F422933
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 363 | 193 | 726 | 234 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10535137|Ga0105240_105351372 |
| Length | 247 |
| Sequence | LALSLKLSAFDFMLFYTPDIAPSHPQYFLSEEESKHAIRVLRLEAGSEVQLIDGRGGFYTAVIQDAHPKRTILQITSVTENYNKRNHYLHLAVAPTKNVERLEWFLEKATEIGIDEISLIISQRSERKEAKTDRLNKIITAAIKQSLKAYHPVLNEPVKLNELLSRPFDGQKYIAHCEPGDKLGLRNDLQLQGRCLILIGPEGDFTPAEIESALQNGFKPITLGESRLRTETAALEACFEVNFLNRV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 8 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 9 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 10 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 11 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 12 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 13 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 14 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 15 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 16 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 19 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 42 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 43 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 44 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 46 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 47 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 66 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 68 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 69 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 70 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 72 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 76 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 77 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 79 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 111 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 112 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 113 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 114 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 115 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 116 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 117 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 118 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 119 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 120 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 121 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 122 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 123 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 124 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 125 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 126 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 127 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 128 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 129 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 130 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 131 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 132 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 133 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 134 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 135 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 136 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 137 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 138 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 166 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 167 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 168 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 169 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 170 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 171 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 172 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 173 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 174 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 175 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 176 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 177 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 178 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 179 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 180 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 181 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 182 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 183 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 184 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 185 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 186 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 187 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 188 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 189 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 190 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 191 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 192 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 193 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.94 |
| Metatranscriptomes | 0.28 |
| Isolates | 5.79 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.74 |
| Nodule | 0 |
| Rhizoplane | 0.28 |
| Rhizosphere | 80.17 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105240_10535137 | 3300009093 | Bacteria | 1298 |
| 2 | JGI24741J21665_1010803 | 3300001915 | Bacteria | 1618 |
| 3 | JGI24740J21852_10033607 | 3300001979 | Bacteria | 1626 |
| 4 | JGI24739J22299_10001167 | 3300001989 | Bacteria | 9825 |
| 5 | JGI24739J22299_10004465 | 3300001989 | Bacteria | 5360 |
| 6 | JGI24737J22298_10000060 | 3300001990 | Bacteria | 32592 |
| 7 | JGI24737J22298_10033991 | 3300001990 | Bacteria | 1582 |
| 8 | JGI24735J21928_10000032 | 3300002067 | Bacteria | 72360 |
| 9 | JGI25162J39368_1000118 | 3300002737 | Bacteria | 87343 |
| 10 | JGI25162J39368_1000562 | 3300002737 | Bacteria | 27227 |
| 11 | JGI25152J39213_1000064 | 3300002773 | Bacteria | 70321 |
| 12 | JGI25150J39212_1000004 | 3300002774 | Bacteria | 417320 |
| 13 | JGI25151J46595_10000002 | 3300003187 | Bacteria | 731381 |
| 14 | JGI25165J46597_1001048 | 3300003214 | Bacteria | 17982 |
| 15 | JGI25153J46596_10000037 | 3300003215 | Bacteria | 182199 |
| 16 | rootH1_10018888 | 3300003316 | Bacteria | 30592 |
| 17 | rootH2_10012714 | 3300003320 | Bacteria | 66260 |
| 18 | rootH2_10014716 | 3300003320 | Bacteria | 3412 |
| 19 | rootH2_10117191 | 3300003320 | Bacteria | 7182 |
| 20 | rootH1_10012646 | 3300003323 | Bacteria | 62371 |
| 21 | rootH1_10035074 | 3300003323 | Bacteria | 5504 |
| 22 | rootH1_10043364 | 3300003323 | Bacteria | 4672 |
| 23 | Ga0055536_1000006 | 3300003781 | Bacteria | 347733 |
| 24 | Ga0055530_10000821 | 3300003791 | Bacteria | 25754 |
| 25 | Ga0058863_10892506 | 3300004799 | Bacteria | 1738 |
| 26 | Ga0065714_10020272 | 3300005288 | Bacteria | 2002 |
| 27 | Ga0065714_10064490 | 3300005288 | Bacteria | 50332 |
| 28 | Ga0065714_10076361 | 3300005288 | Bacteria | 2800 |
| 29 | Ga0065714_10173579 | 3300005288 | Bacteria | 993 |
| 30 | Ga0070658_10000008 | 3300005327 | Bacteria | 319912 |
| 31 | Ga0070658_10331844 | 3300005327 | Bacteria | 1300 |
| 32 | Ga0070676_10004519 | 3300005328 | Bacteria | 7324 |
| 33 | Ga0070683_100069198 | 3300005329 | Bacteria | 3290 |
| 34 | Ga0070680_100086169 | 3300005336 | Bacteria | 2596 |
| 35 | Ga0068868_100011149 | 3300005338 | Bacteria | 6544 |
| 36 | Ga0070660_100005767 | 3300005339 | Bacteria | 8579 |
| 37 | Ga0070660_100042674 | 3300005339 | Bacteria | 3463 |
| 38 | Ga0070660_100071826 | 3300005339 | Bacteria | 2703 |
| 39 | Ga0070674_100128142 | 3300005356 | Bacteria | 1888 |
| 40 | Ga0070673_100002154 | 3300005364 | Bacteria | 11936 |
| 41 | Ga0070659_100000868 | 3300005366 | Bacteria | 22078 |
| 42 | Ga0070659_100083935 | 3300005366 | Bacteria | 2547 |
| 43 | Ga0070667_100479796 | 3300005367 | Bacteria | 1138 |
| 44 | Ga0070663_100016532 | 3300005455 | Bacteria | 4796 |
| 45 | Ga0070678_100002196 | 3300005456 | Bacteria | 10611 |
| 46 | Ga0070662_100000090 | 3300005457 | Bacteria | 49884 |
| 47 | Ga0070681_10069613 | 3300005458 | Bacteria | 3485 |
| 48 | Ga0068867_100004276 | 3300005459 | Bacteria | 10048 |
| 49 | Ga0070679_100002981 | 3300005530 | Bacteria | 15450 |
| 50 | Ga0068853_100033271 | 3300005539 | Bacteria | 4373 |
| 51 | Ga0068853_100118422 | 3300005539 | Bacteria | 2360 |
| 52 | Ga0070665_100000118 | 3300005548 | Bacteria | 149830 |
| 53 | Ga0068855_100000049 | 3300005563 | Bacteria | 145321 |
| 54 | Ga0068855_100011033 | 3300005563 | Bacteria | 10903 |
| 55 | Ga0068855_100039086 | 3300005563 | Bacteria | 5633 |
| 56 | Ga0068855_100042400 | 3300005563 | Bacteria | 5392 |
| 57 | Ga0068856_100003614 | 3300005614 | Bacteria | 15546 |
| 58 | Ga0068856_100008154 | 3300005614 | Bacteria | 10216 |
| 59 | Ga0068856_100058680 | 3300005614 | Bacteria | 3801 |
| 60 | Ga0068852_100013041 | 3300005616 | Bacteria | 6345 |
| 61 | Ga0068858_100164959 | 3300005842 | Bacteria | 2087 |
| 62 | Ga0068860_100789848 | 3300005843 | Bacteria | 962 |
| 63 | Ga0075366_10000135 | 3300006195 | Bacteria | 30916 |
| 64 | Ga0075366_10000556 | 3300006195 | Bacteria | 17427 |
| 65 | Ga0075366_10001049 | 3300006195 | Bacteria | 13565 |
| 66 | Ga0097621_100000015 | 3300006237 | Bacteria | 92182 |
| 67 | Ga0068871_100000051 | 3300006358 | Bacteria | 64844 |
| 68 | Ga0068865_100001125 | 3300006881 | Bacteria | 15478 |
| 69 | Ga0105244_10072382 | 3300009036 | Bacteria | 1717 |
| 70 | Ga0105240_10020637 | 3300009093 | Bacteria | 8782 |
| 71 | Ga0105240_10103143 | 3300009093 | Bacteria | 3466 |
| 72 | Ga0105240_10348238 | 3300009093 | Bacteria | 1681 |
| 73 | Ga0105240_10352479 | 3300009093 | Bacteria | 1669 |
| 74 | Ga0105240_10688939 | 3300009093 | Bacteria | 1117 |
| 75 | Ga0105243_10135471 | 3300009148 | Bacteria | 2095 |
| 76 | Ga0105243_10266061 | 3300009148 | Bacteria | 1537 |
| 77 | Ga0105241_10000804 | 3300009174 | Bacteria | 23826 |
| 78 | Ga0105241_10021267 | 3300009174 | Bacteria | 4794 |
| 79 | Ga0105241_10062925 | 3300009174 | Bacteria | 2861 |
| 80 | Ga0105241_10077581 | 3300009174 | Bacteria | 2594 |
| 81 | Ga0105241_10435996 | 3300009174 | Bacteria | 1156 |
| 82 | Ga0105242_10015307 | 3300009176 | Bacteria | 5957 |
| 83 | Ga0105237_10000310 | 3300009545 | Bacteria | 67887 |
| 84 | Ga0105237_10001895 | 3300009545 | Bacteria | 26705 |
| 85 | Ga0105237_10002529 | 3300009545 | Bacteria | 22637 |
| 86 | Ga0105237_10022235 | 3300009545 | Bacteria | 6507 |
| 87 | Ga0105237_10025146 | 3300009545 | Bacteria | 6091 |
| 88 | Ga0105237_10033945 | 3300009545 | Bacteria | 5169 |
| 89 | Ga0105237_10205391 | 3300009545 | Bacteria | 1970 |
| 90 | Ga0105238_10007593 | 3300009551 | Bacteria | 10864 |
| 91 | Ga0105238_10027877 | 3300009551 | Bacteria | 5756 |
| 92 | Ga0105239_10000049 | 3300010375 | Bacteria | 177578 |
| 93 | Ga0105239_10000166 | 3300010375 | Bacteria | 94743 |
| 94 | Ga0105239_10001978 | 3300010375 | Bacteria | 26646 |
| 95 | Ga0105239_10005378 | 3300010375 | Bacteria | 15038 |
| 96 | Ga0105239_10016298 | 3300010375 | Bacteria | 8217 |
| 97 | Ga0105239_10078749 | 3300010375 | Bacteria | 3627 |
| 98 | Ga0105239_10104269 | 3300010375 | Bacteria | 3140 |
| 99 | Ga0105239_10142401 | 3300010375 | Bacteria | 2673 |
| 100 | Ga0105239_10149353 | 3300010375 | Bacteria | 2608 |
| 101 | Ga0105239_10205179 | 3300010375 | Bacteria | 2209 |
| 102 | Ga0105239_10309835 | 3300010375 | Bacteria | 1779 |
| 103 | Ga0105239_10463574 | 3300010375 | Bacteria | 1438 |
| 104 | Ga0105246_10023425 | 3300011119 | Bacteria | 3995 |
| 105 | Ga0157373_10000164 | 3300013100 | Bacteria | 53961 |
| 106 | Ga0157373_10001332 | 3300013100 | Bacteria | 18906 |
| 107 | Ga0157373_10054151 | 3300013100 | Bacteria | 2851 |
| 108 | Ga0157373_10279811 | 3300013100 | Bacteria | 1182 |
| 109 | Ga0157371_10000027 | 3300013102 | Bacteria | 269243 |
| 110 | Ga0157371_10000107 | 3300013102 | Bacteria | 126477 |
| 111 | Ga0157371_10001877 | 3300013102 | Bacteria | 21017 |
| 112 | Ga0157371_10027834 | 3300013102 | Bacteria | 4096 |
| 113 | Ga0157371_10045937 | 3300013102 | Bacteria | 3107 |
| 114 | Ga0157371_10109897 | 3300013102 | Bacteria | 1957 |
| 115 | Ga0157371_10394088 | 3300013102 | Bacteria | 1012 |
| 116 | Ga0157370_10032727 | 3300013104 | Bacteria | 5075 |
| 117 | Ga0157370_10034394 | 3300013104 | Bacteria | 4936 |
| 118 | Ga0157370_10077392 | 3300013104 | Bacteria | 3133 |
| 119 | Ga0157370_10272396 | 3300013104 | Bacteria | 1564 |
| 120 | Ga0157370_10750347 | 3300013104 | Bacteria | 889 |
| 121 | Ga0157369_10000053 | 3300013105 | Bacteria | 162962 |
| 122 | Ga0157369_10003605 | 3300013105 | Bacteria | 18401 |
| 123 | Ga0157369_10081766 | 3300013105 | Bacteria | 3457 |
| 124 | Ga0157369_10189810 | 3300013105 | Bacteria | 2159 |
| 125 | Ga0157369_10204332 | 3300013105 | Bacteria | 2072 |
| 126 | Ga0157374_10000301 | 3300013296 | Bacteria | 45768 |
| 127 | Ga0157374_10001665 | 3300013296 | Bacteria | 18606 |
| 128 | Ga0157374_10003138 | 3300013296 | Bacteria | 13890 |
| 129 | Ga0157378_10010959 | 3300013297 | Bacteria | 7931 |
| 130 | Ga0157378_10017039 | 3300013297 | Bacteria | 6369 |
| 131 | Ga0163162_10000012 | 3300013306 | Bacteria | 292674 |
| 132 | Ga0163162_10000078 | 3300013306 | Bacteria | 89842 |
| 133 | Ga0163162_10008113 | 3300013306 | Bacteria | 10246 |
| 134 | Ga0163162_10110087 | 3300013306 | Bacteria | 2852 |
| 135 | Ga0163162_10155561 | 3300013306 | Bacteria | 2406 |
| 136 | Ga0163162_10752963 | 3300013306 | Bacteria | 1093 |
| 137 | Ga0157372_10000039 | 3300013307 | Bacteria | 165839 |
| 138 | Ga0157372_10000238 | 3300013307 | Bacteria | 60988 |
| 139 | Ga0157372_10003139 | 3300013307 | Bacteria | 17808 |
| 140 | Ga0157372_10008473 | 3300013307 | Bacteria | 10913 |
| 141 | Ga0157372_10008724 | 3300013307 | Bacteria | 10767 |
| 142 | Ga0157372_10048549 | 3300013307 | Bacteria | 4718 |
| 143 | Ga0157372_10509223 | 3300013307 | Bacteria | 1403 |
| 144 | Ga0157375_10003657 | 3300013308 | Bacteria | 13335 |
| 145 | Ga0157375_10023127 | 3300013308 | Bacteria | 5730 |
| 146 | Ga0157375_10239305 | 3300013308 | Bacteria | 1975 |
| 147 | Ga0157375_10820680 | 3300013308 | Bacteria | 1078 |
| 148 | Ga0157380_10000010 | 3300014326 | Bacteria | 140132 |
| 149 | Ga0182008_10000334 | 3300014497 | Bacteria | 37000 |
| 150 | Ga0157377_10017248 | 3300014745 | Bacteria | 3731 |
| 151 | Ga0182006_1000755 | 3300015261 | Bacteria | 22108 |
| 152 | Ga0182006_1000787 | 3300015261 | Bacteria | 21397 |
| 153 | Ga0182007_10000005 | 3300015262 | Bacteria | 442702 |
| 154 | Ga0183373_1007 | 3300015682 | Bacteria | 282776 |
| 155 | Ga0163161_10001505 | 3300017792 | Bacteria | 17233 |
| 156 | Ga0163161_10002901 | 3300017792 | Bacteria | 12132 |
| 157 | Ga0163161_10033680 | 3300017792 | Bacteria | 3661 |
| 158 | Ga0163161_10544308 | 3300017792 | Bacteria | 951 |
| 159 | Ga0213872_10158873 | 3300021361 | Bacteria | 984 |
| 160 | Ga0209563_105948 | 3300025230 | Bacteria | 2147 |
| 161 | Ga0207427_100122 | 3300025231 | Bacteria | 99064 |
| 162 | Ga0209437_100048 | 3300025233 | Bacteria | 405107 |
| 163 | Ga0209437_100102 | 3300025233 | Bacteria | 224216 |
| 164 | Ga0207425_1000003 | 3300025245 | Bacteria | 1145342 |
| 165 | Ga0209026_1000250 | 3300025250 | Bacteria | 68451 |
| 166 | Ga0209026_1002144 | 3300025250 | Bacteria | 7704 |
| 167 | Ga0209026_1008720 | 3300025250 | Bacteria | 2081 |
| 168 | Ga0209148_1010692 | 3300025254 | Bacteria | 1731 |
| 169 | Ga0209129_1000022 | 3300025258 | Bacteria | 440876 |
| 170 | Ga0209233_1000029 | 3300025261 | Bacteria | 641642 |
| 171 | Ga0209233_1006134 | 3300025261 | Bacteria | 3907 |
| 172 | Ga0209233_1007624 | 3300025261 | Bacteria | 3413 |
| 173 | Ga0209455_1006449 | 3300025272 | Bacteria | 3458 |
| 174 | Ga0209676_1000039 | 3300025292 | Bacteria | 443158 |
| 175 | Ga0209025_1000007 | 3300025294 | Bacteria | 1145109 |
| 176 | Ga0209758_1000012 | 3300025297 | Bacteria | 949866 |
| 177 | Ga0209050_1000033 | 3300025298 | Bacteria | 442615 |
| 178 | Ga0207647_10000018 | 3300025904 | Bacteria | 124816 |
| 179 | Ga0207647_10000071 | 3300025904 | Bacteria | 79170 |
| 180 | Ga0207647_10054010 | 3300025904 | Bacteria | 2473 |
| 181 | Ga0207645_10000229 | 3300025907 | Bacteria | 46502 |
| 182 | Ga0207705_10000026 | 3300025909 | Bacteria | 256051 |
| 183 | Ga0207705_10379849 | 3300025909 | Bacteria | 1091 |
| 184 | Ga0207654_10020440 | 3300025911 | Bacteria | 3509 |
| 185 | Ga0207654_10091942 | 3300025911 | Bacteria | 1852 |
| 186 | Ga0207654_10260363 | 3300025911 | Bacteria | 1166 |
| 187 | Ga0207707_10053636 | 3300025912 | Bacteria | 3510 |
| 188 | Ga0207695_10000053 | 3300025913 | Bacteria | 396740 |
| 189 | Ga0207695_10003037 | 3300025913 | Bacteria | 24051 |
| 190 | Ga0207695_10011545 | 3300025913 | Bacteria | 10687 |
| 191 | Ga0207695_10029788 | 3300025913 | Bacteria | 6022 |
| 192 | Ga0207695_10430480 | 3300025913 | Bacteria | 1203 |
| 193 | Ga0207671_10002584 | 3300025914 | Bacteria | 19130 |
| 194 | Ga0207671_10003225 | 3300025914 | Bacteria | 16410 |
| 195 | Ga0207671_10006202 | 3300025914 | Bacteria | 10731 |
| 196 | Ga0207671_10013292 | 3300025914 | Bacteria | 6565 |
| 197 | Ga0207671_10045196 | 3300025914 | Bacteria | 3256 |
| 198 | Ga0207671_10146697 | 3300025914 | Bacteria | 1821 |
| 199 | Ga0207671_10149621 | 3300025914 | Bacteria | 1803 |
| 200 | Ga0207671_10175813 | 3300025914 | Bacteria | 1664 |
| 201 | Ga0207660_10122307 | 3300025917 | Bacteria | 1972 |
| 202 | Ga0207657_10112313 | 3300025919 | Bacteria | 2249 |
| 203 | Ga0207657_10133535 | 3300025919 | Bacteria | 2032 |
| 204 | Ga0207694_10069007 | 3300025924 | Bacteria | 2761 |
| 205 | Ga0207644_10418476 | 3300025931 | Bacteria | 1097 |
| 206 | Ga0207690_10001163 | 3300025932 | Bacteria | 16661 |
| 207 | Ga0207690_10021542 | 3300025932 | Bacteria | 3999 |
| 208 | Ga0207706_10000718 | 3300025933 | Bacteria | 34581 |
| 209 | Ga0207706_10181909 | 3300025933 | Bacteria | 1846 |
| 210 | Ga0207704_10000047 | 3300025938 | Bacteria | 84386 |
| 211 | Ga0207667_10000015 | 3300025949 | Bacteria | 417534 |
| 212 | Ga0207667_10021180 | 3300025949 | Bacteria | 7209 |
| 213 | Ga0207667_10024438 | 3300025949 | Bacteria | 6634 |
| 214 | Ga0207667_10029785 | 3300025949 | Bacteria | 5914 |
| 215 | Ga0207651_10040523 | 3300025960 | Bacteria | 3082 |
| 216 | Ga0207703_10139008 | 3300026035 | Bacteria | 2106 |
| 217 | Ga0207639_10023836 | 3300026041 | Bacteria | 4423 |
| 218 | Ga0207639_10173995 | 3300026041 | Bacteria | 1826 |
| 219 | Ga0207678_10022845 | 3300026067 | Bacteria | 5477 |
| 220 | Ga0207702_10000163 | 3300026078 | Bacteria | 79263 |
| 221 | Ga0207702_10101053 | 3300026078 | Bacteria | 2546 |
| 222 | Ga0207648_10002322 | 3300026089 | Bacteria | 20530 |
| 223 | Ga0207683_10003865 | 3300026121 | Bacteria | 13002 |
| 224 | Ga0207698_10033736 | 3300026142 | Bacteria | 3723 |
| 225 | Ga0268266_10000121 | 3300028379 | Bacteria | 154995 |
| 226 | Ga0268264_10774861 | 3300028381 | Bacteria | 957 |
| 227 | Ga0307517_10000198 | 3300028786 | Bacteria | 102181 |
| 228 | Ga0307515_10002441 | 3300028794 | Bacteria | 40493 |
| 229 | Ga0307515_10004266 | 3300028794 | Bacteria | 29673 |
| 230 | Ga0265338_10001687 | 3300028800 | Bacteria | 35089 |
| 231 | Ga0265338_10055426 | 3300028800 | Bacteria | 3526 |
| 232 | Ga0316181_1198667 | 3300030744 | Bacteria | 1517 |
| 233 | Ga0265327_10049171 | 3300031251 | Bacteria | 2213 |
| 234 | Ga0307509_10153227 | 3300031507 | Bacteria | 2216 |
| 235 | Ga0307408_100000464 | 3300031548 | Bacteria | 35518 |
| 236 | Ga0307408_100001480 | 3300031548 | Bacteria | 17434 |
| 237 | Ga0307408_100002318 | 3300031548 | Bacteria | 13499 |
| 238 | Ga0307405_10000009 | 3300031731 | Bacteria | 259388 |
| 239 | Ga0307407_10000001 | 3300031903 | Bacteria | 570048 |
| 240 | Ga0307412_10545527 | 3300031911 | Bacteria | 973 |
| 241 | Ga0307409_100256326 | 3300031995 | Bacteria | 1602 |
| 242 | Ga0307416_100000008 | 3300032002 | Bacteria | 401343 |
| 243 | Ga0307414_10000414 | 3300032004 | Bacteria | 23018 |
| 244 | Ga0307414_10008454 | 3300032004 | Bacteria | 5836 |
| 245 | Ga0307414_10080864 | 3300032004 | Bacteria | 2377 |
| 246 | Ga0307414_10140827 | 3300032004 | Bacteria | 1888 |
| 247 | Ga0307411_10069335 | 3300032005 | Bacteria | 2381 |
| 248 | Ga0307411_10153783 | 3300032005 | Bacteria | 1713 |
| 249 | Ga0307507_10000099 | 3300033179 | Bacteria | 139532 |
| 250 | Ga0307510_10000417 | 3300033180 | Bacteria | 40763 |
| 251 | Ga0395899_0000024 | 3300037312 | Bacteria | 357402 |
| 252 | Ga0395899_0000027 | 3300037312 | Bacteria | 337387 |
| 253 | Ga0395899_0000811 | 3300037312 | Bacteria | 30415 |
| 254 | Ga0395899_0027895 | 3300037312 | Bacteria | 4253 |
| 255 | Ga0395900_0000195 | 3300037418 | Bacteria | 97204 |
| 256 | Ga0395900_0000275 | 3300037418 | Bacteria | 78207 |
| 257 | Ga0395900_0023399 | 3300037418 | Bacteria | 6324 |
| 258 | Ga0395898_0007299 | 3300037466 | Bacteria | 11734 |
| 259 | Ga0395898_0064245 | 3300037466 | Bacteria | 3560 |
| 260 | Ga0395905_0000248 | 3300037471 | Bacteria | 81042 |
| 261 | Ga0395905_0000327 | 3300037471 | Bacteria | 68334 |
| 262 | Ga0395901_0000595 | 3300038443 | Bacteria | 42132 |
| 263 | Ga0395901_0022300 | 3300038443 | Bacteria | 6489 |
| 264 | Ga0436361_0717383 | 3300039447 | Bacteria | 4352 |
| 265 | Ga0451855_0125642 | 3300041511 | Bacteria | 1652 |
| 266 | Ga0451855_0261717 | 3300041511 | Bacteria | 1013 |
| 267 | Ga0451855_0276519 | 3300041511 | Unclassified | 1144 |
| 268 | Ga0451855_1450819 | 3300041511 | Bacteria | 1175 |
| 269 | Ga0451855_1871187 | 3300041511 | Bacteria | 1031 |
| 270 | Ga0466969_0076188 | 3300044656 | Bacteria | 1607 |
| 271 | Ga0466966_0003859 | 3300044684 | Bacteria | 9892 |
| 272 | Ga0466961_0003771 | 3300044693 | Bacteria | 9476 |
| 273 | Ga0453684_0218094 | 3300044712 | Bacteria | 2212 |
| 274 | Ga0451576_0354072 | 3300045051 | Bacteria | 1537 |
| 275 | Ga0495651_0060250 | 3300046462 | Bacteria | 2908 |
| 276 | Ga0495650_0000231 | 3300046471 | Bacteria | 113969 |
| 277 | Ga0495585_0000037 | 3300046492 | Bacteria | 133335 |
| 278 | Ga0495585_0001999 | 3300046492 | Bacteria | 15127 |
| 279 | Ga0495606_0000060 | 3300046507 | Bacteria | 185907 |
| 280 | Ga0495606_0007003 | 3300046507 | Bacteria | 10236 |
| 281 | Ga0495606_0027878 | 3300046507 | Bacteria | 3995 |
| 282 | Ga0495606_0032528 | 3300046507 | Bacteria | 3612 |
| 283 | Ga0495606_0039356 | 3300046507 | Bacteria | 3188 |
| 284 | Ga0495606_0202852 | 3300046507 | Bacteria | 1129 |
| 285 | Ga0495610_0000108 | 3300046512 | Bacteria | 96839 |
| 286 | Ga0495610_0000129 | 3300046512 | Bacteria | 83051 |
| 287 | Ga0495610_0001948 | 3300046512 | Bacteria | 17744 |
| 288 | Ga0495610_0026963 | 3300046512 | Bacteria | 3061 |
| 289 | Ga0495616_0004644 | 3300046513 | Bacteria | 8622 |
| 290 | Ga0495616_0009675 | 3300046513 | Bacteria | 5619 |
| 291 | Ga0495637_0005395 | 3300046520 | Bacteria | 6531 |
| 292 | Ga0495637_0020065 | 3300046520 | Bacteria | 3079 |
| 293 | Ga0495644_0014205 | 3300046523 | Bacteria | 3050 |
| 294 | Ga0495648_0016132 | 3300046524 | Bacteria | 5390 |
| 295 | Ga0495648_0042367 | 3300046524 | Bacteria | 2864 |
| 296 | Ga0495652_0103263 | 3300046529 | Bacteria | 2308 |
| 297 | Ga0495652_0489727 | 3300046529 | Bacteria | 854 |
| 298 | Ga0495609_0003494 | 3300046538 | Bacteria | 8981 |
| 299 | Ga0495622_0078880 | 3300046557 | Bacteria | 1516 |
| 300 | Ga0495633_0000015 | 3300046558 | Bacteria | 254484 |
| 301 | Ga0495633_0002945 | 3300046558 | Bacteria | 11649 |
| 302 | Ga0495633_0035657 | 3300046558 | Bacteria | 2388 |
| 303 | Ga0495668_0000041 | 3300046616 | Bacteria | 229462 |
| 304 | Ga0495625_0000191 | 3300046660 | Bacteria | 97363 |
| 305 | Ga0495625_0005486 | 3300046660 | Bacteria | 11552 |
| 306 | Ga0495625_0013045 | 3300046660 | Bacteria | 6698 |
| 307 | Ga0495625_0057804 | 3300046660 | Bacteria | 2757 |
| 308 | Ga0495625_0131559 | 3300046660 | Bacteria | 1695 |
| 309 | Ga0495661_0001963 | 3300046665 | Bacteria | 16326 |
| 310 | Ga0495661_0042962 | 3300046665 | Bacteria | 2782 |
| 311 | Ga0495661_0062627 | 3300046665 | Bacteria | 2202 |
| 312 | Ga0495661_0155770 | 3300046665 | Bacteria | 1230 |
| 313 | Ga0495669_0248744 | 3300046684 | Bacteria | 854 |
| 314 | Ga0495671_0023370 | 3300046692 | Bacteria | 3230 |
| 315 | Ga0495649_0000061 | 3300046694 | Bacteria | 97338 |
| 316 | Ga0495649_0027276 | 3300046694 | Bacteria | 3170 |
| 317 | Ga0495660_0029605 | 3300046810 | Bacteria | 3088 |
| 318 | Ga0495660_0130013 | 3300046810 | Bacteria | 1264 |
| 319 | Ga0495683_0048382 | 3300047323 | Bacteria | 2132 |
| 320 | Ga0495687_000570 | 3300047443 | Bacteria | 43484 |
| 321 | Ga0495687_009002 | 3300047443 | Bacteria | 5639 |
| 322 | Ga0495681_0029764 | 3300047470 | Bacteria | 2790 |
| 323 | Ga0495686_0003586 | 3300047472 | Bacteria | 13326 |
| 324 | Ga0495686_0005173 | 3300047472 | Bacteria | 10386 |
| 325 | Ga0495686_0006114 | 3300047472 | Bacteria | 9327 |
| 326 | Ga0495686_0028108 | 3300047472 | Bacteria | 3664 |
| 327 | Ga0495614_0103191 | 3300048089 | Bacteria | 1248 |
| 328 | Ga0495678_005618 | 3300049459 | Bacteria | 6861 |
| 329 | Ga0495682_0015181 | 3300049460 | Bacteria | 2919 |
| 330 | Ga0495682_0036183 | 3300049460 | Bacteria | 1818 |
| 331 | nmdc:mga0k408_1014_c1 | 3300050493 | Bacteria | 15426 |
| 332 | nmdc:mga0k408_2072_c1 | 3300050493 | Bacteria | 10731 |
| 333 | nmdc:mga0k408_31_c1 | 3300050493 | Bacteria | 85612 |
| 334 | Ga0500635_0001560 | 3300053080 | Bacteria | 5512 |
| 335 | Ga0500635_0051947 | 3300053080 | Bacteria | 1406 |
| 336 | Ga0500647_0102081 | 3300053091 | Bacteria | 1369 |
| 337 | Ga0500608_016821 | 3300053122 | Bacteria | 3311 |
| 338 | Ga0500608_017923 | 3300053122 | Bacteria | 3223 |
| 339 | Ga0500618_000016 | 3300053125 | Bacteria | 164049 |
| 340 | Ga0500642_0116863 | 3300053130 | Bacteria | 1246 |
| 341 | Ga0500622_0002531 | 3300053156 | Bacteria | 13125 |
| 342 | Ga0500624_000583 | 3300053157 | Bacteria | 10075 |
| 343 | 2586206971 | 2585427687 | Bacteria | 5544917 |
| 344 | 2599481410 | 2599185184 | Bacteria | 6430550 |
| 345 | 2738854604 | 2738541302 | Bacteria | 5944758 |
| 346 | 2739587115 | 2739367651 | Bacteria | 6359826 |
| 347 | 2739615214 | 2739367656 | Bacteria | 5152243 |
| 348 | 2739645661 | 2739367663 | Bacteria | 5040914 |
| 349 | 2819547580 | 2818991437 | Bacteria | 5805520 |
| 350 | 2842726594 | 2842722452 | Bacteria | 6263924 |
| 351 | 2842911438 | 2842909656 | Bacteria | 6185908 |
| 352 | 2849284216 | 2849281842 | Bacteria | 6065644 |
| 353 | 2852627054 | 2852623160 | Bacteria | 4376875 |
| 354 | 2857627821 | 2857627736 | Bacteria | 5625397 |
| 355 | 2884935212 | 2884933994 | Bacteria | 4535041 |
| 356 | 2904449017 | 2904445276 | Bacteria | 5310396 |
| 357 | 2919443069 | 2919437846 | Bacteria | 6199444 |
| 358 | 2928083295 | 2928078545 | Bacteria | 6534839 |
| 359 | 2928152757 | 2928147474 | Bacteria | 6512076 |
| 360 | 2932088281 | 2932082852 | Bacteria | 6563563 |
| 361 | 2946003104 | 2945997725 | Bacteria | 6404843 |
| 362 | 2954019963 | 2954016120 | Bacteria | 6446024 |
| 363 | 2977234001 | 2977232053 | Bacteria | 5485925 |
| 364 | Ga0105240_10535137 | |||
| 365 | JGI24741J21665_1010803 | |||
| 366 | JGI24740J21852_10033607 | |||
| 367 | JGI24739J22299_10001167 | |||
| 368 | JGI24739J22299_10004465 | |||
| 369 | JGI24737J22298_10000060 | |||
| 370 | JGI24737J22298_10033991 | |||
| 371 | JGI24735J21928_10000032 | |||
| 372 | JGI25162J39368_1000118 | |||
| 373 | JGI25162J39368_1000562 | |||
| 374 | JGI25152J39213_1000064 | |||
| 375 | JGI25150J39212_1000004 | |||
| 376 | JGI25151J46595_10000002 | |||
| 377 | JGI25165J46597_1001048 | |||
| 378 | JGI25153J46596_10000037 | |||
| 379 | rootH1_10018888 | |||
| 380 | rootH2_10012714 | |||
| 381 | rootH2_10014716 | |||
| 382 | rootH2_10117191 | |||
| 383 | rootH1_10012646 | |||
| 384 | rootH1_10035074 | |||
| 385 | rootH1_10043364 | |||
| 386 | Ga0055536_1000006 | |||
| 387 | Ga0055530_10000821 | |||
| 388 | Ga0058863_10892506 | |||
| 389 | Ga0065714_10020272 | |||
| 390 | Ga0065714_10064490 | |||
| 391 | Ga0065714_10076361 | |||
| 392 | Ga0065714_10173579 | |||
| 393 | Ga0070658_10000008 | |||
| 394 | Ga0070658_10331844 | |||
| 395 | Ga0070676_10004519 | |||
| 396 | Ga0070683_100069198 | |||
| 397 | Ga0070680_100086169 | |||
| 398 | Ga0068868_100011149 | |||
| 399 | Ga0070660_100005767 | |||
| 400 | Ga0070660_100042674 | |||
| 401 | Ga0070660_100071826 | |||
| 402 | Ga0070674_100128142 | |||
| 403 | Ga0070673_100002154 | |||
| 404 | Ga0070659_100000868 | |||
| 405 | Ga0070659_100083935 | |||
| 406 | Ga0070667_100479796 | |||
| 407 | Ga0070663_100016532 | |||
| 408 | Ga0070678_100002196 | |||
| 409 | Ga0070662_100000090 | |||
| 410 | Ga0070681_10069613 | |||
| 411 | Ga0068867_100004276 | |||
| 412 | Ga0070679_100002981 | |||
| 413 | Ga0068853_100033271 | |||
| 414 | Ga0068853_100118422 | |||
| 415 | Ga0070665_100000118 | |||
| 416 | Ga0068855_100000049 | |||
| 417 | Ga0068855_100011033 | |||
| 418 | Ga0068855_100039086 | |||
| 419 | Ga0068855_100042400 | |||
| 420 | Ga0068856_100003614 | |||
| 421 | Ga0068856_100008154 | |||
| 422 | Ga0068856_100058680 | |||
| 423 | Ga0068852_100013041 | |||
| 424 | Ga0068858_100164959 | |||
| 425 | Ga0068860_100789848 | |||
| 426 | Ga0075366_10000135 | |||
| 427 | Ga0075366_10000556 | |||
| 428 | Ga0075366_10001049 | |||
| 429 | Ga0097621_100000015 | |||
| 430 | Ga0068871_100000051 | |||
| 431 | Ga0068865_100001125 | |||
| 432 | Ga0105244_10072382 | |||
| 433 | Ga0105240_10020637 | |||
| 434 | Ga0105240_10103143 | |||
| 435 | Ga0105240_10348238 | |||
| 436 | Ga0105240_10352479 | |||
| 437 | Ga0105240_10688939 | |||
| 438 | Ga0105243_10135471 | |||
| 439 | Ga0105243_10266061 | |||
| 440 | Ga0105241_10000804 | |||
| 441 | Ga0105241_10021267 | |||
| 442 | Ga0105241_10062925 | |||
| 443 | Ga0105241_10077581 | |||
| 444 | Ga0105241_10435996 | |||
| 445 | Ga0105242_10015307 | |||
| 446 | Ga0105237_10000310 | |||
| 447 | Ga0105237_10001895 | |||
| 448 | Ga0105237_10002529 | |||
| 449 | Ga0105237_10022235 | |||
| 450 | Ga0105237_10025146 | |||
| 451 | Ga0105237_10033945 | |||
| 452 | Ga0105237_10205391 | |||
| 453 | Ga0105238_10007593 | |||
| 454 | Ga0105238_10027877 | |||
| 455 | Ga0105239_10000049 | |||
| 456 | Ga0105239_10000166 | |||
| 457 | Ga0105239_10001978 | |||
| 458 | Ga0105239_10005378 | |||
| 459 | Ga0105239_10016298 | |||
| 460 | Ga0105239_10078749 | |||
| 461 | Ga0105239_10104269 | |||
| 462 | Ga0105239_10142401 | |||
| 463 | Ga0105239_10149353 | |||
| 464 | Ga0105239_10205179 | |||
| 465 | Ga0105239_10309835 | |||
| 466 | Ga0105239_10463574 | |||
| 467 | Ga0105246_10023425 | |||
| 468 | Ga0157373_10000164 | |||
| 469 | Ga0157373_10001332 | |||
| 470 | Ga0157373_10054151 | |||
| 471 | Ga0157373_10279811 | |||
| 472 | Ga0157371_10000027 | |||
| 473 | Ga0157371_10000107 | |||
| 474 | Ga0157371_10001877 | |||
| 475 | Ga0157371_10027834 | |||
| 476 | Ga0157371_10045937 | |||
| 477 | Ga0157371_10109897 | |||
| 478 | Ga0157371_10394088 | |||
| 479 | Ga0157370_10032727 | |||
| 480 | Ga0157370_10034394 | |||
| 481 | Ga0157370_10077392 | |||
| 482 | Ga0157370_10272396 | |||
| 483 | Ga0157370_10750347 | |||
| 484 | Ga0157369_10000053 | |||
| 485 | Ga0157369_10003605 | |||
| 486 | Ga0157369_10081766 | |||
| 487 | Ga0157369_10189810 | |||
| 488 | Ga0157369_10204332 | |||
| 489 | Ga0157374_10000301 | |||
| 490 | Ga0157374_10001665 | |||
| 491 | Ga0157374_10003138 | |||
| 492 | Ga0157378_10010959 | |||
| 493 | Ga0157378_10017039 | |||
| 494 | Ga0163162_10000012 | |||
| 495 | Ga0163162_10000078 | |||
| 496 | Ga0163162_10008113 | |||
| 497 | Ga0163162_10110087 | |||
| 498 | Ga0163162_10155561 | |||
| 499 | Ga0163162_10752963 | |||
| 500 | Ga0157372_10000039 | |||
| 501 | Ga0157372_10000238 | |||
| 502 | Ga0157372_10003139 | |||
| 503 | Ga0157372_10008473 | |||
| 504 | Ga0157372_10008724 | |||
| 505 | Ga0157372_10048549 | |||
| 506 | Ga0157372_10509223 | |||
| 507 | Ga0157375_10003657 | |||
| 508 | Ga0157375_10023127 | |||
| 509 | Ga0157375_10239305 | |||
| 510 | Ga0157375_10820680 | |||
| 511 | Ga0157380_10000010 | |||
| 512 | Ga0182008_10000334 | |||
| 513 | Ga0157377_10017248 | |||
| 514 | Ga0182006_1000755 | |||
| 515 | Ga0182006_1000787 | |||
| 516 | Ga0182007_10000005 | |||
| 517 | Ga0183373_1007 | |||
| 518 | Ga0163161_10001505 | |||
| 519 | Ga0163161_10002901 | |||
| 520 | Ga0163161_10033680 | |||
| 521 | Ga0163161_10544308 | |||
| 522 | Ga0213872_10158873 | |||
| 523 | Ga0209563_105948 | |||
| 524 | Ga0207427_100122 | |||
| 525 | Ga0209437_100048 | |||
| 526 | Ga0209437_100102 | |||
| 527 | Ga0207425_1000003 | |||
| 528 | Ga0209026_1000250 | |||
| 529 | Ga0209026_1002144 | |||
| 530 | Ga0209026_1008720 | |||
| 531 | Ga0209148_1010692 | |||
| 532 | Ga0209129_1000022 | |||
| 533 | Ga0209233_1000029 | |||
| 534 | Ga0209233_1006134 | |||
| 535 | Ga0209233_1007624 | |||
| 536 | Ga0209455_1006449 | |||
| 537 | Ga0209676_1000039 | |||
| 538 | Ga0209025_1000007 | |||
| 539 | Ga0209758_1000012 | |||
| 540 | Ga0209050_1000033 | |||
| 541 | Ga0207647_10000018 | |||
| 542 | Ga0207647_10000071 | |||
| 543 | Ga0207647_10054010 | |||
| 544 | Ga0207645_10000229 | |||
| 545 | Ga0207705_10000026 | |||
| 546 | Ga0207705_10379849 | |||
| 547 | Ga0207654_10020440 | |||
| 548 | Ga0207654_10091942 | |||
| 549 | Ga0207654_10260363 | |||
| 550 | Ga0207707_10053636 | |||
| 551 | Ga0207695_10000053 | |||
| 552 | Ga0207695_10003037 | |||
| 553 | Ga0207695_10011545 | |||
| 554 | Ga0207695_10029788 | |||
| 555 | Ga0207695_10430480 | |||
| 556 | Ga0207671_10002584 | |||
| 557 | Ga0207671_10003225 | |||
| 558 | Ga0207671_10006202 | |||
| 559 | Ga0207671_10013292 | |||
| 560 | Ga0207671_10045196 | |||
| 561 | Ga0207671_10146697 | |||
| 562 | Ga0207671_10149621 | |||
| 563 | Ga0207671_10175813 | |||
| 564 | Ga0207660_10122307 | |||
| 565 | Ga0207657_10112313 | |||
| 566 | Ga0207657_10133535 | |||
| 567 | Ga0207694_10069007 | |||
| 568 | Ga0207644_10418476 | |||
| 569 | Ga0207690_10001163 | |||
| 570 | Ga0207690_10021542 | |||
| 571 | Ga0207706_10000718 | |||
| 572 | Ga0207706_10181909 | |||
| 573 | Ga0207704_10000047 | |||
| 574 | Ga0207667_10000015 | |||
| 575 | Ga0207667_10021180 | |||
| 576 | Ga0207667_10024438 | |||
| 577 | Ga0207667_10029785 | |||
| 578 | Ga0207651_10040523 | |||
| 579 | Ga0207703_10139008 | |||
| 580 | Ga0207639_10023836 | |||
| 581 | Ga0207639_10173995 | |||
| 582 | Ga0207678_10022845 | |||
| 583 | Ga0207702_10000163 | |||
| 584 | Ga0207702_10101053 | |||
| 585 | Ga0207648_10002322 | |||
| 586 | Ga0207683_10003865 | |||
| 587 | Ga0207698_10033736 | |||
| 588 | Ga0268266_10000121 | |||
| 589 | Ga0268264_10774861 | |||
| 590 | Ga0307517_10000198 | |||
| 591 | Ga0307515_10002441 | |||
| 592 | Ga0307515_10004266 | |||
| 593 | Ga0265338_10001687 | |||
| 594 | Ga0265338_10055426 | |||
| 595 | Ga0316181_1198667 | |||
| 596 | Ga0265327_10049171 | |||
| 597 | Ga0307509_10153227 | |||
| 598 | Ga0307408_100000464 | |||
| 599 | Ga0307408_100001480 | |||
| 600 | Ga0307408_100002318 | |||
| 601 | Ga0307405_10000009 | |||
| 602 | Ga0307407_10000001 | |||
| 603 | Ga0307412_10545527 | |||
| 604 | Ga0307409_100256326 | |||
| 605 | Ga0307416_100000008 | |||
| 606 | Ga0307414_10000414 | |||
| 607 | Ga0307414_10008454 | |||
| 608 | Ga0307414_10080864 | |||
| 609 | Ga0307414_10140827 | |||
| 610 | Ga0307411_10069335 | |||
| 611 | Ga0307411_10153783 | |||
| 612 | Ga0307507_10000099 | |||
| 613 | Ga0307510_10000417 | |||
| 614 | Ga0395899_0000024 | |||
| 615 | Ga0395899_0000027 | |||
| 616 | Ga0395899_0000811 | |||
| 617 | Ga0395899_0027895 | |||
| 618 | Ga0395900_0000195 | |||
| 619 | Ga0395900_0000275 | |||
| 620 | Ga0395900_0023399 | |||
| 621 | Ga0395898_0007299 | |||
| 622 | Ga0395898_0064245 | |||
| 623 | Ga0395905_0000248 | |||
| 624 | Ga0395905_0000327 | |||
| 625 | Ga0395901_0000595 | |||
| 626 | Ga0395901_0022300 | |||
| 627 | Ga0436361_0717383 | |||
| 628 | Ga0451855_0125642 | |||
| 629 | Ga0451855_0261717 | |||
| 630 | Ga0451855_0276519 | |||
| 631 | Ga0451855_1450819 | |||
| 632 | Ga0451855_1871187 | |||
| 633 | Ga0466969_0076188 | |||
| 634 | Ga0466966_0003859 | |||
| 635 | Ga0466961_0003771 | |||
| 636 | Ga0453684_0218094 | |||
| 637 | Ga0451576_0354072 | |||
| 638 | Ga0495651_0060250 | |||
| 639 | Ga0495650_0000231 | |||
| 640 | Ga0495585_0000037 | |||
| 641 | Ga0495585_0001999 | |||
| 642 | Ga0495606_0000060 | |||
| 643 | Ga0495606_0007003 | |||
| 644 | Ga0495606_0027878 | |||
| 645 | Ga0495606_0032528 | |||
| 646 | Ga0495606_0039356 | |||
| 647 | Ga0495606_0202852 | |||
| 648 | Ga0495610_0000108 | |||
| 649 | Ga0495610_0000129 | |||
| 650 | Ga0495610_0001948 | |||
| 651 | Ga0495610_0026963 | |||
| 652 | Ga0495616_0004644 | |||
| 653 | Ga0495616_0009675 | |||
| 654 | Ga0495637_0005395 | |||
| 655 | Ga0495637_0020065 | |||
| 656 | Ga0495644_0014205 | |||
| 657 | Ga0495648_0016132 | |||
| 658 | Ga0495648_0042367 | |||
| 659 | Ga0495652_0103263 | |||
| 660 | Ga0495652_0489727 | |||
| 661 | Ga0495609_0003494 | |||
| 662 | Ga0495622_0078880 | |||
| 663 | Ga0495633_0000015 | |||
| 664 | Ga0495633_0002945 | |||
| 665 | Ga0495633_0035657 | |||
| 666 | Ga0495668_0000041 | |||
| 667 | Ga0495625_0000191 | |||
| 668 | Ga0495625_0005486 | |||
| 669 | Ga0495625_0013045 | |||
| 670 | Ga0495625_0057804 | |||
| 671 | Ga0495625_0131559 | |||
| 672 | Ga0495661_0001963 | |||
| 673 | Ga0495661_0042962 | |||
| 674 | Ga0495661_0062627 | |||
| 675 | Ga0495661_0155770 | |||
| 676 | Ga0495669_0248744 | |||
| 677 | Ga0495671_0023370 | |||
| 678 | Ga0495649_0000061 | |||
| 679 | Ga0495649_0027276 | |||
| 680 | Ga0495660_0029605 | |||
| 681 | Ga0495660_0130013 | |||
| 682 | Ga0495683_0048382 | |||
| 683 | Ga0495687_000570 | |||
| 684 | Ga0495687_009002 | |||
| 685 | Ga0495681_0029764 | |||
| 686 | Ga0495686_0003586 | |||
| 687 | Ga0495686_0005173 | |||
| 688 | Ga0495686_0006114 | |||
| 689 | Ga0495686_0028108 | |||
| 690 | Ga0495614_0103191 | |||
| 691 | Ga0495678_005618 | |||
| 692 | Ga0495682_0015181 | |||
| 693 | Ga0495682_0036183 | |||
| 694 | nmdc:mga0k408_1014_c1 | |||
| 695 | nmdc:mga0k408_2072_c1 | |||
| 696 | nmdc:mga0k408_31_c1 | |||
| 697 | Ga0500635_0001560 | |||
| 698 | Ga0500635_0051947 | |||
| 699 | Ga0500647_0102081 | |||
| 700 | Ga0500608_016821 | |||
| 701 | Ga0500608_017923 | |||
| 702 | Ga0500618_000016 | |||
| 703 | Ga0500642_0116863 | |||
| 704 | Ga0500622_0002531 | |||
| 705 | Ga0500624_000583 | |||
| 706 | 2586206971 | |||
| 707 | 2599481410 | |||
| 708 | 2738854604 | |||
| 709 | 2739587115 | |||
| 710 | 2739615214 | |||
| 711 | 2739645661 | |||
| 712 | 2819547580 | |||
| 713 | 2842726594 | |||
| 714 | 2842911438 | |||
| 715 | 2849284216 | |||
| 716 | 2852627054 | |||
| 717 | 2857627821 | |||
| 718 | 2884935212 | |||
| 719 | 2904449017 | |||
| 720 | 2919443069 | |||
| 721 | 2928083295 | |||
| 722 | 2928152757 | |||
| 723 | 2932088281 | |||
| 724 | 2946003104 | |||
| 725 | 2954019963 | |||
| 726 | 2977234001 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3kw2-assembly1.cif.gz_B | crystal structure of probable rrna-methyltransferase from porphyromonas gingivalis | 0.9272 | 1 | 234 |
| 3kw2-assembly1.cif.gz_B | crystal structure of probable rrna-methyltransferase from porphyromonas gingivalis | 0.9196 | 1 | 234 |
| 1nxz-assembly1.cif.gz_B | x-ray crystal structure of protein yggj_haein of haemophilus influenzae. northeast structural genomics consortium target ir73. | 0.8986 | 1 | 233 |
| 4e8b-assembly1.cif.gz_A | crystal structure of 16s rrna methyltransferase rsme from e.coli | 0.8948 | 1 | 234 |
| 5o96-assembly4.cif.gz_G | structure of the putative methyltransferase lpg2936 from legionella pneumophila in complex with the bound cofactor sam | 0.889 | 3 | 232 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1vhyA01 | Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Hypothetical PUA domain-like; domain 1 | 0.9436 | 1 | 67 | 2.40.240.20 |
| 3kw2B02 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9418 | 76 | 234 | 3.40.1280.10 |
| 5o96E02 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9237 | 75 | 232 | 3.40.1280.10 |
| 2cx8A02 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9217 | 75 | 230 | 3.40.1280.10 |
| af_Q54SC0_1_67_2.40.240.20 | Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Hypothetical PUA domain-like; domain 1 | 0.9115 | 1 | 66 | 2.40.240.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N2YTR1-F1-model_v4 | 16S rRNA (uracil(1498)-N(3))-methyltransferase (EC 2.1.1.193) | 0.987 | 50 | 235 |
GO:0005737
GO:0070042 GO:0070475 |
| AF-A0A350YTM8-F1-model_v4 | Ribosomal RNA small subunit methyltransferase E (EC 2.1.1.193) | 0.9837 | 1 | 235 |
GO:0005737
GO:0070042 GO:0070475 |
| AF-A0A847XQZ7-F1-model_v4 | 16S rRNA (uracil(1498)-N(3))-methyltransferase (EC 2.1.1.193) | 0.9821 | 104 | 235 |
GO:0005737
GO:0070042 GO:0070475 |
| AF-A0A7V4GYM8-F1-model_v4 | 16S rRNA (uracil(1498)-N(3))-methyltransferase (EC 2.1.1.193) | 0.9815 | 90 | 235 |
GO:0005737
GO:0070042 GO:0070475 |
| AF-A0A6H9PNG6-F1-model_v4 | deleted | 0.9797 | 63 | 235 |
|