F422933

General Info

Members Datasets Scaffolds Average Seq Length
363 193 726 234

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10535137|Ga0105240_105351372
Length 247
Sequence LALSLKLSAFDFMLFYTPDIAPSHPQYFLSEEESKHAIRVLRLEAGSEVQLIDGRGGFYTAVIQDAHPKRTILQITSVTENYNKRNHYLHLAVAPTKNVERLEWFLEKATEIGIDEISLIISQRSERKEAKTDRLNKIITAAIKQSLKAYHPVLNEPVKLNELLSRPFDGQKYIAHCEPGDKLGLRNDLQLQGRCLILIGPEGDFTPAEIESALQNGFKPITLGESRLRTETAALEACFEVNFLNRV

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
19 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
68 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
69 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
72 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
74 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
75 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
76 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
77 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
79 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
80 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
83 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
84 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
111 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
112 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
113 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
114 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
115 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
118 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
119 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
120 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
121 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
122 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
123 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
124 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
125 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
126 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
132 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
133 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
134 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
135 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
136 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
137 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
138 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
139 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
140 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
141 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
142 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
143 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
144 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
145 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
146 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
147 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
148 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
149 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
150 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
151 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
152 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
153 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
154 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
155 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
156 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
157 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
158 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
159 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
160 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
161 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
162 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
163 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
164 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
165 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
166 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
167 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
168 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
169 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
170 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
171 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
172 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
173 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
174 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
175 2738541302 Pedobacter sp. CF074 Isolate Unclassified
176 2739367651 Pedobacter sp. OK291 Isolate Unclassified
177 2739367656 Pedobacter sp. CF523 Isolate Unclassified
178 2739367663 Pedobacter sp. YR510 Isolate Unclassified
179 2818991437 Pedobacter terrae 518 Isolate Unclassified
180 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
181 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
182 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
183 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
184 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
185 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
186 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
187 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
188 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
189 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
190 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
191 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
192 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
193 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.94
Metatranscriptomes 0.28
Isolates 5.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.74
Nodule 0
Rhizoplane 0.28
Rhizosphere 80.17
Stem 0
Stem Tuber 0
Unclassified 0.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10535137 3300009093 Bacteria 1298
2 JGI24741J21665_1010803 3300001915 Bacteria 1618
3 JGI24740J21852_10033607 3300001979 Bacteria 1626
4 JGI24739J22299_10001167 3300001989 Bacteria 9825
5 JGI24739J22299_10004465 3300001989 Bacteria 5360
6 JGI24737J22298_10000060 3300001990 Bacteria 32592
7 JGI24737J22298_10033991 3300001990 Bacteria 1582
8 JGI24735J21928_10000032 3300002067 Bacteria 72360
9 JGI25162J39368_1000118 3300002737 Bacteria 87343
10 JGI25162J39368_1000562 3300002737 Bacteria 27227
11 JGI25152J39213_1000064 3300002773 Bacteria 70321
12 JGI25150J39212_1000004 3300002774 Bacteria 417320
13 JGI25151J46595_10000002 3300003187 Bacteria 731381
14 JGI25165J46597_1001048 3300003214 Bacteria 17982
15 JGI25153J46596_10000037 3300003215 Bacteria 182199
16 rootH1_10018888 3300003316 Bacteria 30592
17 rootH2_10012714 3300003320 Bacteria 66260
18 rootH2_10014716 3300003320 Bacteria 3412
19 rootH2_10117191 3300003320 Bacteria 7182
20 rootH1_10012646 3300003323 Bacteria 62371
21 rootH1_10035074 3300003323 Bacteria 5504
22 rootH1_10043364 3300003323 Bacteria 4672
23 Ga0055536_1000006 3300003781 Bacteria 347733
24 Ga0055530_10000821 3300003791 Bacteria 25754
25 Ga0058863_10892506 3300004799 Bacteria 1738
26 Ga0065714_10020272 3300005288 Bacteria 2002
27 Ga0065714_10064490 3300005288 Bacteria 50332
28 Ga0065714_10076361 3300005288 Bacteria 2800
29 Ga0065714_10173579 3300005288 Bacteria 993
30 Ga0070658_10000008 3300005327 Bacteria 319912
31 Ga0070658_10331844 3300005327 Bacteria 1300
32 Ga0070676_10004519 3300005328 Bacteria 7324
33 Ga0070683_100069198 3300005329 Bacteria 3290
34 Ga0070680_100086169 3300005336 Bacteria 2596
35 Ga0068868_100011149 3300005338 Bacteria 6544
36 Ga0070660_100005767 3300005339 Bacteria 8579
37 Ga0070660_100042674 3300005339 Bacteria 3463
38 Ga0070660_100071826 3300005339 Bacteria 2703
39 Ga0070674_100128142 3300005356 Bacteria 1888
40 Ga0070673_100002154 3300005364 Bacteria 11936
41 Ga0070659_100000868 3300005366 Bacteria 22078
42 Ga0070659_100083935 3300005366 Bacteria 2547
43 Ga0070667_100479796 3300005367 Bacteria 1138
44 Ga0070663_100016532 3300005455 Bacteria 4796
45 Ga0070678_100002196 3300005456 Bacteria 10611
46 Ga0070662_100000090 3300005457 Bacteria 49884
47 Ga0070681_10069613 3300005458 Bacteria 3485
48 Ga0068867_100004276 3300005459 Bacteria 10048
49 Ga0070679_100002981 3300005530 Bacteria 15450
50 Ga0068853_100033271 3300005539 Bacteria 4373
51 Ga0068853_100118422 3300005539 Bacteria 2360
52 Ga0070665_100000118 3300005548 Bacteria 149830
53 Ga0068855_100000049 3300005563 Bacteria 145321
54 Ga0068855_100011033 3300005563 Bacteria 10903
55 Ga0068855_100039086 3300005563 Bacteria 5633
56 Ga0068855_100042400 3300005563 Bacteria 5392
57 Ga0068856_100003614 3300005614 Bacteria 15546
58 Ga0068856_100008154 3300005614 Bacteria 10216
59 Ga0068856_100058680 3300005614 Bacteria 3801
60 Ga0068852_100013041 3300005616 Bacteria 6345
61 Ga0068858_100164959 3300005842 Bacteria 2087
62 Ga0068860_100789848 3300005843 Bacteria 962
63 Ga0075366_10000135 3300006195 Bacteria 30916
64 Ga0075366_10000556 3300006195 Bacteria 17427
65 Ga0075366_10001049 3300006195 Bacteria 13565
66 Ga0097621_100000015 3300006237 Bacteria 92182
67 Ga0068871_100000051 3300006358 Bacteria 64844
68 Ga0068865_100001125 3300006881 Bacteria 15478
69 Ga0105244_10072382 3300009036 Bacteria 1717
70 Ga0105240_10020637 3300009093 Bacteria 8782
71 Ga0105240_10103143 3300009093 Bacteria 3466
72 Ga0105240_10348238 3300009093 Bacteria 1681
73 Ga0105240_10352479 3300009093 Bacteria 1669
74 Ga0105240_10688939 3300009093 Bacteria 1117
75 Ga0105243_10135471 3300009148 Bacteria 2095
76 Ga0105243_10266061 3300009148 Bacteria 1537
77 Ga0105241_10000804 3300009174 Bacteria 23826
78 Ga0105241_10021267 3300009174 Bacteria 4794
79 Ga0105241_10062925 3300009174 Bacteria 2861
80 Ga0105241_10077581 3300009174 Bacteria 2594
81 Ga0105241_10435996 3300009174 Bacteria 1156
82 Ga0105242_10015307 3300009176 Bacteria 5957
83 Ga0105237_10000310 3300009545 Bacteria 67887
84 Ga0105237_10001895 3300009545 Bacteria 26705
85 Ga0105237_10002529 3300009545 Bacteria 22637
86 Ga0105237_10022235 3300009545 Bacteria 6507
87 Ga0105237_10025146 3300009545 Bacteria 6091
88 Ga0105237_10033945 3300009545 Bacteria 5169
89 Ga0105237_10205391 3300009545 Bacteria 1970
90 Ga0105238_10007593 3300009551 Bacteria 10864
91 Ga0105238_10027877 3300009551 Bacteria 5756
92 Ga0105239_10000049 3300010375 Bacteria 177578
93 Ga0105239_10000166 3300010375 Bacteria 94743
94 Ga0105239_10001978 3300010375 Bacteria 26646
95 Ga0105239_10005378 3300010375 Bacteria 15038
96 Ga0105239_10016298 3300010375 Bacteria 8217
97 Ga0105239_10078749 3300010375 Bacteria 3627
98 Ga0105239_10104269 3300010375 Bacteria 3140
99 Ga0105239_10142401 3300010375 Bacteria 2673
100 Ga0105239_10149353 3300010375 Bacteria 2608
101 Ga0105239_10205179 3300010375 Bacteria 2209
102 Ga0105239_10309835 3300010375 Bacteria 1779
103 Ga0105239_10463574 3300010375 Bacteria 1438
104 Ga0105246_10023425 3300011119 Bacteria 3995
105 Ga0157373_10000164 3300013100 Bacteria 53961
106 Ga0157373_10001332 3300013100 Bacteria 18906
107 Ga0157373_10054151 3300013100 Bacteria 2851
108 Ga0157373_10279811 3300013100 Bacteria 1182
109 Ga0157371_10000027 3300013102 Bacteria 269243
110 Ga0157371_10000107 3300013102 Bacteria 126477
111 Ga0157371_10001877 3300013102 Bacteria 21017
112 Ga0157371_10027834 3300013102 Bacteria 4096
113 Ga0157371_10045937 3300013102 Bacteria 3107
114 Ga0157371_10109897 3300013102 Bacteria 1957
115 Ga0157371_10394088 3300013102 Bacteria 1012
116 Ga0157370_10032727 3300013104 Bacteria 5075
117 Ga0157370_10034394 3300013104 Bacteria 4936
118 Ga0157370_10077392 3300013104 Bacteria 3133
119 Ga0157370_10272396 3300013104 Bacteria 1564
120 Ga0157370_10750347 3300013104 Bacteria 889
121 Ga0157369_10000053 3300013105 Bacteria 162962
122 Ga0157369_10003605 3300013105 Bacteria 18401
123 Ga0157369_10081766 3300013105 Bacteria 3457
124 Ga0157369_10189810 3300013105 Bacteria 2159
125 Ga0157369_10204332 3300013105 Bacteria 2072
126 Ga0157374_10000301 3300013296 Bacteria 45768
127 Ga0157374_10001665 3300013296 Bacteria 18606
128 Ga0157374_10003138 3300013296 Bacteria 13890
129 Ga0157378_10010959 3300013297 Bacteria 7931
130 Ga0157378_10017039 3300013297 Bacteria 6369
131 Ga0163162_10000012 3300013306 Bacteria 292674
132 Ga0163162_10000078 3300013306 Bacteria 89842
133 Ga0163162_10008113 3300013306 Bacteria 10246
134 Ga0163162_10110087 3300013306 Bacteria 2852
135 Ga0163162_10155561 3300013306 Bacteria 2406
136 Ga0163162_10752963 3300013306 Bacteria 1093
137 Ga0157372_10000039 3300013307 Bacteria 165839
138 Ga0157372_10000238 3300013307 Bacteria 60988
139 Ga0157372_10003139 3300013307 Bacteria 17808
140 Ga0157372_10008473 3300013307 Bacteria 10913
141 Ga0157372_10008724 3300013307 Bacteria 10767
142 Ga0157372_10048549 3300013307 Bacteria 4718
143 Ga0157372_10509223 3300013307 Bacteria 1403
144 Ga0157375_10003657 3300013308 Bacteria 13335
145 Ga0157375_10023127 3300013308 Bacteria 5730
146 Ga0157375_10239305 3300013308 Bacteria 1975
147 Ga0157375_10820680 3300013308 Bacteria 1078
148 Ga0157380_10000010 3300014326 Bacteria 140132
149 Ga0182008_10000334 3300014497 Bacteria 37000
150 Ga0157377_10017248 3300014745 Bacteria 3731
151 Ga0182006_1000755 3300015261 Bacteria 22108
152 Ga0182006_1000787 3300015261 Bacteria 21397
153 Ga0182007_10000005 3300015262 Bacteria 442702
154 Ga0183373_1007 3300015682 Bacteria 282776
155 Ga0163161_10001505 3300017792 Bacteria 17233
156 Ga0163161_10002901 3300017792 Bacteria 12132
157 Ga0163161_10033680 3300017792 Bacteria 3661
158 Ga0163161_10544308 3300017792 Bacteria 951
159 Ga0213872_10158873 3300021361 Bacteria 984
160 Ga0209563_105948 3300025230 Bacteria 2147
161 Ga0207427_100122 3300025231 Bacteria 99064
162 Ga0209437_100048 3300025233 Bacteria 405107
163 Ga0209437_100102 3300025233 Bacteria 224216
164 Ga0207425_1000003 3300025245 Bacteria 1145342
165 Ga0209026_1000250 3300025250 Bacteria 68451
166 Ga0209026_1002144 3300025250 Bacteria 7704
167 Ga0209026_1008720 3300025250 Bacteria 2081
168 Ga0209148_1010692 3300025254 Bacteria 1731
169 Ga0209129_1000022 3300025258 Bacteria 440876
170 Ga0209233_1000029 3300025261 Bacteria 641642
171 Ga0209233_1006134 3300025261 Bacteria 3907
172 Ga0209233_1007624 3300025261 Bacteria 3413
173 Ga0209455_1006449 3300025272 Bacteria 3458
174 Ga0209676_1000039 3300025292 Bacteria 443158
175 Ga0209025_1000007 3300025294 Bacteria 1145109
176 Ga0209758_1000012 3300025297 Bacteria 949866
177 Ga0209050_1000033 3300025298 Bacteria 442615
178 Ga0207647_10000018 3300025904 Bacteria 124816
179 Ga0207647_10000071 3300025904 Bacteria 79170
180 Ga0207647_10054010 3300025904 Bacteria 2473
181 Ga0207645_10000229 3300025907 Bacteria 46502
182 Ga0207705_10000026 3300025909 Bacteria 256051
183 Ga0207705_10379849 3300025909 Bacteria 1091
184 Ga0207654_10020440 3300025911 Bacteria 3509
185 Ga0207654_10091942 3300025911 Bacteria 1852
186 Ga0207654_10260363 3300025911 Bacteria 1166
187 Ga0207707_10053636 3300025912 Bacteria 3510
188 Ga0207695_10000053 3300025913 Bacteria 396740
189 Ga0207695_10003037 3300025913 Bacteria 24051
190 Ga0207695_10011545 3300025913 Bacteria 10687
191 Ga0207695_10029788 3300025913 Bacteria 6022
192 Ga0207695_10430480 3300025913 Bacteria 1203
193 Ga0207671_10002584 3300025914 Bacteria 19130
194 Ga0207671_10003225 3300025914 Bacteria 16410
195 Ga0207671_10006202 3300025914 Bacteria 10731
196 Ga0207671_10013292 3300025914 Bacteria 6565
197 Ga0207671_10045196 3300025914 Bacteria 3256
198 Ga0207671_10146697 3300025914 Bacteria 1821
199 Ga0207671_10149621 3300025914 Bacteria 1803
200 Ga0207671_10175813 3300025914 Bacteria 1664
201 Ga0207660_10122307 3300025917 Bacteria 1972
202 Ga0207657_10112313 3300025919 Bacteria 2249
203 Ga0207657_10133535 3300025919 Bacteria 2032
204 Ga0207694_10069007 3300025924 Bacteria 2761
205 Ga0207644_10418476 3300025931 Bacteria 1097
206 Ga0207690_10001163 3300025932 Bacteria 16661
207 Ga0207690_10021542 3300025932 Bacteria 3999
208 Ga0207706_10000718 3300025933 Bacteria 34581
209 Ga0207706_10181909 3300025933 Bacteria 1846
210 Ga0207704_10000047 3300025938 Bacteria 84386
211 Ga0207667_10000015 3300025949 Bacteria 417534
212 Ga0207667_10021180 3300025949 Bacteria 7209
213 Ga0207667_10024438 3300025949 Bacteria 6634
214 Ga0207667_10029785 3300025949 Bacteria 5914
215 Ga0207651_10040523 3300025960 Bacteria 3082
216 Ga0207703_10139008 3300026035 Bacteria 2106
217 Ga0207639_10023836 3300026041 Bacteria 4423
218 Ga0207639_10173995 3300026041 Bacteria 1826
219 Ga0207678_10022845 3300026067 Bacteria 5477
220 Ga0207702_10000163 3300026078 Bacteria 79263
221 Ga0207702_10101053 3300026078 Bacteria 2546
222 Ga0207648_10002322 3300026089 Bacteria 20530
223 Ga0207683_10003865 3300026121 Bacteria 13002
224 Ga0207698_10033736 3300026142 Bacteria 3723
225 Ga0268266_10000121 3300028379 Bacteria 154995
226 Ga0268264_10774861 3300028381 Bacteria 957
227 Ga0307517_10000198 3300028786 Bacteria 102181
228 Ga0307515_10002441 3300028794 Bacteria 40493
229 Ga0307515_10004266 3300028794 Bacteria 29673
230 Ga0265338_10001687 3300028800 Bacteria 35089
231 Ga0265338_10055426 3300028800 Bacteria 3526
232 Ga0316181_1198667 3300030744 Bacteria 1517
233 Ga0265327_10049171 3300031251 Bacteria 2213
234 Ga0307509_10153227 3300031507 Bacteria 2216
235 Ga0307408_100000464 3300031548 Bacteria 35518
236 Ga0307408_100001480 3300031548 Bacteria 17434
237 Ga0307408_100002318 3300031548 Bacteria 13499
238 Ga0307405_10000009 3300031731 Bacteria 259388
239 Ga0307407_10000001 3300031903 Bacteria 570048
240 Ga0307412_10545527 3300031911 Bacteria 973
241 Ga0307409_100256326 3300031995 Bacteria 1602
242 Ga0307416_100000008 3300032002 Bacteria 401343
243 Ga0307414_10000414 3300032004 Bacteria 23018
244 Ga0307414_10008454 3300032004 Bacteria 5836
245 Ga0307414_10080864 3300032004 Bacteria 2377
246 Ga0307414_10140827 3300032004 Bacteria 1888
247 Ga0307411_10069335 3300032005 Bacteria 2381
248 Ga0307411_10153783 3300032005 Bacteria 1713
249 Ga0307507_10000099 3300033179 Bacteria 139532
250 Ga0307510_10000417 3300033180 Bacteria 40763
251 Ga0395899_0000024 3300037312 Bacteria 357402
252 Ga0395899_0000027 3300037312 Bacteria 337387
253 Ga0395899_0000811 3300037312 Bacteria 30415
254 Ga0395899_0027895 3300037312 Bacteria 4253
255 Ga0395900_0000195 3300037418 Bacteria 97204
256 Ga0395900_0000275 3300037418 Bacteria 78207
257 Ga0395900_0023399 3300037418 Bacteria 6324
258 Ga0395898_0007299 3300037466 Bacteria 11734
259 Ga0395898_0064245 3300037466 Bacteria 3560
260 Ga0395905_0000248 3300037471 Bacteria 81042
261 Ga0395905_0000327 3300037471 Bacteria 68334
262 Ga0395901_0000595 3300038443 Bacteria 42132
263 Ga0395901_0022300 3300038443 Bacteria 6489
264 Ga0436361_0717383 3300039447 Bacteria 4352
265 Ga0451855_0125642 3300041511 Bacteria 1652
266 Ga0451855_0261717 3300041511 Bacteria 1013
267 Ga0451855_0276519 3300041511 Unclassified 1144
268 Ga0451855_1450819 3300041511 Bacteria 1175
269 Ga0451855_1871187 3300041511 Bacteria 1031
270 Ga0466969_0076188 3300044656 Bacteria 1607
271 Ga0466966_0003859 3300044684 Bacteria 9892
272 Ga0466961_0003771 3300044693 Bacteria 9476
273 Ga0453684_0218094 3300044712 Bacteria 2212
274 Ga0451576_0354072 3300045051 Bacteria 1537
275 Ga0495651_0060250 3300046462 Bacteria 2908
276 Ga0495650_0000231 3300046471 Bacteria 113969
277 Ga0495585_0000037 3300046492 Bacteria 133335
278 Ga0495585_0001999 3300046492 Bacteria 15127
279 Ga0495606_0000060 3300046507 Bacteria 185907
280 Ga0495606_0007003 3300046507 Bacteria 10236
281 Ga0495606_0027878 3300046507 Bacteria 3995
282 Ga0495606_0032528 3300046507 Bacteria 3612
283 Ga0495606_0039356 3300046507 Bacteria 3188
284 Ga0495606_0202852 3300046507 Bacteria 1129
285 Ga0495610_0000108 3300046512 Bacteria 96839
286 Ga0495610_0000129 3300046512 Bacteria 83051
287 Ga0495610_0001948 3300046512 Bacteria 17744
288 Ga0495610_0026963 3300046512 Bacteria 3061
289 Ga0495616_0004644 3300046513 Bacteria 8622
290 Ga0495616_0009675 3300046513 Bacteria 5619
291 Ga0495637_0005395 3300046520 Bacteria 6531
292 Ga0495637_0020065 3300046520 Bacteria 3079
293 Ga0495644_0014205 3300046523 Bacteria 3050
294 Ga0495648_0016132 3300046524 Bacteria 5390
295 Ga0495648_0042367 3300046524 Bacteria 2864
296 Ga0495652_0103263 3300046529 Bacteria 2308
297 Ga0495652_0489727 3300046529 Bacteria 854
298 Ga0495609_0003494 3300046538 Bacteria 8981
299 Ga0495622_0078880 3300046557 Bacteria 1516
300 Ga0495633_0000015 3300046558 Bacteria 254484
301 Ga0495633_0002945 3300046558 Bacteria 11649
302 Ga0495633_0035657 3300046558 Bacteria 2388
303 Ga0495668_0000041 3300046616 Bacteria 229462
304 Ga0495625_0000191 3300046660 Bacteria 97363
305 Ga0495625_0005486 3300046660 Bacteria 11552
306 Ga0495625_0013045 3300046660 Bacteria 6698
307 Ga0495625_0057804 3300046660 Bacteria 2757
308 Ga0495625_0131559 3300046660 Bacteria 1695
309 Ga0495661_0001963 3300046665 Bacteria 16326
310 Ga0495661_0042962 3300046665 Bacteria 2782
311 Ga0495661_0062627 3300046665 Bacteria 2202
312 Ga0495661_0155770 3300046665 Bacteria 1230
313 Ga0495669_0248744 3300046684 Bacteria 854
314 Ga0495671_0023370 3300046692 Bacteria 3230
315 Ga0495649_0000061 3300046694 Bacteria 97338
316 Ga0495649_0027276 3300046694 Bacteria 3170
317 Ga0495660_0029605 3300046810 Bacteria 3088
318 Ga0495660_0130013 3300046810 Bacteria 1264
319 Ga0495683_0048382 3300047323 Bacteria 2132
320 Ga0495687_000570 3300047443 Bacteria 43484
321 Ga0495687_009002 3300047443 Bacteria 5639
322 Ga0495681_0029764 3300047470 Bacteria 2790
323 Ga0495686_0003586 3300047472 Bacteria 13326
324 Ga0495686_0005173 3300047472 Bacteria 10386
325 Ga0495686_0006114 3300047472 Bacteria 9327
326 Ga0495686_0028108 3300047472 Bacteria 3664
327 Ga0495614_0103191 3300048089 Bacteria 1248
328 Ga0495678_005618 3300049459 Bacteria 6861
329 Ga0495682_0015181 3300049460 Bacteria 2919
330 Ga0495682_0036183 3300049460 Bacteria 1818
331 nmdc:mga0k408_1014_c1 3300050493 Bacteria 15426
332 nmdc:mga0k408_2072_c1 3300050493 Bacteria 10731
333 nmdc:mga0k408_31_c1 3300050493 Bacteria 85612
334 Ga0500635_0001560 3300053080 Bacteria 5512
335 Ga0500635_0051947 3300053080 Bacteria 1406
336 Ga0500647_0102081 3300053091 Bacteria 1369
337 Ga0500608_016821 3300053122 Bacteria 3311
338 Ga0500608_017923 3300053122 Bacteria 3223
339 Ga0500618_000016 3300053125 Bacteria 164049
340 Ga0500642_0116863 3300053130 Bacteria 1246
341 Ga0500622_0002531 3300053156 Bacteria 13125
342 Ga0500624_000583 3300053157 Bacteria 10075
343 2586206971 2585427687 Bacteria 5544917
344 2599481410 2599185184 Bacteria 6430550
345 2738854604 2738541302 Bacteria 5944758
346 2739587115 2739367651 Bacteria 6359826
347 2739615214 2739367656 Bacteria 5152243
348 2739645661 2739367663 Bacteria 5040914
349 2819547580 2818991437 Bacteria 5805520
350 2842726594 2842722452 Bacteria 6263924
351 2842911438 2842909656 Bacteria 6185908
352 2849284216 2849281842 Bacteria 6065644
353 2852627054 2852623160 Bacteria 4376875
354 2857627821 2857627736 Bacteria 5625397
355 2884935212 2884933994 Bacteria 4535041
356 2904449017 2904445276 Bacteria 5310396
357 2919443069 2919437846 Bacteria 6199444
358 2928083295 2928078545 Bacteria 6534839
359 2928152757 2928147474 Bacteria 6512076
360 2932088281 2932082852 Bacteria 6563563
361 2946003104 2945997725 Bacteria 6404843
362 2954019963 2954016120 Bacteria 6446024
363 2977234001 2977232053 Bacteria 5485925
364 Ga0105240_10535137
365 JGI24741J21665_1010803
366 JGI24740J21852_10033607
367 JGI24739J22299_10001167
368 JGI24739J22299_10004465
369 JGI24737J22298_10000060
370 JGI24737J22298_10033991
371 JGI24735J21928_10000032
372 JGI25162J39368_1000118
373 JGI25162J39368_1000562
374 JGI25152J39213_1000064
375 JGI25150J39212_1000004
376 JGI25151J46595_10000002
377 JGI25165J46597_1001048
378 JGI25153J46596_10000037
379 rootH1_10018888
380 rootH2_10012714
381 rootH2_10014716
382 rootH2_10117191
383 rootH1_10012646
384 rootH1_10035074
385 rootH1_10043364
386 Ga0055536_1000006
387 Ga0055530_10000821
388 Ga0058863_10892506
389 Ga0065714_10020272
390 Ga0065714_10064490
391 Ga0065714_10076361
392 Ga0065714_10173579
393 Ga0070658_10000008
394 Ga0070658_10331844
395 Ga0070676_10004519
396 Ga0070683_100069198
397 Ga0070680_100086169
398 Ga0068868_100011149
399 Ga0070660_100005767
400 Ga0070660_100042674
401 Ga0070660_100071826
402 Ga0070674_100128142
403 Ga0070673_100002154
404 Ga0070659_100000868
405 Ga0070659_100083935
406 Ga0070667_100479796
407 Ga0070663_100016532
408 Ga0070678_100002196
409 Ga0070662_100000090
410 Ga0070681_10069613
411 Ga0068867_100004276
412 Ga0070679_100002981
413 Ga0068853_100033271
414 Ga0068853_100118422
415 Ga0070665_100000118
416 Ga0068855_100000049
417 Ga0068855_100011033
418 Ga0068855_100039086
419 Ga0068855_100042400
420 Ga0068856_100003614
421 Ga0068856_100008154
422 Ga0068856_100058680
423 Ga0068852_100013041
424 Ga0068858_100164959
425 Ga0068860_100789848
426 Ga0075366_10000135
427 Ga0075366_10000556
428 Ga0075366_10001049
429 Ga0097621_100000015
430 Ga0068871_100000051
431 Ga0068865_100001125
432 Ga0105244_10072382
433 Ga0105240_10020637
434 Ga0105240_10103143
435 Ga0105240_10348238
436 Ga0105240_10352479
437 Ga0105240_10688939
438 Ga0105243_10135471
439 Ga0105243_10266061
440 Ga0105241_10000804
441 Ga0105241_10021267
442 Ga0105241_10062925
443 Ga0105241_10077581
444 Ga0105241_10435996
445 Ga0105242_10015307
446 Ga0105237_10000310
447 Ga0105237_10001895
448 Ga0105237_10002529
449 Ga0105237_10022235
450 Ga0105237_10025146
451 Ga0105237_10033945
452 Ga0105237_10205391
453 Ga0105238_10007593
454 Ga0105238_10027877
455 Ga0105239_10000049
456 Ga0105239_10000166
457 Ga0105239_10001978
458 Ga0105239_10005378
459 Ga0105239_10016298
460 Ga0105239_10078749
461 Ga0105239_10104269
462 Ga0105239_10142401
463 Ga0105239_10149353
464 Ga0105239_10205179
465 Ga0105239_10309835
466 Ga0105239_10463574
467 Ga0105246_10023425
468 Ga0157373_10000164
469 Ga0157373_10001332
470 Ga0157373_10054151
471 Ga0157373_10279811
472 Ga0157371_10000027
473 Ga0157371_10000107
474 Ga0157371_10001877
475 Ga0157371_10027834
476 Ga0157371_10045937
477 Ga0157371_10109897
478 Ga0157371_10394088
479 Ga0157370_10032727
480 Ga0157370_10034394
481 Ga0157370_10077392
482 Ga0157370_10272396
483 Ga0157370_10750347
484 Ga0157369_10000053
485 Ga0157369_10003605
486 Ga0157369_10081766
487 Ga0157369_10189810
488 Ga0157369_10204332
489 Ga0157374_10000301
490 Ga0157374_10001665
491 Ga0157374_10003138
492 Ga0157378_10010959
493 Ga0157378_10017039
494 Ga0163162_10000012
495 Ga0163162_10000078
496 Ga0163162_10008113
497 Ga0163162_10110087
498 Ga0163162_10155561
499 Ga0163162_10752963
500 Ga0157372_10000039
501 Ga0157372_10000238
502 Ga0157372_10003139
503 Ga0157372_10008473
504 Ga0157372_10008724
505 Ga0157372_10048549
506 Ga0157372_10509223
507 Ga0157375_10003657
508 Ga0157375_10023127
509 Ga0157375_10239305
510 Ga0157375_10820680
511 Ga0157380_10000010
512 Ga0182008_10000334
513 Ga0157377_10017248
514 Ga0182006_1000755
515 Ga0182006_1000787
516 Ga0182007_10000005
517 Ga0183373_1007
518 Ga0163161_10001505
519 Ga0163161_10002901
520 Ga0163161_10033680
521 Ga0163161_10544308
522 Ga0213872_10158873
523 Ga0209563_105948
524 Ga0207427_100122
525 Ga0209437_100048
526 Ga0209437_100102
527 Ga0207425_1000003
528 Ga0209026_1000250
529 Ga0209026_1002144
530 Ga0209026_1008720
531 Ga0209148_1010692
532 Ga0209129_1000022
533 Ga0209233_1000029
534 Ga0209233_1006134
535 Ga0209233_1007624
536 Ga0209455_1006449
537 Ga0209676_1000039
538 Ga0209025_1000007
539 Ga0209758_1000012
540 Ga0209050_1000033
541 Ga0207647_10000018
542 Ga0207647_10000071
543 Ga0207647_10054010
544 Ga0207645_10000229
545 Ga0207705_10000026
546 Ga0207705_10379849
547 Ga0207654_10020440
548 Ga0207654_10091942
549 Ga0207654_10260363
550 Ga0207707_10053636
551 Ga0207695_10000053
552 Ga0207695_10003037
553 Ga0207695_10011545
554 Ga0207695_10029788
555 Ga0207695_10430480
556 Ga0207671_10002584
557 Ga0207671_10003225
558 Ga0207671_10006202
559 Ga0207671_10013292
560 Ga0207671_10045196
561 Ga0207671_10146697
562 Ga0207671_10149621
563 Ga0207671_10175813
564 Ga0207660_10122307
565 Ga0207657_10112313
566 Ga0207657_10133535
567 Ga0207694_10069007
568 Ga0207644_10418476
569 Ga0207690_10001163
570 Ga0207690_10021542
571 Ga0207706_10000718
572 Ga0207706_10181909
573 Ga0207704_10000047
574 Ga0207667_10000015
575 Ga0207667_10021180
576 Ga0207667_10024438
577 Ga0207667_10029785
578 Ga0207651_10040523
579 Ga0207703_10139008
580 Ga0207639_10023836
581 Ga0207639_10173995
582 Ga0207678_10022845
583 Ga0207702_10000163
584 Ga0207702_10101053
585 Ga0207648_10002322
586 Ga0207683_10003865
587 Ga0207698_10033736
588 Ga0268266_10000121
589 Ga0268264_10774861
590 Ga0307517_10000198
591 Ga0307515_10002441
592 Ga0307515_10004266
593 Ga0265338_10001687
594 Ga0265338_10055426
595 Ga0316181_1198667
596 Ga0265327_10049171
597 Ga0307509_10153227
598 Ga0307408_100000464
599 Ga0307408_100001480
600 Ga0307408_100002318
601 Ga0307405_10000009
602 Ga0307407_10000001
603 Ga0307412_10545527
604 Ga0307409_100256326
605 Ga0307416_100000008
606 Ga0307414_10000414
607 Ga0307414_10008454
608 Ga0307414_10080864
609 Ga0307414_10140827
610 Ga0307411_10069335
611 Ga0307411_10153783
612 Ga0307507_10000099
613 Ga0307510_10000417
614 Ga0395899_0000024
615 Ga0395899_0000027
616 Ga0395899_0000811
617 Ga0395899_0027895
618 Ga0395900_0000195
619 Ga0395900_0000275
620 Ga0395900_0023399
621 Ga0395898_0007299
622 Ga0395898_0064245
623 Ga0395905_0000248
624 Ga0395905_0000327
625 Ga0395901_0000595
626 Ga0395901_0022300
627 Ga0436361_0717383
628 Ga0451855_0125642
629 Ga0451855_0261717
630 Ga0451855_0276519
631 Ga0451855_1450819
632 Ga0451855_1871187
633 Ga0466969_0076188
634 Ga0466966_0003859
635 Ga0466961_0003771
636 Ga0453684_0218094
637 Ga0451576_0354072
638 Ga0495651_0060250
639 Ga0495650_0000231
640 Ga0495585_0000037
641 Ga0495585_0001999
642 Ga0495606_0000060
643 Ga0495606_0007003
644 Ga0495606_0027878
645 Ga0495606_0032528
646 Ga0495606_0039356
647 Ga0495606_0202852
648 Ga0495610_0000108
649 Ga0495610_0000129
650 Ga0495610_0001948
651 Ga0495610_0026963
652 Ga0495616_0004644
653 Ga0495616_0009675
654 Ga0495637_0005395
655 Ga0495637_0020065
656 Ga0495644_0014205
657 Ga0495648_0016132
658 Ga0495648_0042367
659 Ga0495652_0103263
660 Ga0495652_0489727
661 Ga0495609_0003494
662 Ga0495622_0078880
663 Ga0495633_0000015
664 Ga0495633_0002945
665 Ga0495633_0035657
666 Ga0495668_0000041
667 Ga0495625_0000191
668 Ga0495625_0005486
669 Ga0495625_0013045
670 Ga0495625_0057804
671 Ga0495625_0131559
672 Ga0495661_0001963
673 Ga0495661_0042962
674 Ga0495661_0062627
675 Ga0495661_0155770
676 Ga0495669_0248744
677 Ga0495671_0023370
678 Ga0495649_0000061
679 Ga0495649_0027276
680 Ga0495660_0029605
681 Ga0495660_0130013
682 Ga0495683_0048382
683 Ga0495687_000570
684 Ga0495687_009002
685 Ga0495681_0029764
686 Ga0495686_0003586
687 Ga0495686_0005173
688 Ga0495686_0006114
689 Ga0495686_0028108
690 Ga0495614_0103191
691 Ga0495678_005618
692 Ga0495682_0015181
693 Ga0495682_0036183
694 nmdc:mga0k408_1014_c1
695 nmdc:mga0k408_2072_c1
696 nmdc:mga0k408_31_c1
697 Ga0500635_0001560
698 Ga0500635_0051947
699 Ga0500647_0102081
700 Ga0500608_016821
701 Ga0500608_017923
702 Ga0500618_000016
703 Ga0500642_0116863
704 Ga0500622_0002531
705 Ga0500624_000583
706 2586206971
707 2599481410
708 2738854604
709 2739587115
710 2739615214
711 2739645661
712 2819547580
713 2842726594
714 2842911438
715 2849284216
716 2852627054
717 2857627821
718 2884935212
719 2904449017
720 2919443069
721 2928083295
722 2928152757
723 2932088281
724 2946003104
725 2954019963
726 2977234001

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04452

Methyltrans_RNA

RNA methyltransferase domain

83

241

0.91

PF20260

PUA_4

RNA methyltransferase PUA domain

29

76

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kw2-assembly1.cif.gz_B crystal structure of probable rrna-methyltransferase from porphyromonas gingivalis 0.9272 1 234
3kw2-assembly1.cif.gz_B crystal structure of probable rrna-methyltransferase from porphyromonas gingivalis 0.9196 1 234
1nxz-assembly1.cif.gz_B x-ray crystal structure of protein yggj_haein of haemophilus influenzae. northeast structural genomics consortium target ir73. 0.8986 1 233
4e8b-assembly1.cif.gz_A crystal structure of 16s rrna methyltransferase rsme from e.coli 0.8948 1 234
5o96-assembly4.cif.gz_G structure of the putative methyltransferase lpg2936 from legionella pneumophila in complex with the bound cofactor sam 0.889 3 232
ID Description Score Start End Superfamily
1vhyA01 Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Hypothetical PUA domain-like; domain 1 0.9436 1 67 2.40.240.20
3kw2B02 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9418 76 234 3.40.1280.10
5o96E02 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9237 75 232 3.40.1280.10
2cx8A02 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9217 75 230 3.40.1280.10
af_Q54SC0_1_67_2.40.240.20 Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Hypothetical PUA domain-like; domain 1 0.9115 1 66 2.40.240.20
ID Description Score Start End GO Terms
AF-A0A2N2YTR1-F1-model_v4 16S rRNA (uracil(1498)-N(3))-methyltransferase (EC 2.1.1.193) 0.987 50 235 GO:0005737
GO:0070042
GO:0070475
AF-A0A350YTM8-F1-model_v4 Ribosomal RNA small subunit methyltransferase E (EC 2.1.1.193) 0.9837 1 235 GO:0005737
GO:0070042
GO:0070475
AF-A0A847XQZ7-F1-model_v4 16S rRNA (uracil(1498)-N(3))-methyltransferase (EC 2.1.1.193) 0.9821 104 235 GO:0005737
GO:0070042
GO:0070475
AF-A0A7V4GYM8-F1-model_v4 16S rRNA (uracil(1498)-N(3))-methyltransferase (EC 2.1.1.193) 0.9815 90 235 GO:0005737
GO:0070042
GO:0070475
AF-A0A6H9PNG6-F1-model_v4 deleted 0.9797 63 235

Map