F422909

General Info

Members Datasets Scaffolds Average Seq Length
363 201 726 80

Family's Representative Sequence

Representative Sequence 3300005841|Ga0068863_100028296|Ga0068863_1000282962
Length 92
Sequence MGGLSIWHWLVVGIVVMLLFGKGRFSDMMGDVAKGIKSFKKGMTDDEDAAASTPPAKPVQQIEAQKVEPQPQSADPVAPPAATPVPEEHKQG

Samples

Sample ID Description Type Environment
1 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
2 3300001432 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
64 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
65 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
70 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
108 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
109 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
110 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
111 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
112 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
113 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
114 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
115 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
118 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
119 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
120 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
124 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
125 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
126 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
127 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
128 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
129 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
130 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
131 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
132 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
133 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
134 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
135 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
136 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
137 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
138 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
139 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
140 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
141 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
142 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
147 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
148 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
149 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
150 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
151 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
152 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
153 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
154 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
155 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
156 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
157 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
158 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
159 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
160 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
161 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
162 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
174 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
175 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
176 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
177 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
178 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
179 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
180 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
181 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
182 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
183 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
187 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
188 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
191 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
192 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
193 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
194 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
195 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
196 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
197 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
198 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
199 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
200 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
201 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.9
Metatranscriptomes 0.55
Isolates 0.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.19
Nodule 0
Rhizoplane 3.03
Rhizosphere 77.69
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068863_100028296 3300005841 Bacteria 5351
2 JGI24034J14986_104728 3300001432 Bacteria 561
3 JGI24752J21851_1000861 3300001976 Bacteria 4117
4 JGI24748J21848_1000097 3300002074 Bacteria 23021
5 JGI24034J26672_10000060 3300002239 Bacteria 41095
6 JGI24742J22300_10039560 3300002244 Bacteria 838
7 JGI24751J29686_10009164 3300002459 Bacteria 2032
8 Ga0055536_1002976 3300003781 Bacteria 9281
9 Ga0055536_1003397 3300003781 Bacteria 8570
10 Ga0055536_1018865 3300003781 Bacteria 2191
11 Ga0055530_10000013 3300003791 Bacteria 153390
12 Ga0055530_10047246 3300003791 Bacteria 1018
13 Ga0070658_10000086 3300005327 Bacteria 86563
14 Ga0070670_100220735 3300005331 Bacteria 1649
15 Ga0070666_10000069 3300005335 Bacteria 75768
16 Ga0070666_10000129 3300005335 Bacteria 53219
17 Ga0070666_10047456 3300005335 Bacteria 2883
18 Ga0068868_100000503 3300005338 Bacteria 26082
19 Ga0070660_100000197 3300005339 Bacteria 40265
20 Ga0070660_100000856 3300005339 Bacteria 20282
21 Ga0070660_100055989 3300005339 Bacteria 3050
22 Ga0070660_101848148 3300005339 Bacteria 515
23 Ga0070689_100003334 3300005340 Bacteria 10668
24 Ga0070689_101192512 3300005340 Bacteria 683
25 Ga0070661_100000011 3300005344 Bacteria 175355
26 Ga0070692_10003531 3300005345 Bacteria 6356
27 Ga0070668_100005753 3300005347 Bacteria 9197
28 Ga0070668_100039704 3300005347 Bacteria 3599
29 Ga0070668_100165852 3300005347 Bacteria 1795
30 Ga0070668_100350533 3300005347 Bacteria 1249
31 Ga0070668_100459315 3300005347 Bacteria 1096
32 Ga0070669_100000004 3300005353 Bacteria 314707
33 Ga0070669_100000167 3300005353 Bacteria 57589
34 Ga0070669_100451890 3300005353 Bacteria 1059
35 Ga0070669_100526896 3300005353 Bacteria 983
36 Ga0070671_100000004 3300005355 Bacteria 262155
37 Ga0070671_100012110 3300005355 Bacteria 6941
38 Ga0070671_100973485 3300005355 Bacteria 743
39 Ga0070674_100572421 3300005356 Bacteria 951
40 Ga0070688_100004979 3300005365 Bacteria 6950
41 Ga0070659_100000159 3300005366 Bacteria 51703
42 Ga0070659_100002714 3300005366 Bacteria 12587
43 Ga0070659_100054626 3300005366 Bacteria 3146
44 Ga0070659_101986222 3300005366 Bacteria 522
45 Ga0070667_100000036 3300005367 Bacteria 172536
46 Ga0070667_100064227 3300005367 Bacteria 3114
47 Ga0070700_100569346 3300005441 Bacteria 883
48 Ga0070700_100970211 3300005441 Bacteria 697
49 Ga0070708_100355842 3300005445 Bacteria 1380
50 Ga0070708_100772724 3300005445 Bacteria 903
51 Ga0070678_100736769 3300005456 Bacteria 890
52 Ga0070662_100553847 3300005457 Bacteria 964
53 Ga0070685_10000036 3300005466 Bacteria 80641
54 Ga0068853_100691996 3300005539 Bacteria 972
55 Ga0070686_100000045 3300005544 Bacteria 101988
56 Ga0070696_101097464 3300005546 Bacteria 669
57 Ga0070665_100000042 3300005548 Bacteria 292582
58 Ga0070665_100034565 3300005548 Bacteria 5083
59 Ga0070704_101170748 3300005549 Bacteria 700
60 Ga0068857_101099510 3300005577 Bacteria 767
61 Ga0068854_102064006 3300005578 Bacteria 526
62 Ga0068852_101349400 3300005616 Bacteria 735
63 Ga0068859_100008727 3300005617 Bacteria 10240
64 Ga0068859_100026991 3300005617 Bacteria 5761
65 Ga0068859_100086420 3300005617 Bacteria 3183
66 Ga0068859_100156542 3300005617 Bacteria 2356
67 Ga0068859_100384456 3300005617 Bacteria 1499
68 Ga0068864_100000736 3300005618 Bacteria 27421
69 Ga0068861_100005577 3300005719 Bacteria 8530
70 Ga0068861_101303667 3300005719 Bacteria 706
71 Ga0068863_100000239 3300005841 Bacteria 58509
72 Ga0068863_100000845 3300005841 Bacteria 30656
73 Ga0068863_100004067 3300005841 Bacteria 14443
74 Ga0068858_100000659 3300005842 Bacteria 36067
75 Ga0068858_100003763 3300005842 Bacteria 15003
76 Ga0068858_101414752 3300005842 Bacteria 685
77 Ga0068860_100000063 3300005843 Bacteria 189519
78 Ga0068860_100000182 3300005843 Bacteria 100888
79 Ga0068860_100002979 3300005843 Bacteria 17493
80 Ga0068860_100571226 3300005843 Bacteria 1134
81 Ga0068860_101111201 3300005843 Bacteria 810
82 Ga0068860_101882225 3300005843 Bacteria 620
83 Ga0068862_100000067 3300005844 Bacteria 123668
84 Ga0068862_100000392 3300005844 Bacteria 47165
85 Ga0068862_100001195 3300005844 Bacteria 24489
86 Ga0068862_100005835 3300005844 Bacteria 10261
87 Ga0068862_100302671 3300005844 Bacteria 1471
88 Ga0068862_101719104 3300005844 Bacteria 636
89 Ga0075430_100007566 3300006846 Bacteria 9175
90 Ga0097620_100008726 3300006931 Bacteria 10240
91 Ga0097620_100026991 3300006931 Bacteria 5761
92 Ga0097620_100086416 3300006931 Bacteria 3183
93 Ga0097620_100156538 3300006931 Bacteria 2356
94 Ga0097620_100384436 3300006931 Bacteria 1499
95 Ga0105250_10011581 3300009092 Bacteria 3657
96 Ga0111539_11292568 3300009094 Bacteria 847
97 Ga0105245_10161479 3300009098 Bacteria 2127
98 Ga0105245_10161701 3300009098 Bacteria 2125
99 Ga0105247_10014686 3300009101 Bacteria 4694
100 Ga0105247_10231573 3300009101 Bacteria 1255
101 Ga0105248_10214434 3300009177 Bacteria 2168
102 Ga0105248_10229550 3300009177 Bacteria 2089
103 Ga0105249_10000012 3300009553 Bacteria 292640
104 Ga0105249_10000105 3300009553 Bacteria 117181
105 Ga0105249_10032169 3300009553 Bacteria 4745
106 Ga0105249_10083720 3300009553 Bacteria 2970
107 Ga0105249_10174207 3300009553 Bacteria 2088
108 Ga0105249_11227729 3300009553 Bacteria 821
109 Ga0105148_103453 3300009978 Bacteria 1120
110 Ga0157373_10404722 3300013100 Bacteria 978
111 Ga0157370_10451308 3300013104 Bacteria 1182
112 Ga0157370_10934350 3300013104 Bacteria 786
113 Ga0157369_10067925 3300013105 Bacteria 3830
114 Ga0163162_10065894 3300013306 Bacteria 3671
115 Ga0163162_10326940 3300013306 Bacteria 1666
116 Ga0163162_10638187 3300013306 Bacteria 1189
117 Ga0163162_11275452 3300013306 Bacteria 834
118 Ga0157372_10401395 3300013307 Bacteria 1597
119 Ga0157372_10632303 3300013307 Bacteria 1247
120 Ga0157375_10189103 3300013308 Bacteria 2213
121 Ga0163163_10131728 3300014325 Bacteria 2541
122 Ga0163163_10248142 3300014325 Bacteria 1831
123 Ga0157380_10001468 3300014326 Bacteria 15436
124 Ga0157380_10001964 3300014326 Bacteria 13685
125 Ga0157380_10331000 3300014326 Bacteria 1416
126 Ga0157379_10011656 3300014968 Bacteria 7676
127 Ga0157379_10163230 3300014968 Bacteria 2011
128 Ga0157379_10304243 3300014968 Bacteria 1453
129 Ga0163161_10000387 3300017792 Bacteria 36952
130 Ga0213873_10000042 3300021358 Bacteria 30839
131 Ga0213876_10000050 3300021384 Bacteria 144836
132 Ga0213876_10001602 3300021384 Bacteria 13897
133 Ga0207672_1001171 3300025223 Bacteria 2285
134 Ga0209675_1000275 3300025291 Bacteria 49474
135 Ga0209676_1000349 3300025292 Bacteria 87517
136 Ga0209676_1000453 3300025292 Bacteria 69137
137 Ga0209676_1000648 3300025292 Bacteria 49941
138 Ga0209676_1023969 3300025292 Bacteria 1987
139 Ga0209025_1015485 3300025294 Bacteria 4592
140 Ga0209758_1099264 3300025297 Bacteria 832
141 Ga0209050_1000042 3300025298 Bacteria 402842
142 Ga0209050_1000822 3300025298 Bacteria 43254
143 Ga0209050_1038989 3300025298 Bacteria 1345
144 Ga0209257_1000135 3300025304 Bacteria 205668
145 Ga0207697_10000502 3300025315 Bacteria 22013
146 Ga0207696_1153544 3300025711 Bacteria 614
147 Ga0207710_10002821 3300025900 Bacteria 7922
148 Ga0207710_10125201 3300025900 Bacteria 1230
149 Ga0207680_10000012 3300025903 Bacteria 293810
150 Ga0207680_10000106 3300025903 Bacteria 38390
151 Ga0207680_10053560 3300025903 Bacteria 2423
152 Ga0207705_10000002 3300025909 Bacteria 2046852
153 Ga0207657_10006128 3300025919 Bacteria 12497
154 Ga0207657_10013217 3300025919 Bacteria 8103
155 Ga0207657_10049485 3300025919 Bacteria 3662
156 Ga0207649_10000221 3300025920 Bacteria 46316
157 Ga0207652_11703060 3300025921 Bacteria 535
158 Ga0207681_10000010 3300025923 Bacteria 403379
159 Ga0207681_10000076 3300025923 Bacteria 89353
160 Ga0207650_10118113 3300025925 Bacteria 2061
161 Ga0207650_10180957 3300025925 Bacteria 1680
162 Ga0207659_10111132 3300025926 Bacteria 2084
163 Ga0207687_10130685 3300025927 Bacteria 1892
164 Ga0207687_10223224 3300025927 Bacteria 1485
165 Ga0207644_10000007 3300025931 Bacteria 381778
166 Ga0207644_10011602 3300025931 Bacteria 5833
167 Ga0207644_10851554 3300025931 Bacteria 763
168 Ga0207690_10000177 3300025932 Bacteria 49108
169 Ga0207690_10001952 3300025932 Bacteria 12643
170 Ga0207706_10092075 3300025933 Bacteria 2666
171 Ga0207670_10386629 3300025936 Bacteria 1116
172 Ga0207670_11080939 3300025936 Bacteria 677
173 Ga0207711_10053556 3300025941 Bacteria 3460
174 Ga0207711_10135504 3300025941 Bacteria 2211
175 Ga0207651_12131796 3300025960 Bacteria 503
176 Ga0207712_10000015 3300025961 Bacteria 346689
177 Ga0207712_10000021 3300025961 Bacteria 292649
178 Ga0207712_10071807 3300025961 Bacteria 2490
179 Ga0207712_10561612 3300025961 Bacteria 983
180 Ga0207712_10718816 3300025961 Bacteria 873
181 Ga0207668_10000156 3300025972 Bacteria 47336
182 Ga0207668_10008280 3300025972 Bacteria 6195
183 Ga0207668_10083261 3300025972 Bacteria 2327
184 Ga0207668_10193370 3300025972 Bacteria 1614
185 Ga0207668_10979047 3300025972 Bacteria 755
186 Ga0207668_11828255 3300025972 Bacteria 548
187 Ga0207640_10014352 3300025981 Bacteria 4559
188 Ga0207640_10758096 3300025981 Bacteria 837
189 Ga0207658_10000083 3300025986 Bacteria 104502
190 Ga0207658_10000826 3300025986 Bacteria 25872
191 Ga0207677_10001450 3300026023 Bacteria 12555
192 Ga0207703_10001618 3300026035 Bacteria 20317
193 Ga0207703_10094183 3300026035 Bacteria 2524
194 Ga0207639_10390542 3300026041 Bacteria 1252
195 Ga0207708_10622744 3300026075 Bacteria 916
196 Ga0207641_10000410 3300026088 Bacteria 50167
197 Ga0207641_10004799 3300026088 Bacteria 11651
198 Ga0207641_10021668 3300026088 Bacteria 5279
199 Ga0207641_10172618 3300026088 Bacteria 1974
200 Ga0207648_12004065 3300026089 Bacteria 540
201 Ga0207676_10005009 3300026095 Bacteria 9384
202 Ga0207676_10202626 3300026095 Bacteria 1754
203 Ga0207675_100000075 3300026118 Bacteria 76201
204 Ga0207675_100013675 3300026118 Bacteria 7574
205 Ga0207675_101165311 3300026118 Bacteria 791
206 Ga0207698_11188877 3300026142 Bacteria 776
207 Ga0209998_10028737 3300027717 Bacteria 1223
208 Ga0268266_10000054 3300028379 Bacteria 292717
209 Ga0268266_10006558 3300028379 Bacteria 10641
210 Ga0268266_11132212 3300028379 Bacteria 757
211 Ga0268266_11680332 3300028379 Bacteria 610
212 Ga0268265_10000021 3300028380 Bacteria 272292
213 Ga0268265_10000278 3300028380 Bacteria 58293
214 Ga0268265_10001179 3300028380 Bacteria 22889
215 Ga0268265_10019888 3300028380 Bacteria 4676
216 Ga0268265_10039089 3300028380 Bacteria 3494
217 Ga0268264_10000083 3300028381 Bacteria 245366
218 Ga0268264_10000106 3300028381 Bacteria 210031
219 Ga0268264_10000764 3300028381 Bacteria 35781
220 Ga0268264_10003943 3300028381 Bacteria 12705
221 Ga0268264_10051497 3300028381 Bacteria 3431
222 Ga0268264_11090069 3300028381 Bacteria 807
223 Ga0307517_10390841 3300028786 Bacteria 740
224 Ga0316183_1210559 3300030742 Bacteria 1453
225 Ga0316182_1269164 3300030745 Bacteria 582
226 Ga0307513_10170931 3300031456 Bacteria 2051
227 Ga0307408_100025798 3300031548 Bacteria 4028
228 Ga0307408_100059846 3300031548 Bacteria 2774
229 Ga0307408_100159743 3300031548 Bacteria 1789
230 Ga0307405_10004719 3300031731 Bacteria 6487
231 Ga0307405_10012331 3300031731 Bacteria 4518
232 Ga0307410_10652279 3300031852 Bacteria 883
233 Ga0307406_10001642 3300031901 Bacteria 12289
234 Ga0307412_10001919 3300031911 Bacteria 11484
235 Ga0307412_10002795 3300031911 Bacteria 9694
236 Ga0307412_10009604 3300031911 Bacteria 5556
237 Ga0307412_10391954 3300031911 Bacteria 1128
238 Ga0307412_11007917 3300031911 Bacteria 736
239 Ga0307416_100021750 3300032002 Bacteria 4612
240 Ga0307416_100305941 3300032002 Bacteria 1583
241 Ga0307416_101185615 3300032002 Bacteria 869
242 Ga0307416_102772434 3300032002 Bacteria 586
243 Ga0307414_10001123 3300032004 Bacteria 13682
244 Ga0307414_10008032 3300032004 Bacteria 5965
245 Ga0307414_10048300 3300032004 Bacteria 2935
246 Ga0307414_10461475 3300032004 Bacteria 1116
247 Ga0307414_10536722 3300032004 Bacteria 1040
248 Ga0307411_10055119 3300032005 Bacteria 2614
249 Ga0307411_10371537 3300032005 Bacteria 1173
250 Ga0307411_11914375 3300032005 Bacteria 552
251 Ga0307415_102425608 3300032126 Bacteria 516
252 Ga0307510_10046515 3300033180 Bacteria 4664
253 Ga0395905_0216150 3300037471 Bacteria 1795
254 Ga0395901_0068076 3300038443 Bacteria 3709
255 Ga0395901_0223048 3300038443 Bacteria 1970
256 Ga0436365_0083893 3300039437 Bacteria 1171
257 Ga0436365_1595987 3300039437 Bacteria 26536
258 Ga0436365_1697258 3300039437 Bacteria 30915
259 Ga0436363_0702332 3300039450 Bacteria 2106
260 Ga0436362_1132945 3300039453 Bacteria 19454
261 Ga0439461_0120312 3300041410 Bacteria 656
262 Ga0451791_0426158 3300041451 Bacteria 609
263 Ga0451797_0725346 3300041453 Bacteria 674
264 Ga0439445_0093039 3300042004 Bacteria 850
265 Ga0439434_0188174 3300042435 Bacteria 693
266 Ga0495620_0276638 3300046515 Bacteria 639
267 Ga0495663_0250841 3300046525 Bacteria 628
268 Ga0495654_0000999 3300046530 Bacteria 20769
269 Ga0495654_0138190 3300046530 Bacteria 1088
270 Ga0495668_0006190 3300046616 Bacteria 7906
271 Ga0495668_0012944 3300046616 Bacteria 4938
272 Ga0495625_0000652 3300046660 Bacteria 49796
273 Ga0495670_0042357 3300046691 Bacteria 2271
274 Ga0495671_0180652 3300046692 Bacteria 1025
275 Ga0495589_0047816 3300046794 Bacteria 2119
276 Ga0495673_0043055 3300047469 Bacteria 2023
277 Ga0495681_0204586 3300047470 Bacteria 799
278 Ga0495686_0304605 3300047472 Bacteria 878
279 Ga0496101_0443686 3300048904 Bacteria 1024
280 Ga0496102_0000010 3300048905 Bacteria 324617
281 Ga0496102_0002069 3300048905 Bacteria 17283
282 Ga0496103_0000029 3300048906 Bacteria 213326
283 Ga0496103_0011551 3300048906 Bacteria 5235
284 Ga0496104_0127839 3300048907 Bacteria 2440
285 Ga0496106_0717801 3300048909 Bacteria 796
286 Ga0496107_0257426 3300048910 Bacteria 1299
287 Ga0496111_0549159 3300048914 Bacteria 848
288 Ga0496116_0002331 3300048919 Bacteria 20105
289 Ga0496117_0000037 3300048920 Bacteria 324960
290 Ga0496117_0009462 3300048920 Bacteria 9064
291 Ga0496117_0012147 3300048920 Bacteria 7628
292 Ga0496118_0000034 3300048921 Bacteria 322764
293 Ga0496118_0000811 3300048921 Bacteria 49879
294 Ga0496118_0188896 3300048921 Bacteria 1234
295 Ga0496119_0230268 3300048922 Bacteria 943
296 Ga0496120_0164149 3300048923 Bacteria 1104
297 Ga0496121_0033968 3300048924 Bacteria 4602
298 Ga0496122_0407546 3300048925 Bacteria 688
299 Ga0496123_0013439 3300048926 Bacteria 6874
300 Ga0496123_0246398 3300048926 Bacteria 884
301 Ga0496124_0000033 3300048927 Bacteria 330586
302 Ga0496124_0118730 3300048927 Bacteria 2117
303 Ga0496124_0220408 3300048927 Bacteria 1427
304 Ga0496124_0671941 3300048927 Bacteria 661
305 Ga0496125_0252752 3300048928 Bacteria 1111
306 Ga0496125_0706696 3300048928 Bacteria 534
307 Ga0496126_0264071 3300048929 Bacteria 1431
308 Ga0496126_0836927 3300048929 Bacteria 703
309 Ga0496126_1161552 3300048929 Bacteria 570
310 Ga0495678_149587 3300049459 Bacteria 755
311 Ga0501290_091072 3300049513 Bacteria 531
312 Ga0501314_000311 3300049530 Bacteria 2881
313 Ga0501335_020962 3300049551 Bacteria 698
314 Ga0501032_0119275 3300049569 Bacteria 1744
315 Ga0501033_0287546 3300049570 Bacteria 1159
316 Ga0501034_0006999 3300049571 Bacteria 12042
317 Ga0501034_0068953 3300049571 Bacteria 3547
318 Ga0501036_0209944 3300049572 Bacteria 1636
319 Ga0501037_0134197 3300049573 Bacteria 1773
320 Ga0501038_0031513 3300049574 Bacteria 4685
321 Ga0501039_0389669 3300049575 Bacteria 1094
322 Ga0501043_0045523 3300049579 Bacteria 3451
323 Ga0501046_0176618 3300049580 Bacteria 1599
324 Ga0501070_0572056 3300049586 Bacteria 903
325 Ga0501223_000227 3300049663 Bacteria 14454
326 Ga0501223_028808 3300049663 Bacteria 1081
327 Ga0501224_000030 3300049664 Bacteria 45775
328 Ga0501233_002383 3300049668 Bacteria 3305
329 Ga0501235_049936 3300049669 Bacteria 968
330 Ga0501257_000019 3300049686 Bacteria 47149
331 Ga0501225_0000009 3300049705 Bacteria 90065
332 Ga0501229_034179 3300049706 Bacteria 706
333 Ga0501234_002981 3300049707 Bacteria 2658
334 Ga0501280_001184 3300049776 Bacteria 5114
335 Ga0501035_0149915 3300049822 Bacteria 2024
336 Ga0501044_0056725 3300049823 Bacteria 4021
337 Ga0501045_1073349 3300049824 Bacteria 589
338 Ga0501226_000054 3300049853 Bacteria 39689
339 nmdc:mga0k408_163766_c1 3300050493 Bacteria 1325
340 nmdc:mga0qj67_158416_c1 3300050509 Bacteria 1838
341 nmdc:mga08y16_1166447_c1 3300050511 Bacteria 742
342 Ga0500643_000151 3300053087 Bacteria 70674
343 Ga0500646_0033566 3300053090 Bacteria 1420
344 Ga0500592_000316 3300053116 Bacteria 8295
345 Ga0500592_001181 3300053116 Bacteria 4252
346 Ga0500592_025783 3300053116 Bacteria 948
347 Ga0500592_077988 3300053116 Bacteria 549
348 Ga0500618_148181 3300053125 Bacteria 535
349 Ga0500658_0032270 3300053134 Bacteria 2053
350 Ga0500658_0478150 3300053134 Bacteria 565
351 Ga0500568_0001107 3300053139 Bacteria 18110
352 Ga0500577_0348956 3300053142 Bacteria 647
353 Ga0500604_0000017 3300053151 Bacteria 82010
354 Ga0500604_0020018 3300053151 Bacteria 1879
355 Ga0500627_0000005 3300053158 Bacteria 167950
356 Ga0500627_0000495 3300053158 Bacteria 10626
357 Ga0500627_0007085 3300053158 Bacteria 3874
358 Ga0500627_0107933 3300053158 Bacteria 1252
359 Ga0500627_0260946 3300053158 Bacteria 764
360 Ga0500627_0507621 3300053158 Bacteria 501
361 Ga0500611_053764 3300053727 Bacteria 931
362 2644042893 2643221606 Bacteria 5588032
363 2644395676 2643221671 Bacteria 5496681
364 Ga0068863_100028296
365 JGI24034J14986_104728
366 JGI24752J21851_1000861
367 JGI24748J21848_1000097
368 JGI24034J26672_10000060
369 JGI24742J22300_10039560
370 JGI24751J29686_10009164
371 Ga0055536_1002976
372 Ga0055536_1003397
373 Ga0055536_1018865
374 Ga0055530_10000013
375 Ga0055530_10047246
376 Ga0070658_10000086
377 Ga0070670_100220735
378 Ga0070666_10000069
379 Ga0070666_10000129
380 Ga0070666_10047456
381 Ga0068868_100000503
382 Ga0070660_100000197
383 Ga0070660_100000856
384 Ga0070660_100055989
385 Ga0070660_101848148
386 Ga0070689_100003334
387 Ga0070689_101192512
388 Ga0070661_100000011
389 Ga0070692_10003531
390 Ga0070668_100005753
391 Ga0070668_100039704
392 Ga0070668_100165852
393 Ga0070668_100350533
394 Ga0070668_100459315
395 Ga0070669_100000004
396 Ga0070669_100000167
397 Ga0070669_100451890
398 Ga0070669_100526896
399 Ga0070671_100000004
400 Ga0070671_100012110
401 Ga0070671_100973485
402 Ga0070674_100572421
403 Ga0070688_100004979
404 Ga0070659_100000159
405 Ga0070659_100002714
406 Ga0070659_100054626
407 Ga0070659_101986222
408 Ga0070667_100000036
409 Ga0070667_100064227
410 Ga0070700_100569346
411 Ga0070700_100970211
412 Ga0070708_100355842
413 Ga0070708_100772724
414 Ga0070678_100736769
415 Ga0070662_100553847
416 Ga0070685_10000036
417 Ga0068853_100691996
418 Ga0070686_100000045
419 Ga0070696_101097464
420 Ga0070665_100000042
421 Ga0070665_100034565
422 Ga0070704_101170748
423 Ga0068857_101099510
424 Ga0068854_102064006
425 Ga0068852_101349400
426 Ga0068859_100008727
427 Ga0068859_100026991
428 Ga0068859_100086420
429 Ga0068859_100156542
430 Ga0068859_100384456
431 Ga0068864_100000736
432 Ga0068861_100005577
433 Ga0068861_101303667
434 Ga0068863_100000239
435 Ga0068863_100000845
436 Ga0068863_100004067
437 Ga0068858_100000659
438 Ga0068858_100003763
439 Ga0068858_101414752
440 Ga0068860_100000063
441 Ga0068860_100000182
442 Ga0068860_100002979
443 Ga0068860_100571226
444 Ga0068860_101111201
445 Ga0068860_101882225
446 Ga0068862_100000067
447 Ga0068862_100000392
448 Ga0068862_100001195
449 Ga0068862_100005835
450 Ga0068862_100302671
451 Ga0068862_101719104
452 Ga0075430_100007566
453 Ga0097620_100008726
454 Ga0097620_100026991
455 Ga0097620_100086416
456 Ga0097620_100156538
457 Ga0097620_100384436
458 Ga0105250_10011581
459 Ga0111539_11292568
460 Ga0105245_10161479
461 Ga0105245_10161701
462 Ga0105247_10014686
463 Ga0105247_10231573
464 Ga0105248_10214434
465 Ga0105248_10229550
466 Ga0105249_10000012
467 Ga0105249_10000105
468 Ga0105249_10032169
469 Ga0105249_10083720
470 Ga0105249_10174207
471 Ga0105249_11227729
472 Ga0105148_103453
473 Ga0157373_10404722
474 Ga0157370_10451308
475 Ga0157370_10934350
476 Ga0157369_10067925
477 Ga0163162_10065894
478 Ga0163162_10326940
479 Ga0163162_10638187
480 Ga0163162_11275452
481 Ga0157372_10401395
482 Ga0157372_10632303
483 Ga0157375_10189103
484 Ga0163163_10131728
485 Ga0163163_10248142
486 Ga0157380_10001468
487 Ga0157380_10001964
488 Ga0157380_10331000
489 Ga0157379_10011656
490 Ga0157379_10163230
491 Ga0157379_10304243
492 Ga0163161_10000387
493 Ga0213873_10000042
494 Ga0213876_10000050
495 Ga0213876_10001602
496 Ga0207672_1001171
497 Ga0209675_1000275
498 Ga0209676_1000349
499 Ga0209676_1000453
500 Ga0209676_1000648
501 Ga0209676_1023969
502 Ga0209025_1015485
503 Ga0209758_1099264
504 Ga0209050_1000042
505 Ga0209050_1000822
506 Ga0209050_1038989
507 Ga0209257_1000135
508 Ga0207697_10000502
509 Ga0207696_1153544
510 Ga0207710_10002821
511 Ga0207710_10125201
512 Ga0207680_10000012
513 Ga0207680_10000106
514 Ga0207680_10053560
515 Ga0207705_10000002
516 Ga0207657_10006128
517 Ga0207657_10013217
518 Ga0207657_10049485
519 Ga0207649_10000221
520 Ga0207652_11703060
521 Ga0207681_10000010
522 Ga0207681_10000076
523 Ga0207650_10118113
524 Ga0207650_10180957
525 Ga0207659_10111132
526 Ga0207687_10130685
527 Ga0207687_10223224
528 Ga0207644_10000007
529 Ga0207644_10011602
530 Ga0207644_10851554
531 Ga0207690_10000177
532 Ga0207690_10001952
533 Ga0207706_10092075
534 Ga0207670_10386629
535 Ga0207670_11080939
536 Ga0207711_10053556
537 Ga0207711_10135504
538 Ga0207651_12131796
539 Ga0207712_10000015
540 Ga0207712_10000021
541 Ga0207712_10071807
542 Ga0207712_10561612
543 Ga0207712_10718816
544 Ga0207668_10000156
545 Ga0207668_10008280
546 Ga0207668_10083261
547 Ga0207668_10193370
548 Ga0207668_10979047
549 Ga0207668_11828255
550 Ga0207640_10014352
551 Ga0207640_10758096
552 Ga0207658_10000083
553 Ga0207658_10000826
554 Ga0207677_10001450
555 Ga0207703_10001618
556 Ga0207703_10094183
557 Ga0207639_10390542
558 Ga0207708_10622744
559 Ga0207641_10000410
560 Ga0207641_10004799
561 Ga0207641_10021668
562 Ga0207641_10172618
563 Ga0207648_12004065
564 Ga0207676_10005009
565 Ga0207676_10202626
566 Ga0207675_100000075
567 Ga0207675_100013675
568 Ga0207675_101165311
569 Ga0207698_11188877
570 Ga0209998_10028737
571 Ga0268266_10000054
572 Ga0268266_10006558
573 Ga0268266_11132212
574 Ga0268266_11680332
575 Ga0268265_10000021
576 Ga0268265_10000278
577 Ga0268265_10001179
578 Ga0268265_10019888
579 Ga0268265_10039089
580 Ga0268264_10000083
581 Ga0268264_10000106
582 Ga0268264_10000764
583 Ga0268264_10003943
584 Ga0268264_10051497
585 Ga0268264_11090069
586 Ga0307517_10390841
587 Ga0316183_1210559
588 Ga0316182_1269164
589 Ga0307513_10170931
590 Ga0307408_100025798
591 Ga0307408_100059846
592 Ga0307408_100159743
593 Ga0307405_10004719
594 Ga0307405_10012331
595 Ga0307410_10652279
596 Ga0307406_10001642
597 Ga0307412_10001919
598 Ga0307412_10002795
599 Ga0307412_10009604
600 Ga0307412_10391954
601 Ga0307412_11007917
602 Ga0307416_100021750
603 Ga0307416_100305941
604 Ga0307416_101185615
605 Ga0307416_102772434
606 Ga0307414_10001123
607 Ga0307414_10008032
608 Ga0307414_10048300
609 Ga0307414_10461475
610 Ga0307414_10536722
611 Ga0307411_10055119
612 Ga0307411_10371537
613 Ga0307411_11914375
614 Ga0307415_102425608
615 Ga0307510_10046515
616 Ga0395905_0216150
617 Ga0395901_0068076
618 Ga0395901_0223048
619 Ga0436365_0083893
620 Ga0436365_1595987
621 Ga0436365_1697258
622 Ga0436363_0702332
623 Ga0436362_1132945
624 Ga0439461_0120312
625 Ga0451791_0426158
626 Ga0451797_0725346
627 Ga0439445_0093039
628 Ga0439434_0188174
629 Ga0495620_0276638
630 Ga0495663_0250841
631 Ga0495654_0000999
632 Ga0495654_0138190
633 Ga0495668_0006190
634 Ga0495668_0012944
635 Ga0495625_0000652
636 Ga0495670_0042357
637 Ga0495671_0180652
638 Ga0495589_0047816
639 Ga0495673_0043055
640 Ga0495681_0204586
641 Ga0495686_0304605
642 Ga0496101_0443686
643 Ga0496102_0000010
644 Ga0496102_0002069
645 Ga0496103_0000029
646 Ga0496103_0011551
647 Ga0496104_0127839
648 Ga0496106_0717801
649 Ga0496107_0257426
650 Ga0496111_0549159
651 Ga0496116_0002331
652 Ga0496117_0000037
653 Ga0496117_0009462
654 Ga0496117_0012147
655 Ga0496118_0000034
656 Ga0496118_0000811
657 Ga0496118_0188896
658 Ga0496119_0230268
659 Ga0496120_0164149
660 Ga0496121_0033968
661 Ga0496122_0407546
662 Ga0496123_0013439
663 Ga0496123_0246398
664 Ga0496124_0000033
665 Ga0496124_0118730
666 Ga0496124_0220408
667 Ga0496124_0671941
668 Ga0496125_0252752
669 Ga0496125_0706696
670 Ga0496126_0264071
671 Ga0496126_0836927
672 Ga0496126_1161552
673 Ga0495678_149587
674 Ga0501290_091072
675 Ga0501314_000311
676 Ga0501335_020962
677 Ga0501032_0119275
678 Ga0501033_0287546
679 Ga0501034_0006999
680 Ga0501034_0068953
681 Ga0501036_0209944
682 Ga0501037_0134197
683 Ga0501038_0031513
684 Ga0501039_0389669
685 Ga0501043_0045523
686 Ga0501046_0176618
687 Ga0501070_0572056
688 Ga0501223_000227
689 Ga0501223_028808
690 Ga0501224_000030
691 Ga0501233_002383
692 Ga0501235_049936
693 Ga0501257_000019
694 Ga0501225_0000009
695 Ga0501229_034179
696 Ga0501234_002981
697 Ga0501280_001184
698 Ga0501035_0149915
699 Ga0501044_0056725
700 Ga0501045_1073349
701 Ga0501226_000054
702 nmdc:mga0k408_163766_c1
703 nmdc:mga0qj67_158416_c1
704 nmdc:mga08y16_1166447_c1
705 Ga0500643_000151
706 Ga0500646_0033566
707 Ga0500592_000316
708 Ga0500592_001181
709 Ga0500592_025783
710 Ga0500592_077988
711 Ga0500618_148181
712 Ga0500658_0032270
713 Ga0500658_0478150
714 Ga0500568_0001107
715 Ga0500577_0348956
716 Ga0500604_0000017
717 Ga0500604_0020018
718 Ga0500627_0000005
719 Ga0500627_0000495
720 Ga0500627_0007085
721 Ga0500627_0107933
722 Ga0500627_0260946
723 Ga0500627_0507621
724 Ga0500611_053764
725 2644042893
726 2644395676

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02416

TatA_B_E

mttA/Hcf106 family

4

71

0.91

Map