0125856 Ga0495639_0125856_469_1146 219
165 3300046491 Ga0495584_0024254 Ga0495584_0024254_401_1078 219
166 3300046492 Ga0495585_0014744 Ga0495585_0014744_1756_2433 219
167 3300046492 Ga0495585_0116665 Ga0495585_0116665_492_1169 219
168 3300046501 Ga0495607_0128389 Ga0495607_0128389_421_1098 219
169 3300046506 Ga0495583_0062518 Ga0495583_0062518_370_1047 219
170 3300046507 Ga0495606_0003756 Ga0495606_0003756_2938_3615 219
171 3300046512 Ga0495610_0018258 Ga0495610_0018258_1295_1972 219
172 3300046513 Ga0495616_0003184 Ga0495616_0003184_1121_1798 219
173 3300046518 Ga0495631_0001857 Ga0495631_0001857_2058_2735 219
174 3300046519 Ga0495632_0070071 Ga0495632_0070071_455_1132 219
175 3300046524 Ga0495648_0025851 Ga0495648_0025851_723_1400 219
176 3300046526 Ga0495666_0000670 Ga0495666_0000670_2202_2879 219
177 3300046533 Ga0495640_0108544 Ga0495640_0108544_421_1098 219
178 3300046538 Ga0495609_0126433 Ga0495609_0126433_343_1020 219
179 3300046542 Ga0495597_0002113 Ga0495597_0002113_3120_3797 219
180 3300046557 Ga0495622_0048079 Ga0495622_0048079_23_700 219
181 3300046558 Ga0495633_0038179 Ga0495633_0038179_1241_1918 219
182 3300046616 Ga0495668_0002532 Ga0495668_0002532_2996_3673 219
183 3300046642 Ga0495634_0039164 Ga0495634_0039164_1588_2265 219
184 3300046660 Ga0495625_0073435 Ga0495625_0073435_353_1030 219
185 3300046665 Ga0495661_0027290 Ga0495661_0027290_1805_2482 219
186 3300046683 Ga0495658_0075706 Ga0495658_0075706_797_1474 219
187 3300046689 Ga0495613_0030429 Ga0495613_0030429_547_1224 219
188 3300046689 Ga0495613_0130039 Ga0495613_0130039_773_1450 219
189 3300046794 Ga0495589_0000944 Ga0495589_0000944_17102_17779 219
190 3300046810 Ga0495660_0023956 Ga0495660_0023956_275_952 219
191 3300046810 Ga0495660_0078916 Ga0495660_0078916_276_953 219
192 3300047315 Ga0495581_0085294 Ga0495581_0085294_135_812 219
193 3300047321 Ga0495676_0001253 Ga0495676_0001253_4552_5229 219
194 3300047323 Ga0495683_0053000 Ga0495683_0053000_496_1173 219
195 3300047443 Ga0495687_020377 Ga0495687_020377_2202_2879 219
196 3300047443 Ga0495687_063320 Ga0495687_063320_485_1162 219
197 3300047447 Ga0495685_001656 Ga0495685_001656_177_854 219
198 3300047447 Ga0495685_023068 Ga0495685_023068_1450_2127 219
199 3300047472 Ga0495686_0015207 Ga0495686_0015207_2104_2781 219
200 3300048089 Ga0495614_0001241 Ga0495614_0001241_2123_2800 219
201 3300048091 Ga0495626_0009254 Ga0495626_0009254_4058_4735 219
202 3300049459 Ga0495678_034377 Ga0495678_034377_1058_1735 219
203 3300049570 Ga0501033_0046997 Ga0501033_0046997_1018_1776 219
204 3300053101 Ga0500553_033411 Ga0500553_033411_1048_1725 219
205 iso_pu_bacteria 2643221542 2643733537 219
206 iso_pu_bacteria 2643221549 2643768990 219
207 iso_pu_bacteria 2643221553 2643785969 219
208 iso_pu_bacteria 2643221619 2644112416 219
209 iso_pu_bacteria 2643221630 2644170112 219
210 iso_pu_bacteria 2721755702 2723640747 219
211 iso_pu_bacteria 2747842429 2747952055 219
212 iso_pu_bacteria 2808606372 2808900538 219
213 iso_pu_bacteria 2852663356 2852665389 219
214 iso_pu_bacteria 2919443155 2919445120 219
215 iso_pu_bacteria 2935409751 2935410221 219
216 iso_pu_bacteria 2946041624 2946044348 219
217 iso_pu_bacteria 2946080515 2946080805 219
218 iso_pu_bacteria 3006493962 3006500422 219
219 iso_pu_bacteria 8004182704 8004185041 219
220 iso_pu_bacteria 8033684223 8033684675 219
221 iso_pu_bacteria 8045830549 8045830970 219
222 iso_pu_bacteria 8056207758 8056212977 219
223 3300005327 Ga0070658_10249360 Ga0070658_102493601 221
224 3300025302 Ga0207426_1002223 Ga0207426_10022239 221
225 3300025302 Ga0207426_1002269 Ga0207426_10022695 221
226 3300025302 Ga0207426_1007175 Ga0207426_10071756 221
227 3300028794 Ga0307515_10123442 Ga0307515_101234422 221
228 3300030522 Ga0307512_10022520 Ga0307512_100225204 221
229 3300031616 Ga0307508_10033750 Ga0307508_100337503 221
230 3300031616 Ga0307508_10049385 Ga0307508_100493851 221
231 3300031649 Ga0307514_10052063 Ga0307514_100520633 221
232 3300031852 Ga0307410_10033372 Ga0307410_100333722 221
233 3300032002 Ga0307416_100109114 Ga0307416_1001091141 221
234 3300041404 Ga0439436_0113873 Ga0439436_0113873_22_696 221
235 3300041512 Ga0451853_0427946 Ga0451853_0427946_4000_4689 221
236 3300042131 Ga0450894_000025 Ga0450894_000025_10360_11034 221
237 3300042135 Ga0450899_002559 Ga0450899_002559_1219_1893 221
238 3300042145 Ga0450906_001225 Ga0450906_001225_1901_2575 221
239 3300042157 Ga0439458_0034069 Ga0439458_0034069_147_863 221
240 3300044656 Ga0466969_0003499 Ga0466969_0003499_1504_2178 221
241 3300044658 Ga0466972_0001339 Ga0466972_0001339_7619_8293 221
242 3300044684 Ga0466966_0009770 Ga0466966_0009770_3585_4259 221
243 3300044693 Ga0466961_0042364 Ga0466961_0042364_767_1441 221
244 3300044735 Ga0466968_0001375 Ga0466968_0001375_7630_8304 221
245 3300045049 Ga0466959_0325389 Ga0466959_0325389_34_708 221
246 3300046452 Ga0495617_134566 Ga0495617_134566_67_744 221
247 3300046455 Ga0495603_0001858 Ga0495603_0001858_6012_6704 221
248 3300046459 Ga0495629_0003234 Ga0495629_0003234_9343_10035 221
249 3300046460 Ga0495638_0372794 Ga0495638_0372794_40_717 221
250 3300046474 Ga0495605_0088753 Ga0495605_0088753_743_1420 221
251 3300046492 Ga0495585_0236785 Ga0495585_0236785_177_854 221
252 3300046499 Ga0495594_0024856 Ga0495594_0024856_1289_1966 221
253 3300046515 Ga0495620_0020728 Ga0495620_0020728_1392_2069 221
254 3300046660 Ga0495625_0066822 Ga0495625_0066822_1754_2434 221
255 3300046689 Ga0495613_0000689 Ga0495613_0000689_5275_5967 221
256 3300046691 Ga0495670_0034904 Ga0495670_0034904_1265_1942 221
257 3300046692 Ga0495671_0293590 Ga0495671_0293590_53_730 221
258 3300046794 Ga0495589_0014763 Ga0495589_0014763_3259_3936 221
259 3300046794 Ga0495589_0040926 Ga0495589_0040926_1367_2044 221
260 3300047318 Ga0495636_0064341 Ga0495636_0064341_186_869 221
261 3300047321 Ga0495676_0002844 Ga0495676_0002844_5631_6323 221
262 3300047321 Ga0495676_0022395 Ga0495676_0022395_1742_2419 221
263 3300047323 Ga0495683_0143521 Ga0495683_0143521_173_850 221
264 3300047447 Ga0495685_002921 Ga0495685_002921_1128_1805 221
265 3300047447 Ga0495685_003985 Ga0495685_003985_205_882 221
266 3300047447 Ga0495685_097046 Ga0495685_097046_111_785 221
267 3300047673 Ga0495593_0051463 Ga0495593_0051463_151_843 221
268 3300048089 Ga0495614_0000585 Ga0495614_0000585_6942_7634 221
269 3300048923 Ga0496120_0022674 Ga0496120_0022674_1203_1892 221
270 3300049568 Ga0501031_0003784 Ga0501031_0003784_4824_5498 221
271 3300049569 Ga0501032_0004546 Ga0501032_0004546_3214_3888 221
272 3300049569 Ga0501032_0254263 Ga0501032_0254263_190_864 221
273 3300049570 Ga0501033_0039025 Ga0501033_0039025_1613_2287 221
274 3300049572 Ga0501036_0019710 Ga0501036_0019710_4406_5080 221
275 3300049573 Ga0501037_0005388 Ga0501037_0005388_7050_7724 221
276 3300049573 Ga0501037_0163807 Ga0501037_0163807_180_854 221
277 3300049573 Ga0501037_0309050 Ga0501037_0309050_61_735 221
278 3300049574 Ga0501038_0001296 Ga0501038_0001296_19029_19703 221
279 3300049574 Ga0501038_0118275 Ga0501038_0118275_43_717 221
280 3300049578 Ga0501042_0025439 Ga0501042_0025439_436_1110 221
281 3300049579 Ga0501043_0007412 Ga0501043_0007412_1051_1725 221
282 3300049579 Ga0501043_0221812 Ga0501043_0221812_89_763 221
283 3300049580 Ga0501046_0019689 Ga0501046_0019689_1572_2246 221
284 3300049581 Ga0501047_0011825 Ga0501047_0011825_5855_6529 221
285 3300049581 Ga0501047_0078921 Ga0501047_0078921_580_1254 221
286 3300049581 Ga0501047_0108740 Ga0501047_0108740_209_883 221
287 3300049582 Ga0501048_0007309 Ga0501048_0007309_20_694 221
288 3300049586 Ga0501070_0130781 Ga0501070_0130781_174_848 221
289 3300049589 Ga0501073_0024661 Ga0501073_0024661_563_1237 221
290 3300049742 Ga0501080_0240841 Ga0501080_0240841_699_1373 221
291 3300049742 Ga0501080_0517251 Ga0501080_0517251_314_988 221
292 3300049822 Ga0501035_0034685 Ga0501035_0034685_2971_3645 221
293 3300049822 Ga0501035_0067684 Ga0501035_0067684_2102_2776 221
294 3300049823 Ga0501044_0007278 Ga0501044_0007278_9425_10099 221
295 3300049823 Ga0501044_0064347 Ga0501044_0064347_2535_3209 221
296 3300049823 Ga0501044_0204507 Ga0501044_0204507_901_1575 221
297 3300049824 Ga0501045_0178342 Ga0501045_0178342_856_1530 221
298 3300053139 Ga0500568_0000041 Ga0500568_0000041_40665_41381 221
299 3300053153 Ga0500616_0000972 Ga0500616_0000972_26054_26722 221
300 iso_pu_bacteria 2906799679 2906800735 221
301 iso_pu_bacteria 2990088156 2990089242 221
302 3300006051 Ga0075364_10248552 Ga0075364_102485522 222
303 3300013105 Ga0157369_10019540 Ga0157369_100195406 222
304 3300031901 Ga0307406_10004232 Ga0307406_100042328 222
305 3300031911 Ga0307412_10320079 Ga0307412_103200791 222
306 3300048925 Ga0496122_0082125 Ga0496122_0082125_634_1302 222
307 3300048927 Ga0496124_0076566 Ga0496124_0076566_696_1364 222
308 3300048928 Ga0496125_0004742 Ga0496125_0004742_267_935 222
309 3300050491 nmdc:mga00v17_121934_c1 nmdc:mga00v17_121934_c1_824_1492 222
310 3300002738 JGI25154J39366_1001514 JGI25154J39366_10015145 223
311 3300005455 Ga0070663_100151601 Ga0070663_1001516012 223
312 3300005840 Ga0068870_10077915 Ga0068870_100779152 223
313 3300006051 Ga0075364_10027186 Ga0075364_100271864 223
314 3300006051 Ga0075364_10172956 Ga0075364_101729562 223
315 3300009148 Ga0105243_10134350 Ga0105243_101343502 223
316 3300009148 Ga0105243_10399043 Ga0105243_103990431 223
317 3300011119 Ga0105246_10101964 Ga0105246_101019643 223
318 3300013250 Ga0171462_1003 Ga0171462_1003611 223
319 3300013308 Ga0157375_10656598 Ga0157375_106565982 223
320 3300014326 Ga0157380_10071864 Ga0157380_100718643 223
321 3300025246 Ga0209646_1000071 Ga0209646_100007124 223
322 3300025935 Ga0207709_10077450 Ga0207709_100774502 223
323 3300025935 Ga0207709_10460548 Ga0207709_104605481 223
324 3300031824 Ga0307413_10123408 Ga0307413_101234082 223
325 3300031901 Ga0307406_10000186 Ga0307406_1000018631 223
326 3300031901 Ga0307406_10387897 Ga0307406_103878972 223
327 3300031903 Ga0307407_10318351 Ga0307407_103183511 223
328 3300031911 Ga0307412_10194251 Ga0307412_101942512 223
329 3300031995 Ga0307409_100271114 Ga0307409_1002711141 223
330 3300032002 Ga0307416_100255484 Ga0307416_1002554842 223
331 3300032004 Ga0307414_10047789 Ga0307414_100477894 223
332 3300032004 Ga0307414_10085052 Ga0307414_100850522 223
333 3300041498 Ga0451841_1228916 Ga0451841_1228916_484_1155 223
334 3300044765 Ga0466970_0065141 Ga0466970_0065141_79_750 223
335 3300046453 Ga0495627_000896 Ga0495627_000896_7467_8138 223
336 3300046689 Ga0495613_0091412 Ga0495613_0091412_321_1043 223
337 3300048905 Ga0496102_0144085 Ga0496102_0144085_29_700 223
338 3300048916 Ga0496113_0066370 Ga0496113_0066370_823_1494 223
339 3300048917 Ga0496114_0073517 Ga0496114_0073517_2027_2698 223
340 3300048917 Ga0496114_0154201 Ga0496114_0154201_396_1067 223
341 3300048919 Ga0496116_0086867 Ga0496116_0086867_768_1439 223
342 3300048920 Ga0496117_0002993 Ga0496117_0002993_3943_4614 223
343 3300048921 Ga0496118_0011693 Ga0496118_0011693_541_1212 223
344 3300048921 Ga0496118_0109171 Ga0496118_0109171_671_1342 223
345 3300048922 Ga0496119_0006517 Ga0496119_0006517_7961_8632 223
346 3300048922 Ga0496119_0026124 Ga0496119_0026124_2496_3167 223
347 3300048923 Ga0496120_0001029 Ga0496120_0001029_7235_7906 223
348 3300048924 Ga0496121_0452194 Ga0496121_0452194_70_741 223
349 3300048925 Ga0496122_0000071 Ga0496122_0000071_30484_31155 223
350 3300048926 Ga0496123_0000006 Ga0496123_0000006_455208_455879 223
351 3300048927 Ga0496124_0006427 Ga0496124_0006427_2567_3238 223
352 3300048928 Ga0496125_0047268 Ga0496125_0047268_1252_1923 223
353 3300048928 Ga0496125_0071556 Ga0496125_0071556_728_1399 223
354 3300048929 Ga0496126_0005581 Ga0496126_0005581_6361_7032 223
355 3300048929 Ga0496126_0504708 Ga0496126_0504708_237_908 223
356 3300049571 Ga0501034_0002190 Ga0501034_0002190_11116_11787 223
357 3300049571 Ga0501034_0485682 Ga0501034_0485682_223_894 223
358 3300049571 Ga0501034_0897654 Ga0501034_0897654_12_683 223
359 3300049574 Ga0501038_0070866 Ga0501038_0070866_556_1227 223
360 3300049586 Ga0501070_0000473 Ga0501070_0000473_28255_28926 223
361 3300050491 nmdc:mga00v17_151765_c1 nmdc:mga00v17_151765_c1_86_760 223
362 3300050491 nmdc:mga00v17_2315_c2 nmdc:mga00v17_2315_c2_487_1158 223

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00196

GerE

Bacterial regulatory proteins, luxR family

181

237

0.97

PF00072

Response_reg

Response regulator receiver domain

26

144

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wul-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna 0.9881 157 219
4wsz-assembly1.cif.gz_A crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9865 155 219
4wsz-assembly1.cif.gz_B crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9826 155 219
4wu4-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 22bp dna 0.9807 155 218
4wul-assembly1.cif.gz_B crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna 0.98 158 219
ID Description Score Start End Superfamily
af_P06993_830_894_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9878 158 214 1.10.10.10
af_P52106_149_214_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9669 157 215 1.10.10.10
af_O53213_1064_1134_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9665 157 218 1.10.10.10
4if4C02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9649 155 220 1.10.10.10
4if4D02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9632 155 220 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A4R4RCU8-F1-model_v4 Response regulator transcription factor 0.9746 1 126 GO:0000160
GO:0003677
AF-A0A5N8WA06-F1-model_v4 Response regulator transcription factor 0.9741 2 126 GO:0000160
GO:0003677
AF-A0A652KLP3-F1-model_v4 DNA-binding response regulator 0.9721 1 126 GO:0000160
GO:0003677
AF-A0A3D5DM31-F1-model_v4 DNA-binding response regulator 0.972 2 108 GO:0000160
GO:0003677
AF-A0A652KLP3-F1-model_v4 DNA-binding response regulator 0.9646 1 126 GO:0000160
GO:0003677

Feature Viewer

pLDDT pTM Quality
85.84 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map