F422945

General Info

Members Datasets Scaffolds Average Seq Length
363 211 726 456

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10145547|Ga0105248_101455472
Length 487
Sequence VHGKWDVATAFNPRVERRMSLPPCFASASTSQGARAIPLVALDATTLQSYLAQQPERVRRWVETQGFSAEANSVLLLPDADGAPLAALVGVGDAHDPFALAACPXXXPPGTYALNKGGQDNNGLHLEPANAILGWGLGAYRFERYRKPARPPARLLLEDAAAESSEAFALLKASTLVRDLVNTPTEDMGPDELDAVARRLAHAYGGIVETTVGDALLAANFPTIHAVGRASHRAPRLIALRWGDAAHPHVVVVGKGVCFDTGGLSIKTGDGMRNMKKDMGGAAHALGLAQMVMAMHLPLRLTMLIPAVENAIAGNAFRPGEVIRTRAGITVEVDNTDAEGRLVLCDALAYAAEYAPNLVLDFATLTGAARVALGPELPALFCNDETLASDYLKAAQHARDPLWRMPLWKPYLNYLKSNVADIANSGSTRMAGAIIAAMYLQRFVPDTLPWAHVDTYAWNDADRPGHPAGGEAQGLRAAYALLKARCR

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
78 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
82 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
83 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
85 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
86 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
87 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
89 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
90 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
91 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
93 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
94 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
141 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
145 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
146 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
147 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
148 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
149 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
150 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
151 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
152 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
153 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
154 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
155 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
156 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
157 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
158 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
159 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
160 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
161 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
162 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
163 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
164 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
170 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
171 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
172 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
173 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
174 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
175 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
182 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
183 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
184 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
185 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
186 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
187 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
188 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
189 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
190 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
191 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
192 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
193 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
194 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
195 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
196 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
197 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
198 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
199 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
200 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
201 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
202 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
203 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
204 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
205 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
206 2739367700 Dyella sp. YR388 Isolate Unclassified
207 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
208 2884411467 Dyella sp. AD56 Isolate Rhizosphere
209 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
210 2928963466 Dyella japonica 1073 Isolate Unclassified
211 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.52
Metatranscriptomes 0
Isolates 2.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.47
Nodule 0
Rhizoplane 1.93
Rhizosphere 82.64
Stem 0
Stem Tuber 0.28
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_10145547 3300009177 Bacteria 2674
2 JGI24735J21928_10001924 3300002067 Bacteria 7287
3 JGI25162J39368_1001426 3300002737 Bacteria 12918
4 JGI25162J39368_1003336 3300002737 Bacteria 4788
5 JGI25157J39369_1000302 3300002741 Bacteria 35658
6 JGI25163J39215_1001275 3300002771 Bacteria 4518
7 JGI25164J39214_1000333 3300002772 Bacteria 30196
8 JGI25150J39212_1000240 3300002774 Bacteria 29534
9 JGI25151J46595_10000231 3300003187 Bacteria 66295
10 JGI25165J46597_1000213 3300003214 Bacteria 82308
11 JGI25153J46596_10000166 3300003215 Bacteria 66295
12 Ga0055535_1000311 3300003761 Bacteria 49424
13 Ga0055542_1001331 3300003762 Bacteria 12918
14 Ga0055542_1003083 3300003762 Bacteria 4788
15 Ga0055529_1000196 3300003763 Bacteria 82308
16 Ga0070658_10005244 3300005327 Bacteria 10529
17 Ga0070690_100105332 3300005330 Bacteria 1875
18 Ga0070670_100007359 3300005331 Bacteria 9346
19 Ga0070666_10000202 3300005335 Bacteria 40833
20 Ga0070666_10000442 3300005335 Bacteria 25310
21 Ga0070666_10121958 3300005335 Bacteria 1808
22 Ga0068868_100007240 3300005338 Bacteria 7887
23 Ga0070689_100007001 3300005340 Bacteria 7859
24 Ga0070689_100027216 3300005340 Bacteria 4310
25 Ga0070661_100004765 3300005344 Bacteria 9335
26 Ga0070661_100050419 3300005344 Bacteria 3045
27 Ga0070661_100149307 3300005344 Bacteria 1766
28 Ga0070668_100025651 3300005347 Bacteria 4470
29 Ga0070669_100046124 3300005353 Bacteria 3177
30 Ga0070675_100176729 3300005354 Bacteria 1844
31 Ga0070667_100000049 3300005367 Bacteria 158483
32 Ga0070708_100097068 3300005445 Bacteria 2693
33 Ga0070663_100000042 3300005455 Bacteria 57899
34 Ga0070663_100115882 3300005455 Bacteria 2019
35 Ga0070678_100005613 3300005456 Bacteria 7281
36 Ga0070678_100023197 3300005456 Bacteria 4130
37 Ga0070662_100001371 3300005457 Bacteria 14974
38 Ga0070681_10009167 3300005458 Bacteria 9724
39 Ga0070681_10074640 3300005458 Bacteria 3352
40 Ga0070681_10325949 3300005458 Bacteria 1445
41 Ga0068867_100025759 3300005459 Bacteria 4220
42 Ga0068867_100083972 3300005459 Bacteria 2405
43 Ga0070699_100061834 3300005518 Bacteria 3245
44 Ga0068853_100003659 3300005539 Bacteria 11791
45 Ga0068853_100004195 3300005539 Bacteria 11116
46 Ga0068853_100011114 3300005539 Bacteria 7303
47 Ga0068853_100036676 3300005539 Bacteria 4170
48 Ga0068853_100137173 3300005539 Bacteria 2194
49 Ga0068853_100139401 3300005539 Bacteria 2176
50 Ga0068853_100189143 3300005539 Bacteria 1870
51 Ga0070672_100020088 3300005543 Bacteria 4866
52 Ga0070672_100050978 3300005543 Bacteria 3226
53 Ga0070696_100015256 3300005546 Bacteria 5157
54 Ga0070696_100051563 3300005546 Bacteria 2862
55 Ga0070693_100001813 3300005547 Bacteria 9747
56 Ga0070665_100007322 3300005548 Bacteria 11227
57 Ga0070665_100037577 3300005548 Bacteria 4868
58 Ga0068855_100033792 3300005563 Bacteria 6101
59 Ga0068855_100072173 3300005563 Bacteria 4013
60 Ga0068855_100099538 3300005563 Bacteria 3348
61 Ga0068855_100109532 3300005563 Bacteria 3171
62 Ga0068857_100051448 3300005577 Bacteria 3655
63 Ga0068857_100138462 3300005577 Bacteria 2199
64 Ga0068854_100005464 3300005578 Bacteria 8027
65 Ga0068856_100133322 3300005614 Bacteria 2489
66 Ga0068852_100001953 3300005616 Bacteria 14041
67 Ga0068852_100005973 3300005616 Bacteria 8769
68 Ga0068852_100008245 3300005616 Bacteria 7661
69 Ga0068859_100000280 3300005617 Bacteria 50848
70 Ga0068864_100189767 3300005618 Bacteria 1883
71 Ga0068851_10000800 3300005834 Bacteria 13590
72 Ga0068851_10005795 3300005834 Bacteria 5627
73 Ga0068858_100000323 3300005842 Bacteria 50583
74 Ga0068858_100023495 3300005842 Bacteria 5743
75 Ga0068860_100021322 3300005843 Bacteria 6273
76 Ga0068862_100000215 3300005844 Bacteria 64251
77 Ga0068862_100069942 3300005844 Bacteria 3030
78 Ga0075364_10000028 3300006051 Bacteria 50736
79 Ga0075366_10031972 3300006195 Bacteria 3098
80 Ga0097621_100003008 3300006237 Bacteria 11577
81 Ga0097621_100014639 3300006237 Bacteria 5878
82 Ga0068871_100005993 3300006358 Bacteria 8556
83 Ga0068871_100008299 3300006358 Bacteria 7465
84 Ga0068871_100014593 3300006358 Bacteria 5861
85 Ga0068871_100030425 3300006358 Bacteria 4251
86 Ga0068871_100125827 3300006358 Bacteria 2169
87 Ga0068871_100143134 3300006358 Bacteria 2034
88 Ga0068865_100020868 3300006881 Bacteria 4254
89 Ga0068865_100151699 3300006881 Bacteria 1759
90 Ga0075436_100004194 3300006914 Bacteria 9888
91 Ga0097620_100000280 3300006931 Bacteria 50848
92 Ga0075435_100164267 3300007076 Bacteria 1872
93 Ga0105240_10003239 3300009093 Bacteria 25493
94 Ga0105240_10024836 3300009093 Bacteria 7890
95 Ga0105240_10035683 3300009093 Bacteria 6406
96 Ga0105240_10060422 3300009093 Bacteria 4725
97 Ga0105240_10102772 3300009093 Bacteria 3473
98 Ga0105240_10147975 3300009093 Bacteria 2800
99 Ga0105240_10210581 3300009093 Bacteria 2272
100 Ga0105245_10079745 3300009098 Bacteria 2990
101 Ga0105245_10182473 3300009098 Bacteria 2006
102 Ga0105241_10006111 3300009174 Bacteria 8874
103 Ga0105241_10007616 3300009174 Bacteria 7956
104 Ga0105241_10010170 3300009174 Bacteria 6909
105 Ga0105241_10074337 3300009174 Bacteria 2646
106 Ga0105242_10097050 3300009176 Bacteria 2491
107 Ga0105248_10000120 3300009177 Bacteria 89960
108 Ga0105248_10059053 3300009177 Bacteria 4308
109 Ga0105237_10011173 3300009545 Bacteria 9517
110 Ga0105237_10027718 3300009545 Bacteria 5776
111 Ga0105238_10006626 3300009551 Bacteria 11543
112 Ga0105238_10027024 3300009551 Bacteria 5849
113 Ga0105238_10032641 3300009551 Bacteria 5298
114 Ga0105238_10039988 3300009551 Bacteria 4753
115 Ga0105238_10063811 3300009551 Bacteria 3684
116 Ga0105249_10000898 3300009553 Bacteria 26273
117 Ga0105249_10002568 3300009553 Bacteria 15721
118 Ga0105239_10010309 3300010375 Bacteria 10466
119 Ga0105239_10018322 3300010375 Bacteria 7740
120 Ga0105239_10051398 3300010375 Bacteria 4518
121 Ga0105239_10061961 3300010375 Bacteria 4106
122 Ga0105239_10071519 3300010375 Bacteria 3811
123 Ga0105239_10104266 3300010375 Bacteria 3140
124 Ga0105239_10145007 3300010375 Bacteria 2648
125 Ga0105239_10197556 3300010375 Bacteria 2253
126 Ga0157370_10020424 3300013104 Bacteria 6615
127 Ga0157370_10027259 3300013104 Bacteria 5634
128 Ga0157370_10057884 3300013104 Bacteria 3684
129 Ga0157369_10001435 3300013105 Bacteria 29239
130 Ga0157369_10002250 3300013105 Bacteria 23203
131 Ga0157369_10004413 3300013105 Bacteria 16604
132 Ga0157369_10013049 3300013105 Bacteria 9409
133 Ga0157369_10232754 3300013105 Bacteria 1926
134 Ga0157369_10301684 3300013105 Bacteria 1666
135 Ga0157378_10000536 3300013297 Bacteria 36043
136 Ga0157378_10034377 3300013297 Bacteria 4483
137 Ga0163162_10000004 3300013306 Bacteria 505593
138 Ga0163162_10024605 3300013306 Bacteria 5946
139 Ga0157372_10000344 3300013307 Bacteria 51217
140 Ga0157372_10002027 3300013307 Bacteria 22019
141 Ga0157372_10057981 3300013307 Bacteria 4329
142 Ga0157372_10063154 3300013307 Bacteria 4152
143 Ga0157372_10306492 3300013307 Bacteria 1848
144 Ga0157372_10425080 3300013307 Bacteria 1548
145 Ga0157375_10091341 3300013308 Bacteria 3106
146 Ga0157375_10200823 3300013308 Bacteria 2150
147 Ga0163163_10000029 3300014325 Bacteria 174973
148 Ga0157380_10117581 3300014326 Bacteria 2246
149 Ga0182008_10103385 3300014497 Bacteria 1409
150 Ga0157377_10049028 3300014745 Bacteria 2372
151 Ga0157376_10005164 3300014969 Bacteria 9105
152 Ga0157376_10018127 3300014969 Bacteria 5388
153 Ga0157376_10045860 3300014969 Bacteria 3601
154 Ga0157376_10174915 3300014969 Bacteria 1957
155 Ga0183368_1002 3300015687 Bacteria 1865598
156 Ga0163161_10122004 3300017792 Bacteria 1959
157 Ga0209760_100151 3300025207 Bacteria 42314
158 Ga0209784_100119 3300025224 Bacteria 82900
159 Ga0209674_100014 3300025226 Bacteria 704989
160 Ga0209672_101014 3300025228 Bacteria 12254
161 Ga0207427_100142 3300025231 Bacteria 82907
162 Ga0209437_100074 3300025233 Bacteria 300858
163 Ga0209437_100162 3300025233 Bacteria 147864
164 Ga0209258_100127 3300025242 Bacteria 177606
165 Ga0209258_102100 3300025242 Bacteria 5617
166 Ga0207425_1000029 3300025245 Bacteria 268521
167 Ga0209646_1007690 3300025246 Bacteria 1750
168 Ga0209026_1000200 3300025250 Bacteria 82913
169 Ga0209148_1000005 3300025254 Bacteria 1806504
170 Ga0209148_1000036 3300025254 Bacteria 530505
171 Ga0209759_1013361 3300025256 Bacteria 2226
172 Ga0209129_1000216 3300025258 Bacteria 66352
173 Ga0209233_1000040 3300025261 Bacteria 530395
174 Ga0209455_1000071 3300025272 Bacteria 300858
175 Ga0209025_1000076 3300025294 Bacteria 273934
176 Ga0209025_1011481 3300025294 Bacteria 5828
177 Ga0209758_1000473 3300025297 Bacteria 66352
178 Ga0209257_1000147 3300025304 Bacteria 194105
179 Ga0207656_10000595 3300025321 Bacteria 11966
180 Ga0207680_10000529 3300025903 Bacteria 18152
181 Ga0207647_10000024 3300025904 Bacteria 115153
182 Ga0207647_10001336 3300025904 Bacteria 18958
183 Ga0207647_10057088 3300025904 Bacteria 2394
184 Ga0207705_10005189 3300025909 Bacteria 9767
185 Ga0207705_10218752 3300025909 Bacteria 1446
186 Ga0207654_10000458 3300025911 Bacteria 23295
187 Ga0207654_10017818 3300025911 Bacteria 3720
188 Ga0207707_10000578 3300025912 Bacteria 37213
189 Ga0207707_10166351 3300025912 Bacteria 1927
190 Ga0207695_10000200 3300025913 Bacteria 165896
191 Ga0207695_10000772 3300025913 Bacteria 60706
192 Ga0207695_10006223 3300025913 Bacteria 15542
193 Ga0207695_10010745 3300025913 Bacteria 11170
194 Ga0207695_10065222 3300025913 Bacteria 3744
195 Ga0207695_10075978 3300025913 Bacteria 3416
196 Ga0207695_10184079 3300025913 Bacteria 2009
197 Ga0207671_10003514 3300025914 Bacteria 15562
198 Ga0207671_10023070 3300025914 Bacteria 4696
199 Ga0207671_10028453 3300025914 Bacteria 4175
200 Ga0207671_10195000 3300025914 Bacteria 1580
201 Ga0207657_10002547 3300025919 Bacteria 19710
202 Ga0207649_10021253 3300025920 Bacteria 3732
203 Ga0207652_10017800 3300025921 Bacteria 5820
204 Ga0207681_10043829 3300025923 Bacteria 2996
205 Ga0207694_10002184 3300025924 Bacteria 16074
206 Ga0207694_10012020 3300025924 Bacteria 6527
207 Ga0207694_10013943 3300025924 Bacteria 6060
208 Ga0207694_10037771 3300025924 Bacteria 3711
209 Ga0207694_10071435 3300025924 Bacteria 2712
210 Ga0207650_10004794 3300025925 Bacteria 9243
211 Ga0207659_10059307 3300025926 Bacteria 2750
212 Ga0207700_10014152 3300025928 Bacteria 5218
213 Ga0207664_10012937 3300025929 Bacteria 5979
214 Ga0207706_10000950 3300025933 Bacteria 29643
215 Ga0207686_10105296 3300025934 Bacteria 1892
216 Ga0207670_10002635 3300025936 Bacteria 9437
217 Ga0207670_10040885 3300025936 Bacteria 3045
218 Ga0207669_10104562 3300025937 Bacteria 1881
219 Ga0207691_10067705 3300025940 Bacteria 3228
220 Ga0207691_10102108 3300025940 Bacteria 2558
221 Ga0207711_10002259 3300025941 Bacteria 17293
222 Ga0207711_10096967 3300025941 Bacteria 2603
223 Ga0207661_10087719 3300025944 Bacteria 2585
224 Ga0207667_10001817 3300025949 Bacteria 26859
225 Ga0207667_10029565 3300025949 Bacteria 5940
226 Ga0207667_10103949 3300025949 Bacteria 2929
227 Ga0207667_10114466 3300025949 Bacteria 2780
228 Ga0207712_10000275 3300025961 Bacteria 49090
229 Ga0207712_10000305 3300025961 Bacteria 45213
230 Ga0207668_10066868 3300025972 Bacteria 2549
231 Ga0207640_10001575 3300025981 Bacteria 12252
232 Ga0207658_10000033 3300025986 Bacteria 158540
233 Ga0207658_10038364 3300025986 Bacteria 3451
234 Ga0207703_10001612 3300026035 Bacteria 20384
235 Ga0207703_10105042 3300026035 Bacteria 2400
236 Ga0207639_10000116 3300026041 Bacteria 61688
237 Ga0207639_10000514 3300026041 Bacteria 26656
238 Ga0207639_10027971 3300026041 Bacteria 4111
239 Ga0207639_10032146 3300026041 Bacteria 3861
240 Ga0207639_10038343 3300026041 Bacteria 3564
241 Ga0207639_10222115 3300026041 Bacteria 1632
242 Ga0207678_10010163 3300026067 Bacteria 8261
243 Ga0207678_10059925 3300026067 Bacteria 3275
244 Ga0207678_10099474 3300026067 Bacteria 2484
245 Ga0207641_10060618 3300026088 Bacteria 3225
246 Ga0207648_10015120 3300026089 Bacteria 7104
247 Ga0207674_10008389 3300026116 Bacteria 11948
248 Ga0207674_10036099 3300026116 Bacteria 5155
249 Ga0207674_10175369 3300026116 Bacteria 2096
250 Ga0207698_10024847 3300026142 Bacteria 4211
251 Ga0207698_10051413 3300026142 Bacteria 3150
252 Ga0207698_10159678 3300026142 Bacteria 1970
253 Ga0268266_10000008 3300028379 Bacteria 1161875
254 Ga0268266_10020720 3300028379 Bacteria 5605
255 Ga0268265_10000376 3300028380 Bacteria 48178
256 Ga0268265_10259465 3300028380 Bacteria 1544
257 Ga0307508_10081405 3300031616 Bacteria 2819
258 Ga0307405_10038269 3300031731 Bacteria 2890
259 Ga0307413_10005416 3300031824 Bacteria 5695
260 Ga0307410_10159710 3300031852 Bacteria 1687
261 Ga0307406_10011273 3300031901 Bacteria 5069
262 Ga0307416_100067521 3300032002 Bacteria 2950
263 Ga0307416_100129373 3300032002 Bacteria 2269
264 Ga0307414_10052212 3300032004 Bacteria 2843
265 Ga0316582_0017450 3300036647 Bacteria 4154
266 Ga0316582_0038087 3300036647 Bacteria 2986
267 Ga0316584_0003979 3300036712 Bacteria 9721
268 Ga0395900_0000163 3300037418 Bacteria 109199
269 Ga0395900_0019634 3300037418 Bacteria 6891
270 Ga0395900_0146967 3300037418 Bacteria 2410
271 Ga0395901_0021659 3300038443 Bacteria 6585
272 Ga0439449_0006909 3300042007 Bacteria 4327
273 Ga0451577_0000804 3300042876 Bacteria 47207
274 Ga0466957_0003076 3300044842 Bacteria 9080
275 Ga0495638_0000650 3300046460 Bacteria 38037
276 Ga0495638_0000657 3300046460 Bacteria 37781
277 Ga0495650_0000849 3300046471 Bacteria 36705
278 Ga0495606_0003920 3300046507 Bacteria 15312
279 Ga0495608_0003431 3300046511 Bacteria 11349
280 Ga0495663_0021552 3300046525 Bacteria 1856
281 Ga0495587_0074236 3300046536 Bacteria 1975
282 Ga0495621_0006171 3300046539 Bacteria 3484
283 Ga0495645_0010814 3300046543 Bacteria 6410
284 Ga0495625_0146085 3300046660 Bacteria 1592
285 Ga0495657_0078464 3300046675 Bacteria 2140
286 Ga0495599_0002340 3300046678 Bacteria 11003
287 Ga0495623_0024973 3300046679 Bacteria 3850
288 Ga0495649_0013115 3300046694 Bacteria 4790
289 Ga0495649_0067651 3300046694 Bacteria 1916
290 Ga0495600_0015597 3300046809 Bacteria 4809
291 Ga0495604_0037953 3300047317 Bacteria 3791
292 Ga0495684_0120947 3300047471 Bacteria 1972
293 Ga0495686_0004214 3300047472 Bacteria 11939
294 Ga0496103_0102751 3300048906 Bacteria 1810
295 Ga0496104_0031898 3300048907 Bacteria 4902
296 Ga0496105_0134375 3300048908 Bacteria 2038
297 Ga0496113_0210088 3300048916 Bacteria 1549
298 Ga0496115_0005052 3300048918 Bacteria 9588
299 Ga0496115_0009701 3300048918 Bacteria 7167
300 Ga0496115_0046611 3300048918 Bacteria 3465
301 Ga0496117_0010444 3300048920 Bacteria 8463
302 Ga0496118_0001867 3300048921 Bacteria 30139
303 Ga0496122_0001517 3300048925 Bacteria 37011
304 Ga0496122_0004896 3300048925 Bacteria 16243
305 Ga0496123_0000323 3300048926 Bacteria 91212
306 Ga0496123_0018477 3300048926 Bacteria 5545
307 Ga0496124_0000006 3300048927 Bacteria 904259
308 Ga0495682_0050361 3300049460 Bacteria 1516
309 Ga0501032_0006515 3300049569 Bacteria 8578
310 Ga0501036_0209476 3300049572 Bacteria 1638
311 Ga0501038_0007093 3300049574 Bacteria 10348
312 Ga0501043_0060249 3300049579 Bacteria 2979
313 Ga0501046_0004915 3300049580 Bacteria 12023
314 Ga0501047_0003339 3300049581 Bacteria 15207
315 Ga0501047_0009546 3300049581 Bacteria 9170
316 Ga0501047_0226043 3300049581 Bacteria 1726
317 Ga0501067_0000857 3300049583 Bacteria 16400
318 Ga0501068_0000747 3300049584 Bacteria 16667
319 Ga0501069_0000367 3300049585 Bacteria 20361
320 Ga0501069_0038786 3300049585 Bacteria 2630
321 Ga0501070_0000943 3300049586 Bacteria 26245
322 Ga0501070_0002597 3300049586 Bacteria 15787
323 Ga0501070_0005876 3300049586 Bacteria 10464
324 Ga0501070_0035984 3300049586 Bacteria 4134
325 Ga0501070_0050461 3300049586 Bacteria 3454
326 Ga0501072_0000573 3300049588 Bacteria 26511
327 Ga0501073_0000434 3300049589 Bacteria 28757
328 Ga0501073_0000964 3300049589 Bacteria 20699
329 Ga0501073_0080798 3300049589 Bacteria 2261
330 Ga0501074_0012589 3300049590 Bacteria 6149
331 Ga0501074_0012764 3300049590 Bacteria 6108
332 Ga0501076_0053317 3300049592 Bacteria 3205
333 Ga0501079_0004962 3300049741 Bacteria 9869
334 Ga0501080_0000764 3300049742 Bacteria 26124
335 Ga0501080_0003649 3300049742 Bacteria 13587
336 Ga0501080_0020641 3300049742 Bacteria 6102
337 Ga0501080_0020645 3300049742 Bacteria 6101
338 Ga0501080_0106650 3300049742 Bacteria 2596
339 Ga0501081_0048796 3300049743 Bacteria 2914
340 Ga0501083_0000246 3300049744 Bacteria 34511
341 Ga0501083_0004617 3300049744 Bacteria 9728
342 Ga0501044_0004602 3300049823 Bacteria 15430
343 Ga0501044_0047378 3300049823 Bacteria 4446
344 Ga0501044_0061770 3300049823 Bacteria 3832
345 nmdc:mga00v17_86_c1 3300050491 Bacteria 56453
346 nmdc:mga0k408_8280_c1 3300050493 Bacteria 2368
347 nmdc:mga08x19_10529_c1 3300050514 Bacteria 5556
348 Ga0500643_007235 3300053087 Bacteria 4517
349 Ga0500651_0025246 3300053093 Bacteria 3728
350 Ga0500597_000088 3300053120 Bacteria 19053
351 Ga0501084_0008342 3300054114 Bacteria 8552
352 Ga0501084_0027838 3300054114 Bacteria 4723
353 Ga0501082_0039064 3300060353 Bacteria 4094
354 Ga0530510_0100374 3300061734 Bacteria 2116
355 2525556560 2524614729 Bacteria 3091755
356 2630649789 2627854209 Bacteria 3093011
357 2687581729 2687453130 Bacteria 4227172
358 2739733995 2739367700 Bacteria 4747630
359 2842782568 2842780639 Bacteria 4337790
360 2884415394 2884411467 Bacteria 5246714
361 2885427904 2885427238 Bacteria 2291351
362 2928966150 2928963466 Bacteria 5165703
363 8002870966 8002869464 Bacteria 3588529
364 Ga0105248_10145547
365 JGI24735J21928_10001924
366 JGI25162J39368_1001426
367 JGI25162J39368_1003336
368 JGI25157J39369_1000302
369 JGI25163J39215_1001275
370 JGI25164J39214_1000333
371 JGI25150J39212_1000240
372 JGI25151J46595_10000231
373 JGI25165J46597_1000213
374 JGI25153J46596_10000166
375 Ga0055535_1000311
376 Ga0055542_1001331
377 Ga0055542_1003083
378 Ga0055529_1000196
379 Ga0070658_10005244
380 Ga0070690_100105332
381 Ga0070670_100007359
382 Ga0070666_10000202
383 Ga0070666_10000442
384 Ga0070666_10121958
385 Ga0068868_100007240
386 Ga0070689_100007001
387 Ga0070689_100027216
388 Ga0070661_100004765
389 Ga0070661_100050419
390 Ga0070661_100149307
391 Ga0070668_100025651
392 Ga0070669_100046124
393 Ga0070675_100176729
394 Ga0070667_100000049
395 Ga0070708_100097068
396 Ga0070663_100000042
397 Ga0070663_100115882
398 Ga0070678_100005613
399 Ga0070678_100023197
400 Ga0070662_100001371
401 Ga0070681_10009167
402 Ga0070681_10074640
403 Ga0070681_10325949
404 Ga0068867_100025759
405 Ga0068867_100083972
406 Ga0070699_100061834
407 Ga0068853_100003659
408 Ga0068853_100004195
409 Ga0068853_100011114
410 Ga0068853_100036676
411 Ga0068853_100137173
412 Ga0068853_100139401
413 Ga0068853_100189143
414 Ga0070672_100020088
415 Ga0070672_100050978
416 Ga0070696_100015256
417 Ga0070696_100051563
418 Ga0070693_100001813
419 Ga0070665_100007322
420 Ga0070665_100037577
421 Ga0068855_100033792
422 Ga0068855_100072173
423 Ga0068855_100099538
424 Ga0068855_100109532
425 Ga0068857_100051448
426 Ga0068857_100138462
427 Ga0068854_100005464
428 Ga0068856_100133322
429 Ga0068852_100001953
430 Ga0068852_100005973
431 Ga0068852_100008245
432 Ga0068859_100000280
433 Ga0068864_100189767
434 Ga0068851_10000800
435 Ga0068851_10005795
436 Ga0068858_100000323
437 Ga0068858_100023495
438 Ga0068860_100021322
439 Ga0068862_100000215
440 Ga0068862_100069942
441 Ga0075364_10000028
442 Ga0075366_10031972
443 Ga0097621_100003008
444 Ga0097621_100014639
445 Ga0068871_100005993
446 Ga0068871_100008299
447 Ga0068871_100014593
448 Ga0068871_100030425
449 Ga0068871_100125827
450 Ga0068871_100143134
451 Ga0068865_100020868
452 Ga0068865_100151699
453 Ga0075436_100004194
454 Ga0097620_100000280
455 Ga0075435_100164267
456 Ga0105240_10003239
457 Ga0105240_10024836
458 Ga0105240_10035683
459 Ga0105240_10060422
460 Ga0105240_10102772
461 Ga0105240_10147975
462 Ga0105240_10210581
463 Ga0105245_10079745
464 Ga0105245_10182473
465 Ga0105241_10006111
466 Ga0105241_10007616
467 Ga0105241_10010170
468 Ga0105241_10074337
469 Ga0105242_10097050
470 Ga0105248_10000120
471 Ga0105248_10059053
472 Ga0105237_10011173
473 Ga0105237_10027718
474 Ga0105238_10006626
475 Ga0105238_10027024
476 Ga0105238_10032641
477 Ga0105238_10039988
478 Ga0105238_10063811
479 Ga0105249_10000898
480 Ga0105249_10002568
481 Ga0105239_10010309
482 Ga0105239_10018322
483 Ga0105239_10051398
484 Ga0105239_10061961
485 Ga0105239_10071519
486 Ga0105239_10104266
487 Ga0105239_10145007
488 Ga0105239_10197556
489 Ga0157370_10020424
490 Ga0157370_10027259
491 Ga0157370_10057884
492 Ga0157369_10001435
493 Ga0157369_10002250
494 Ga0157369_10004413
495 Ga0157369_10013049
496 Ga0157369_10232754
497 Ga0157369_10301684
498 Ga0157378_10000536
499 Ga0157378_10034377
500 Ga0163162_10000004
501 Ga0163162_10024605
502 Ga0157372_10000344
503 Ga0157372_10002027
504 Ga0157372_10057981
505 Ga0157372_10063154
506 Ga0157372_10306492
507 Ga0157372_10425080
508 Ga0157375_10091341
509 Ga0157375_10200823
510 Ga0163163_10000029
511 Ga0157380_10117581
512 Ga0182008_10103385
513 Ga0157377_10049028
514 Ga0157376_10005164
515 Ga0157376_10018127
516 Ga0157376_10045860
517 Ga0157376_10174915
518 Ga0183368_1002
519 Ga0163161_10122004
520 Ga0209760_100151
521 Ga0209784_100119
522 Ga0209674_100014
523 Ga0209672_101014
524 Ga0207427_100142
525 Ga0209437_100074
526 Ga0209437_100162
527 Ga0209258_100127
528 Ga0209258_102100
529 Ga0207425_1000029
530 Ga0209646_1007690
531 Ga0209026_1000200
532 Ga0209148_1000005
533 Ga0209148_1000036
534 Ga0209759_1013361
535 Ga0209129_1000216
536 Ga0209233_1000040
537 Ga0209455_1000071
538 Ga0209025_1000076
539 Ga0209025_1011481
540 Ga0209758_1000473
541 Ga0209257_1000147
542 Ga0207656_10000595
543 Ga0207680_10000529
544 Ga0207647_10000024
545 Ga0207647_10001336
546 Ga0207647_10057088
547 Ga0207705_10005189
548 Ga0207705_10218752
549 Ga0207654_10000458
550 Ga0207654_10017818
551 Ga0207707_10000578
552 Ga0207707_10166351
553 Ga0207695_10000200
554 Ga0207695_10000772
555 Ga0207695_10006223
556 Ga0207695_10010745
557 Ga0207695_10065222
558 Ga0207695_10075978
559 Ga0207695_10184079
560 Ga0207671_10003514
561 Ga0207671_10023070
562 Ga0207671_10028453
563 Ga0207671_10195000
564 Ga0207657_10002547
565 Ga0207649_10021253
566 Ga0207652_10017800
567 Ga0207681_10043829
568 Ga0207694_10002184
569 Ga0207694_10012020
570 Ga0207694_10013943
571 Ga0207694_10037771
572 Ga0207694_10071435
573 Ga0207650_10004794
574 Ga0207659_10059307
575 Ga0207700_10014152
576 Ga0207664_10012937
577 Ga0207706_10000950
578 Ga0207686_10105296
579 Ga0207670_10002635
580 Ga0207670_10040885
581 Ga0207669_10104562
582 Ga0207691_10067705
583 Ga0207691_10102108
584 Ga0207711_10002259
585 Ga0207711_10096967
586 Ga0207661_10087719
587 Ga0207667_10001817
588 Ga0207667_10029565
589 Ga0207667_10103949
590 Ga0207667_10114466
591 Ga0207712_10000275
592 Ga0207712_10000305
593 Ga0207668_10066868
594 Ga0207640_10001575
595 Ga0207658_10000033
596 Ga0207658_10038364
597 Ga0207703_10001612
598 Ga0207703_10105042
599 Ga0207639_10000116
600 Ga0207639_10000514
601 Ga0207639_10027971
602 Ga0207639_10032146
603 Ga0207639_10038343
604 Ga0207639_10222115
605 Ga0207678_10010163
606 Ga0207678_10059925
607 Ga0207678_10099474
608 Ga0207641_10060618
609 Ga0207648_10015120
610 Ga0207674_10008389
611 Ga0207674_10036099
612 Ga0207674_10175369
613 Ga0207698_10024847
614 Ga0207698_10051413
615 Ga0207698_10159678
616 Ga0268266_10000008
617 Ga0268266_10020720
618 Ga0268265_10000376
619 Ga0268265_10259465
620 Ga0307508_10081405
621 Ga0307405_10038269
622 Ga0307413_10005416
623 Ga0307410_10159710
624 Ga0307406_10011273
625 Ga0307416_100067521
626 Ga0307416_100129373
627 Ga0307414_10052212
628 Ga0316582_0017450
629 Ga0316582_0038087
630 Ga0316584_0003979
631 Ga0395900_0000163
632 Ga0395900_0019634
633 Ga0395900_0146967
634 Ga0395901_0021659
635 Ga0439449_0006909
636 Ga0451577_0000804
637 Ga0466957_0003076
638 Ga0495638_0000650
639 Ga0495638_0000657
640 Ga0495650_0000849
641 Ga0495606_0003920
642 Ga0495608_0003431
643 Ga0495663_0021552
644 Ga0495587_0074236
645 Ga0495621_0006171
646 Ga0495645_0010814
647 Ga0495625_0146085
648 Ga0495657_0078464
649 Ga0495599_0002340
650 Ga0495623_0024973
651 Ga0495649_0013115
652 Ga0495649_0067651
653 Ga0495600_0015597
654 Ga0495604_0037953
655 Ga0495684_0120947
656 Ga0495686_0004214
657 Ga0496103_0102751
658 Ga0496104_0031898
659 Ga0496105_0134375
660 Ga0496113_0210088
661 Ga0496115_0005052
662 Ga0496115_0009701
663 Ga0496115_0046611
664 Ga0496117_0010444
665 Ga0496118_0001867
666 Ga0496122_0001517
667 Ga0496122_0004896
668 Ga0496123_0000323
669 Ga0496123_0018477
670 Ga0496124_0000006
671 Ga0495682_0050361
672 Ga0501032_0006515
673 Ga0501036_0209476
674 Ga0501038_0007093
675 Ga0501043_0060249
676 Ga0501046_0004915
677 Ga0501047_0003339
678 Ga0501047_0009546
679 Ga0501047_0226043
680 Ga0501067_0000857
681 Ga0501068_0000747
682 Ga0501069_0000367
683 Ga0501069_0038786
684 Ga0501070_0000943
685 Ga0501070_0002597
686 Ga0501070_0005876
687 Ga0501070_0035984
688 Ga0501070_0050461
689 Ga0501072_0000573
690 Ga0501073_0000434
691 Ga0501073_0000964
692 Ga0501073_0080798
693 Ga0501074_0012589
694 Ga0501074_0012764
695 Ga0501076_0053317
696 Ga0501079_0004962
697 Ga0501080_0000764
698 Ga0501080_0003649
699 Ga0501080_0020641
700 Ga0501080_0020645
701 Ga0501080_0106650
702 Ga0501081_0048796
703 Ga0501083_0000246
704 Ga0501083_0004617
705 Ga0501044_0004602
706 Ga0501044_0047378
707 Ga0501044_0061770
708 nmdc:mga00v17_86_c1
709 nmdc:mga0k408_8280_c1
710 nmdc:mga08x19_10529_c1
711 Ga0500643_007235
712 Ga0500651_0025246
713 Ga0500597_000088
714 Ga0501084_0008342
715 Ga0501084_0027838
716 Ga0501082_0039064
717 Ga0530510_0100374
718 2525556560
719 2630649789
720 2687581729
721 2739733995
722 2842782568
723 2884415394
724 2885427904
725 2928966150
726 8002870966

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00883

Peptidase_M17

Cytosol aminopeptidase family, catalytic domain

175

479

0.94

PF21337

Peptidase_M17_N_1

M17 aminopeptidase, N-terminal domain

37

158

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ij3-assembly1.cif.gz_A 1.8 angstrom resolution crystal structure of cytosol aminopeptidase from coxiella burnetii 0.905 3 453
3ij3-assembly1.cif.gz_A 1.8 angstrom resolution crystal structure of cytosol aminopeptidase from coxiella burnetii 0.8955 3 453
4zla-assembly1.cif.gz_D bestatin complex structure of leucine aminopeptidase from helicobacter pylori 0.8386 4 452
7k5k-assembly1.cif.gz_B plasmodium vivax m17 leucyl aminopeptidase pv-m17 0.8377 44 451
4zla-assembly1.cif.gz_E bestatin complex structure of leucine aminopeptidase from helicobacter pylori 0.8347 4 454
ID Description Score Start End Superfamily
3ij3A02 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8924 134 453 3.40.630.10
af_A0A1D6GRR2_213_395_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8903 131 304 3.40.630.10
af_K7MGH8_224_493_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8879 133 389 3.40.630.10
3ij3A02 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8768 134 453 3.40.630.10
4zi6D02 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8727 131 454 3.40.630.10
ID Description Score Start End GO Terms
AF-A0A382K2C7-F1-model_v4 Uncharacterized protein 0.9322 2 315 GO:0005737
GO:0006508
GO:0030145
GO:0070006
AF-A0A6L7XTR0-F1-model_v4 Leucyl aminopeptidase family protein 0.9214 4 325 GO:0005737
GO:0006508
GO:0030145
GO:0070006
AF-A0A3D2SSG9-F1-model_v4 Leucyl aminopeptidase 0.9184 4 379 GO:0005737
GO:0006508
GO:0030145
GO:0070006
AF-A0A3B9L189-F1-model_v4 Leucyl aminopeptidase 0.9162 3 379 GO:0005737
GO:0006508
GO:0030145
GO:0070006
AF-A0A6L7XTR0-F1-model_v4 Leucyl aminopeptidase family protein 0.9159 4 325 GO:0005737
GO:0006508
GO:0030145
GO:0070006

Map