F422947

General Info

Members Datasets Scaffolds Average Seq Length
363 216 726 339

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10296283|Ga0105237_102962832
Length 359
Sequence LAYEQLFFDSFIFYRTYIHMSQILIIYTGGTIGMMSDPQTKVLKPINFEQIMDNVPELEKLNCKIKVHSFEQIIDSSNMNPAIWSELASLIESNYNDVDGFVILHGSDTMAFSASVLSFMLEGLGKPVIFTGSQLPISAIRTDAKENLMTSIEIAKAKKNDRARVPEVCIYFDYKLFRGNRSFKYNSSKFEAFRSPNYPILAESGVHLRFSANDIRHPKEGETLKVHKNLVSDVAVLKLYPGISPKVVETILGADVRGVVMETFGAGNTTTDDWFVDLLKQAIDSGKVILDISQCKVGTVELGRYETSKQLKDIGVANGYDMTYESAVTKMMYLLGQFDNPQDVKEHLEMDIRGEITVS

Samples

Sample ID Description Type Environment
1 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
16 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
71 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
72 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
73 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
74 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
75 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
76 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
78 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
110 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
111 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
112 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
113 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
114 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
117 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
118 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
119 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
120 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
121 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
127 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
128 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
129 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
130 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
131 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
132 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
133 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
134 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
135 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
136 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
137 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
138 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
139 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
140 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
141 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
142 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
143 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
144 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
145 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
146 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
147 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
148 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
149 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
150 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
151 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
152 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
153 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
154 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
155 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
156 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
157 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
158 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
159 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
160 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
161 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
162 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
170 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
171 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
172 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
173 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
174 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
175 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
176 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
177 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
178 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
183 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
184 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
185 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
186 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
187 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
188 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
189 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
190 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
191 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
192 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
193 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
194 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
195 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
196 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
197 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
198 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
199 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
200 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
201 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
202 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
203 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
204 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
205 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
206 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
207 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
208 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
209 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
210 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
211 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
212 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
213 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
214 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
215 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
216 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.56
Metatranscriptomes 0.28
Isolates 7.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.44
Nodule 0
Rhizoplane 2.2
Rhizosphere 80.72
Stem 0
Stem Tuber 0
Unclassified 2.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105237_10296283 3300009545 Bacteria 1620
2 SwRhRL2b_contig_1558989 2162886007 Bacteria 3652
3 JGI24740J21852_10015341 3300001979 Bacteria 2801
4 JGI24739J22299_10045081 3300001989 Bacteria 1449
5 JGI24737J22298_10000077 3300001990 Bacteria 28981
6 JGI24737J22298_10035692 3300001990 Bacteria 1538
7 JGI24735J21928_10000005 3300002067 Bacteria 356755
8 JGI24744J21845_10016887 3300002077 Bacteria 1452
9 JGI25162J39368_1000596 3300002737 Bacteria 26217
10 JGI25165J46597_1002041 3300003214 Bacteria 7635
11 rootH1_10026072 3300003316 Bacteria 16591
12 rootH2_10024240 3300003320 Bacteria 36961
13 rootH2_10035444 3300003320 Bacteria 12072
14 rootH2_10069782 3300003320 Bacteria 1362
15 rootH2_10076019 3300003320 Bacteria 7044
16 rootH2_10122926 3300003320 Bacteria 1670
17 rootH2_10209505 3300003320 Bacteria 2957
18 rootL2_10021894 3300003322 Bacteria 11126
19 rootH1_10005386 3300003323 Bacteria 37172
20 rootH1_10007323 3300003323 Bacteria 15190
21 rootH1_10080363 3300003323 Bacteria 5682
22 JGI25160J50197_1007425 3300003354 Bacteria 4289
23 Ga0055529_1005870 3300003763 Bacteria 1746
24 Ga0058863_11005245 3300004799 Bacteria 3341
25 Ga0070658_10000917 3300005327 Bacteria 25190
26 Ga0070658_10050510 3300005327 Bacteria 3371
27 Ga0070676_10000030 3300005328 Bacteria 43467
28 Ga0070683_100182168 3300005329 Bacteria 1994
29 Ga0070670_100171232 3300005331 Bacteria 1883
30 Ga0070666_10118763 3300005335 Unclassified 1832
31 Ga0070680_100001753 3300005336 Bacteria 15938
32 Ga0068868_100364142 3300005338 Bacteria 1241
33 Ga0070660_100107558 3300005339 Bacteria 2216
34 Ga0070660_100111286 3300005339 Bacteria 2179
35 Ga0070671_100001418 3300005355 Bacteria 17923
36 Ga0070671_100062693 3300005355 Bacteria 3095
37 Ga0070674_100107452 3300005356 Bacteria 2043
38 Ga0070673_100001160 3300005364 Bacteria 15150
39 Ga0070659_100024209 3300005366 Bacteria 4653
40 Ga0070659_100088431 3300005366 Bacteria 2481
41 Ga0070659_100101692 3300005366 Bacteria 2314
42 Ga0070663_100218493 3300005455 Bacteria 1495
43 Ga0070678_100001694 3300005456 Bacteria 11820
44 Ga0070662_100000003 3300005457 Bacteria 239813
45 Ga0070681_10024611 3300005458 Bacteria 6057
46 Ga0068867_100012919 3300005459 Bacteria 5908
47 Ga0068867_100158694 3300005459 Unclassified 1782
48 Ga0070679_100002253 3300005530 Bacteria 17431
49 Ga0070679_100081415 3300005530 Bacteria 3227
50 Ga0070684_100084098 3300005535 Bacteria 2820
51 Ga0068853_100003188 3300005539 Bacteria 12525
52 Ga0068853_100250764 3300005539 Bacteria 1624
53 Ga0070672_100312038 3300005543 Bacteria 1335
54 Ga0070665_100000212 3300005548 Bacteria 100019
55 Ga0070665_100147639 3300005548 Bacteria 2354
56 Ga0070665_100578087 3300005548 Bacteria 1136
57 Ga0068855_100000127 3300005563 Bacteria 96826
58 Ga0068855_100000201 3300005563 Bacteria 76965
59 Ga0068855_100114425 3300005563 Bacteria 3093
60 Ga0068855_100179556 3300005563 Bacteria 2394
61 Ga0068855_100419481 3300005563 Bacteria 1464
62 Ga0070664_100056658 3300005564 Bacteria 3330
63 Ga0068857_100020049 3300005577 Bacteria 5879
64 Ga0068856_100000036 3300005614 Bacteria 121468
65 Ga0068856_100007014 3300005614 Bacteria 11006
66 Ga0068856_100454929 3300005614 Bacteria 1301
67 Ga0068852_100000729 3300005616 Bacteria 21570
68 Ga0075366_10000073 3300006195 Bacteria 38953
69 Ga0075366_10007201 3300006195 Bacteria 6130
70 Ga0075366_10023976 3300006195 Bacteria 3557
71 Ga0097621_100000353 3300006237 Bacteria 31725
72 Ga0097621_100001494 3300006237 Bacteria 16035
73 Ga0075370_10067937 3300006353 Bacteria 2035
74 Ga0068871_100000042 3300006358 Bacteria 67951
75 Ga0068871_100000162 3300006358 Bacteria 44419
76 Ga0068865_100000075 3300006881 Bacteria 51751
77 Ga0105240_10000185 3300009093 Bacteria 126364
78 Ga0105240_10022581 3300009093 Bacteria 8338
79 Ga0105240_10082194 3300009093 Bacteria 3956
80 Ga0105240_10089237 3300009093 Bacteria 3771
81 Ga0105240_10463636 3300009093 Bacteria 1415
82 Ga0105243_10000003 3300009148 Bacteria 712931
83 Ga0105241_10001639 3300009174 Bacteria 17064
84 Ga0105241_10007443 3300009174 Bacteria 8058
85 Ga0105241_10019658 3300009174 Bacteria 4984
86 Ga0105241_10111747 3300009174 Bacteria 2188
87 Ga0105241_10235974 3300009174 Bacteria 1544
88 Ga0105242_10010606 3300009176 Bacteria 7073
89 Ga0105237_10000154 3300009545 Bacteria 96509
90 Ga0105237_10000808 3300009545 Bacteria 42764
91 Ga0105237_10001785 3300009545 Bacteria 27820
92 Ga0105237_10002335 3300009545 Bacteria 23567
93 Ga0105237_10010324 3300009545 Bacteria 9948
94 Ga0105237_10052950 3300009545 Bacteria 4072
95 Ga0105237_10346529 3300009545 Bacteria 1490
96 Ga0105238_10007841 3300009551 Bacteria 10676
97 Ga0105238_10011638 3300009551 Bacteria 8863
98 Ga0105249_10018966 3300009553 Bacteria 6132
99 Ga0105249_10123231 3300009553 Bacteria 2466
100 Ga0105239_10000008 3300010375 Bacteria 376925
101 Ga0105239_10000045 3300010375 Bacteria 186314
102 Ga0105239_10000446 3300010375 Bacteria 60289
103 Ga0105239_10002896 3300010375 Bacteria 21449
104 Ga0105239_10048703 3300010375 Bacteria 4647
105 Ga0105239_10114553 3300010375 Bacteria 2990
106 Ga0105239_10274782 3300010375 Bacteria 1896
107 Ga0157373_10000091 3300013100 Bacteria 75012
108 Ga0157373_10003653 3300013100 Bacteria 11625
109 Ga0157373_10054956 3300013100 Bacteria 2829
110 Ga0157371_10000155 3300013102 Bacteria 100230
111 Ga0157371_10002671 3300013102 Bacteria 16870
112 Ga0157371_10019428 3300013102 Bacteria 5013
113 Ga0157371_10042384 3300013102 Bacteria 3244
114 Ga0157370_10064769 3300013104 Bacteria 3459
115 Ga0157370_10194791 3300013104 Bacteria 1881
116 Ga0157369_10001051 3300013105 Bacteria 34842
117 Ga0157369_10071612 3300013105 Bacteria 3721
118 Ga0157369_10124852 3300013105 Bacteria 2730
119 Ga0157374_10001433 3300013296 Bacteria 20152
120 Ga0157374_10009075 3300013296 Bacteria 8521
121 Ga0157374_10301027 3300013296 Bacteria 1586
122 Ga0157378_10006635 3300013297 Bacteria 10114
123 Ga0163162_10000041 3300013306 Bacteria 132375
124 Ga0163162_10003627 3300013306 Bacteria 14800
125 Ga0163162_10030011 3300013306 Bacteria 5384
126 Ga0163162_10077773 3300013306 Bacteria 3382
127 Ga0163162_10620502 3300013306 Bacteria 1206
128 Ga0157372_10000009 3300013307 Bacteria 302051
129 Ga0157372_10001387 3300013307 Bacteria 26142
130 Ga0157372_10003738 3300013307 Bacteria 16334
131 Ga0157372_10019416 3300013307 Bacteria 7327
132 Ga0157372_10069679 3300013307 Bacteria 3956
133 Ga0157372_10128176 3300013307 Bacteria 2918
134 Ga0157372_10275799 3300013307 Bacteria 1955
135 Ga0157375_10000182 3300013308 Bacteria 59120
136 Ga0157375_10012227 3300013308 Bacteria 7610
137 Ga0157375_10042141 3300013308 Bacteria 4416
138 Ga0157375_10297475 3300013308 Bacteria 1777
139 Ga0163163_10001809 3300014325 Bacteria 18036
140 Ga0163163_10707075 3300014325 Bacteria 1071
141 Ga0157377_10046968 3300014745 Bacteria 2417
142 Ga0157379_10019053 3300014968 Bacteria 6059
143 Ga0157379_10118284 3300014968 Bacteria 2383
144 Ga0157376_10001366 3300014969 Bacteria 16065
145 Ga0157376_10222559 3300014969 Bacteria 1749
146 Ga0163161_10002927 3300017792 Bacteria 12089
147 Ga0163161_10022533 3300017792 Bacteria 4437
148 Ga0163161_10124675 3300017792 Bacteria 1938
149 Ga0213872_10013780 3300021361 Bacteria 3782
150 Ga0207427_100109 3300025231 Bacteria 116061
151 Ga0209437_100096 3300025233 Bacteria 233558
152 Ga0209437_100507 3300025233 Bacteria 27709
153 Ga0209026_1000225 3300025250 Bacteria 77234
154 Ga0209026_1001350 3300025250 Bacteria 10961
155 Ga0209129_1006483 3300025258 Bacteria 3766
156 Ga0209233_1000029 3300025261 Bacteria 641642
157 Ga0209233_1003414 3300025261 Bacteria 5602
158 Ga0209233_1027993 3300025261 Bacteria 1358
159 Ga0209455_1001235 3300025272 Bacteria 12098
160 Ga0209130_1003558 3300025284 Bacteria 6519
161 Ga0207426_1000415 3300025302 Bacteria 70247
162 Ga0207647_10000135 3300025904 Bacteria 58247
163 Ga0207647_10035660 3300025904 Bacteria 3168
164 Ga0207645_10000014 3300025907 Bacteria 117512
165 Ga0207705_10000833 3300025909 Bacteria 25202
166 Ga0207705_10039697 3300025909 Bacteria 3374
167 Ga0207654_10004469 3300025911 Bacteria 7059
168 Ga0207654_10005992 3300025911 Bacteria 6117
169 Ga0207654_10015207 3300025911 Bacteria 3989
170 Ga0207654_10097780 3300025911 Bacteria 1803
171 Ga0207695_10000117 3300025913 Bacteria 237982
172 Ga0207695_10010304 3300025913 Bacteria 11443
173 Ga0207695_10011948 3300025913 Bacteria 10454
174 Ga0207671_10000185 3300025914 Bacteria 95649
175 Ga0207671_10001286 3300025914 Bacteria 29511
176 Ga0207671_10002683 3300025914 Bacteria 18663
177 Ga0207671_10003474 3300025914 Bacteria 15671
178 Ga0207660_10008055 3300025917 Bacteria 6817
179 Ga0207657_10188464 3300025919 Bacteria 1665
180 Ga0207657_10247362 3300025919 Bacteria 1422
181 Ga0207652_10011555 3300025921 Bacteria 7120
182 Ga0207694_10024184 3300025924 Bacteria 4612
183 Ga0207694_10045871 3300025924 Bacteria 3377
184 Ga0207650_10191878 3300025925 Bacteria 1632
185 Ga0207644_10017612 3300025931 Bacteria 4830
186 Ga0207644_10143756 3300025931 Bacteria 1839
187 Ga0207690_10015056 3300025932 Bacteria 4682
188 Ga0207706_10000009 3300025933 Bacteria 200607
189 Ga0207686_10041848 3300025934 Bacteria 2797
190 Ga0207709_10000008 3300025935 Bacteria 713099
191 Ga0207704_10000118 3300025938 Bacteria 43936
192 Ga0207661_10063070 3300025944 Bacteria 3000
193 Ga0207667_10000171 3300025949 Bacteria 95554
194 Ga0207667_10000236 3300025949 Bacteria 77019
195 Ga0207667_10014886 3300025949 Bacteria 8845
196 Ga0207667_10138115 3300025949 Bacteria 2510
197 Ga0207651_10005229 3300025960 Bacteria 6633
198 Ga0207677_10024067 3300026023 Bacteria 3776
199 Ga0207639_10001022 3300026041 Bacteria 19034
200 Ga0207639_10014208 3300026041 Bacteria 5591
201 Ga0207639_10223496 3300026041 Bacteria 1628
202 Ga0207702_10000088 3300026078 Bacteria 105505
203 Ga0207702_10015658 3300026078 Bacteria 6276
204 Ga0207702_10025309 3300026078 Bacteria 4925
205 Ga0207702_10414091 3300026078 Bacteria 1302
206 Ga0207648_10000459 3300026089 Bacteria 45286
207 Ga0207648_10226087 3300026089 Bacteria 1664
208 Ga0207674_10040744 3300026116 Bacteria 4808
209 Ga0207674_10156143 3300026116 Bacteria 2237
210 Ga0207683_10002362 3300026121 Bacteria 16484
211 Ga0207698_10023382 3300026142 Bacteria 4316
212 Ga0209968_1002282 3300027526 Bacteria 2902
213 Ga0209974_10008742 3300027876 Bacteria 3450
214 Ga0268266_10000177 3300028379 Bacteria 114318
215 Ga0307517_10000553 3300028786 Bacteria 63892
216 Ga0307515_10000595 3300028794 Bacteria 84423
217 Ga0307515_10001029 3300028794 Bacteria 63730
218 Ga0307515_10234983 3300028794 Bacteria 1616
219 Ga0265338_10043721 3300028800 Bacteria 4149
220 Ga0316176_1047582 3300030732 Bacteria 13233
221 Ga0316183_1089491 3300030742 Bacteria 19428
222 Ga0316181_1178606 3300030744 Bacteria 13203
223 Ga0307408_100001869 3300031548 Bacteria 15354
224 Ga0307408_100001899 3300031548 Bacteria 15198
225 Ga0307408_100013466 3300031548 Bacteria 5429
226 Ga0307405_10110649 3300031731 Bacteria 1860
227 Ga0307412_10000925 3300031911 Bacteria 16779
228 Ga0307412_10022610 3300031911 Bacteria 3857
229 Ga0307414_10181002 3300032004 Bacteria 1695
230 Ga0307507_10001172 3300033179 Bacteria 58234
231 Ga0307510_10000172 3300033180 Bacteria 54812
232 Ga0395899_0000017 3300037312 Bacteria 440179
233 Ga0395899_0000327 3300037312 Bacteria 60343
234 Ga0395900_0000197 3300037418 Bacteria 95775
235 Ga0395900_0000609 3300037418 Bacteria 48753
236 Ga0395900_0004982 3300037418 Bacteria 13961
237 Ga0395900_0261053 3300037418 Bacteria 1730
238 Ga0395898_0011895 3300037466 Bacteria 9012
239 Ga0395905_0000186 3300037471 Bacteria 99159
240 Ga0395905_0059218 3300037471 Bacteria 3580
241 Ga0395901_0000368 3300038443 Bacteria 54066
242 Ga0395901_0131861 3300038443 Bacteria 2626
243 Ga0395901_0153676 3300038443 Bacteria 2417
244 Ga0436361_0967822 3300039447 Bacteria 7535
245 Ga0439436_0041589 3300041404 Bacteria 1315
246 Ga0439448_0001244 3300042005 Bacteria 6503
247 Ga0439457_011387 3300042014 Bacteria 2024
248 Ga0451577_0014190 3300042876 Bacteria 7427
249 Ga0453683_0009891 3300044673 Bacteria 6349
250 Ga0466966_0011694 3300044684 Bacteria 5817
251 Ga0466966_0286401 3300044684 Bacteria 990
252 Ga0466961_0074001 3300044693 Bacteria 2160
253 Ga0453684_0000143 3300044712 Bacteria 315998
254 Ga0453684_0018760 3300044712 Bacteria 10589
255 Ga0453684_0148477 3300044712 Bacteria 2789
256 Ga0453684_0222057 3300044712 Bacteria 2188
257 Ga0453684_0277779 3300044712 Bacteria 1911
258 Ga0453684_0352577 3300044712 Bacteria 1659
259 Ga0466957_0200763 3300044842 Bacteria 1310
260 Ga0466959_0006644 3300045049 Bacteria 8036
261 Ga0451576_0022510 3300045051 Bacteria 6833
262 Ga0451576_0144877 3300045051 Bacteria 2477
263 Ga0451576_0210561 3300045051 Bacteria 2030
264 Ga0451576_0258771 3300045051 Bacteria 1819
265 Ga0466958_0037793 3300045836 Bacteria 2894
266 Ga0495650_0000225 3300046471 Bacteria 117898
267 Ga0495650_0024378 3300046471 Bacteria 2858
268 Ga0495585_0000074 3300046492 Bacteria 102651
269 Ga0495607_0014893 3300046501 Bacteria 5054
270 Ga0495607_0087317 3300046501 Bacteria 1698
271 Ga0495606_0000074 3300046507 Bacteria 170848
272 Ga0495606_0011030 3300046507 Bacteria 7416
273 Ga0495606_0015802 3300046507 Bacteria 5793
274 Ga0495606_0025785 3300046507 Bacteria 4201
275 Ga0495606_0067679 3300046507 Bacteria 2261
276 Ga0495610_0001170 3300046512 Bacteria 23824
277 Ga0495616_0002088 3300046513 Bacteria 13429
278 Ga0495631_0005662 3300046518 Bacteria 6518
279 Ga0495631_0016589 3300046518 Bacteria 3507
280 Ga0495637_0053489 3300046520 Bacteria 1680
281 Ga0495648_0031261 3300046524 Bacteria 3508
282 Ga0495609_0014746 3300046538 Bacteria 3669
283 Ga0495622_0034930 3300046557 Bacteria 2345
284 Ga0495633_0000006 3300046558 Bacteria 326774
285 Ga0495633_0000025 3300046558 Bacteria 218627
286 Ga0495633_0005495 3300046558 Bacteria 7716
287 Ga0495668_0000011 3300046616 Bacteria 472186
288 Ga0495625_0000067 3300046660 Bacteria 171483
289 Ga0495625_0000660 3300046660 Bacteria 49270
290 Ga0495625_0002214 3300046660 Bacteria 21483
291 Ga0495625_0020512 3300046660 Bacteria 5100
292 Ga0495661_0001183 3300046665 Bacteria 22653
293 Ga0495661_0003220 3300046665 Bacteria 12186
294 Ga0495670_0069475 3300046691 Bacteria 1781
295 Ga0495649_0000054 3300046694 Bacteria 107048
296 Ga0495649_0074641 3300046694 Bacteria 1817
297 Ga0495660_0078823 3300046810 Bacteria 1731
298 Ga0495683_0038971 3300047323 Bacteria 2403
299 Ga0495687_001083 3300047443 Bacteria 26756
300 Ga0495687_002879 3300047443 Bacteria 13149
301 Ga0495685_040045 3300047447 Bacteria 1603
302 Ga0495673_0035812 3300047469 Bacteria 2283
303 Ga0495686_0000783 3300047472 Bacteria 41638
304 Ga0495686_0001252 3300047472 Bacteria 28871
305 Ga0495686_0108544 3300047472 Bacteria 1667
306 Ga0495614_0072355 3300048089 Bacteria 1487
307 Ga0496100_0020389 3300048903 Bacteria 3974
308 Ga0496101_0197322 3300048904 Unclassified 1555
309 Ga0496102_0389927 3300048905 Unclassified 1310
310 Ga0496104_0377535 3300048907 Unclassified 1330
311 Ga0496105_0202861 3300048908 Unclassified 1618
312 Ga0496114_0298071 3300048917 Unclassified 1423
313 Ga0496115_0045793 3300048918 Bacteria 3493
314 Ga0496116_0005899 3300048919 Bacteria 11244
315 Ga0496117_0005949 3300048920 Bacteria 12577
316 Ga0496118_0106467 3300048921 Bacteria 1876
317 Ga0496122_0003774 3300048925 Bacteria 19531
318 Ga0496123_0018910 3300048926 Bacteria 5453
319 Ga0496125_0003293 3300048928 Bacteria 19812
320 Ga0496126_0021822 3300048929 Bacteria 6247
321 Ga0496126_0377907 3300048929 Bacteria 1154
322 Ga0495678_010512 3300049459 Bacteria 4495
323 Ga0501034_0037681 3300049571 Bacteria 4897
324 Ga0501036_0305702 3300049572 Bacteria 1330
325 Ga0501043_0266503 3300049579 Bacteria 1316
326 Ga0501047_0050690 3300049581 Bacteria 4009
327 Ga0501217_070423 3300049661 Unclassified 951
328 Ga0501044_0013100 3300049823 Bacteria 8977
329 nmdc:mga0k408_106_c1 3300050493 Bacteria 40767
330 nmdc:mga0k408_3774_c1 3300050493 Bacteria 8035
331 nmdc:mga0k408_626_c1 3300050493 Bacteria 19472
332 Ga0500635_0005805 3300053080 Bacteria 3265
333 Ga0500608_001805 3300053122 Bacteria 7635
334 Ga0500614_004410 3300053123 Bacteria 2974
335 Ga0500618_000006 3300053125 Bacteria 239188
336 Ga0500622_0000891 3300053156 Bacteria 25423
337 Ga0500624_000514 3300053157 Bacteria 11241
338 2599479977 2599185184 Bacteria 6430550
339 2722730553 2721755487 Bacteria 6357185
340 2819677351 2818991460 Bacteria 7595395
341 2842905219 2842903701 Bacteria 6986368
342 2852625727 2852623160 Bacteria 4376875
343 2881250588 2881247448 Bacteria 3717788
344 2884797284 2884791551 Bacteria 8511252
345 2884935748 2884933994 Bacteria 4535041
346 2890739349 2890737413 Bacteria 4269751
347 2896319555 2896317667 Bacteria 4606601
348 2896346000 2896344016 Bacteria 3811746
349 2898713644 2898713307 Bacteria 4110805
350 2904785177 2904780799 Bacteria 5840761
351 2911142742 2911138879 Bacteria 5811561
352 2919181747 2919177583 Bacteria 5641607
353 2919440180 2919437846 Bacteria 6199444
354 2928081107 2928078545 Bacteria 6534839
355 2928152472 2928147474 Bacteria 6512076
356 2929177247 2929177148 Bacteria 7883697
357 2932087757 2932082852 Bacteria 6563563
358 2945979616 2945977869 Bacteria 7777518
359 2946014517 2946013367 Bacteria 7766675
360 2958514410 2958512119 Bacteria 4528530
361 2977235581 2977232053 Bacteria 5485925
362 3003236716 3003233435 Bacteria 4458031
363 8055588900 8055588893 Bacteria 3619545
364 Ga0105237_10296283
365 SwRhRL2b_contig_1558989
366 JGI24740J21852_10015341
367 JGI24739J22299_10045081
368 JGI24737J22298_10000077
369 JGI24737J22298_10035692
370 JGI24735J21928_10000005
371 JGI24744J21845_10016887
372 JGI25162J39368_1000596
373 JGI25165J46597_1002041
374 rootH1_10026072
375 rootH2_10024240
376 rootH2_10035444
377 rootH2_10069782
378 rootH2_10076019
379 rootH2_10122926
380 rootH2_10209505
381 rootL2_10021894
382 rootH1_10005386
383 rootH1_10007323
384 rootH1_10080363
385 JGI25160J50197_1007425
386 Ga0055529_1005870
387 Ga0058863_11005245
388 Ga0070658_10000917
389 Ga0070658_10050510
390 Ga0070676_10000030
391 Ga0070683_100182168
392 Ga0070670_100171232
393 Ga0070666_10118763
394 Ga0070680_100001753
395 Ga0068868_100364142
396 Ga0070660_100107558
397 Ga0070660_100111286
398 Ga0070671_100001418
399 Ga0070671_100062693
400 Ga0070674_100107452
401 Ga0070673_100001160
402 Ga0070659_100024209
403 Ga0070659_100088431
404 Ga0070659_100101692
405 Ga0070663_100218493
406 Ga0070678_100001694
407 Ga0070662_100000003
408 Ga0070681_10024611
409 Ga0068867_100012919
410 Ga0068867_100158694
411 Ga0070679_100002253
412 Ga0070679_100081415
413 Ga0070684_100084098
414 Ga0068853_100003188
415 Ga0068853_100250764
416 Ga0070672_100312038
417 Ga0070665_100000212
418 Ga0070665_100147639
419 Ga0070665_100578087
420 Ga0068855_100000127
421 Ga0068855_100000201
422 Ga0068855_100114425
423 Ga0068855_100179556
424 Ga0068855_100419481
425 Ga0070664_100056658
426 Ga0068857_100020049
427 Ga0068856_100000036
428 Ga0068856_100007014
429 Ga0068856_100454929
430 Ga0068852_100000729
431 Ga0075366_10000073
432 Ga0075366_10007201
433 Ga0075366_10023976
434 Ga0097621_100000353
435 Ga0097621_100001494
436 Ga0075370_10067937
437 Ga0068871_100000042
438 Ga0068871_100000162
439 Ga0068865_100000075
440 Ga0105240_10000185
441 Ga0105240_10022581
442 Ga0105240_10082194
443 Ga0105240_10089237
444 Ga0105240_10463636
445 Ga0105243_10000003
446 Ga0105241_10001639
447 Ga0105241_10007443
448 Ga0105241_10019658
449 Ga0105241_10111747
450 Ga0105241_10235974
451 Ga0105242_10010606
452 Ga0105237_10000154
453 Ga0105237_10000808
454 Ga0105237_10001785
455 Ga0105237_10002335
456 Ga0105237_10010324
457 Ga0105237_10052950
458 Ga0105237_10346529
459 Ga0105238_10007841
460 Ga0105238_10011638
461 Ga0105249_10018966
462 Ga0105249_10123231
463 Ga0105239_10000008
464 Ga0105239_10000045
465 Ga0105239_10000446
466 Ga0105239_10002896
467 Ga0105239_10048703
468 Ga0105239_10114553
469 Ga0105239_10274782
470 Ga0157373_10000091
471 Ga0157373_10003653
472 Ga0157373_10054956
473 Ga0157371_10000155
474 Ga0157371_10002671
475 Ga0157371_10019428
476 Ga0157371_10042384
477 Ga0157370_10064769
478 Ga0157370_10194791
479 Ga0157369_10001051
480 Ga0157369_10071612
481 Ga0157369_10124852
482 Ga0157374_10001433
483 Ga0157374_10009075
484 Ga0157374_10301027
485 Ga0157378_10006635
486 Ga0163162_10000041
487 Ga0163162_10003627
488 Ga0163162_10030011
489 Ga0163162_10077773
490 Ga0163162_10620502
491 Ga0157372_10000009
492 Ga0157372_10001387
493 Ga0157372_10003738
494 Ga0157372_10019416
495 Ga0157372_10069679
496 Ga0157372_10128176
497 Ga0157372_10275799
498 Ga0157375_10000182
499 Ga0157375_10012227
500 Ga0157375_10042141
501 Ga0157375_10297475
502 Ga0163163_10001809
503 Ga0163163_10707075
504 Ga0157377_10046968
505 Ga0157379_10019053
506 Ga0157379_10118284
507 Ga0157376_10001366
508 Ga0157376_10222559
509 Ga0163161_10002927
510 Ga0163161_10022533
511 Ga0163161_10124675
512 Ga0213872_10013780
513 Ga0207427_100109
514 Ga0209437_100096
515 Ga0209437_100507
516 Ga0209026_1000225
517 Ga0209026_1001350
518 Ga0209129_1006483
519 Ga0209233_1000029
520 Ga0209233_1003414
521 Ga0209233_1027993
522 Ga0209455_1001235
523 Ga0209130_1003558
524 Ga0207426_1000415
525 Ga0207647_10000135
526 Ga0207647_10035660
527 Ga0207645_10000014
528 Ga0207705_10000833
529 Ga0207705_10039697
530 Ga0207654_10004469
531 Ga0207654_10005992
532 Ga0207654_10015207
533 Ga0207654_10097780
534 Ga0207695_10000117
535 Ga0207695_10010304
536 Ga0207695_10011948
537 Ga0207671_10000185
538 Ga0207671_10001286
539 Ga0207671_10002683
540 Ga0207671_10003474
541 Ga0207660_10008055
542 Ga0207657_10188464
543 Ga0207657_10247362
544 Ga0207652_10011555
545 Ga0207694_10024184
546 Ga0207694_10045871
547 Ga0207650_10191878
548 Ga0207644_10017612
549 Ga0207644_10143756
550 Ga0207690_10015056
551 Ga0207706_10000009
552 Ga0207686_10041848
553 Ga0207709_10000008
554 Ga0207704_10000118
555 Ga0207661_10063070
556 Ga0207667_10000171
557 Ga0207667_10000236
558 Ga0207667_10014886
559 Ga0207667_10138115
560 Ga0207651_10005229
561 Ga0207677_10024067
562 Ga0207639_10001022
563 Ga0207639_10014208
564 Ga0207639_10223496
565 Ga0207702_10000088
566 Ga0207702_10015658
567 Ga0207702_10025309
568 Ga0207702_10414091
569 Ga0207648_10000459
570 Ga0207648_10226087
571 Ga0207674_10040744
572 Ga0207674_10156143
573 Ga0207683_10002362
574 Ga0207698_10023382
575 Ga0209968_1002282
576 Ga0209974_10008742
577 Ga0268266_10000177
578 Ga0307517_10000553
579 Ga0307515_10000595
580 Ga0307515_10001029
581 Ga0307515_10234983
582 Ga0265338_10043721
583 Ga0316176_1047582
584 Ga0316183_1089491
585 Ga0316181_1178606
586 Ga0307408_100001869
587 Ga0307408_100001899
588 Ga0307408_100013466
589 Ga0307405_10110649
590 Ga0307412_10000925
591 Ga0307412_10022610
592 Ga0307414_10181002
593 Ga0307507_10001172
594 Ga0307510_10000172
595 Ga0395899_0000017
596 Ga0395899_0000327
597 Ga0395900_0000197
598 Ga0395900_0000609
599 Ga0395900_0004982
600 Ga0395900_0261053
601 Ga0395898_0011895
602 Ga0395905_0000186
603 Ga0395905_0059218
604 Ga0395901_0000368
605 Ga0395901_0131861
606 Ga0395901_0153676
607 Ga0436361_0967822
608 Ga0439436_0041589
609 Ga0439448_0001244
610 Ga0439457_011387
611 Ga0451577_0014190
612 Ga0453683_0009891
613 Ga0466966_0011694
614 Ga0466966_0286401
615 Ga0466961_0074001
616 Ga0453684_0000143
617 Ga0453684_0018760
618 Ga0453684_0148477
619 Ga0453684_0222057
620 Ga0453684_0277779
621 Ga0453684_0352577
622 Ga0466957_0200763
623 Ga0466959_0006644
624 Ga0451576_0022510
625 Ga0451576_0144877
626 Ga0451576_0210561
627 Ga0451576_0258771
628 Ga0466958_0037793
629 Ga0495650_0000225
630 Ga0495650_0024378
631 Ga0495585_0000074
632 Ga0495607_0014893
633 Ga0495607_0087317
634 Ga0495606_0000074
635 Ga0495606_0011030
636 Ga0495606_0015802
637 Ga0495606_0025785
638 Ga0495606_0067679
639 Ga0495610_0001170
640 Ga0495616_0002088
641 Ga0495631_0005662
642 Ga0495631_0016589
643 Ga0495637_0053489
644 Ga0495648_0031261
645 Ga0495609_0014746
646 Ga0495622_0034930
647 Ga0495633_0000006
648 Ga0495633_0000025
649 Ga0495633_0005495
650 Ga0495668_0000011
651 Ga0495625_0000067
652 Ga0495625_0000660
653 Ga0495625_0002214
654 Ga0495625_0020512
655 Ga0495661_0001183
656 Ga0495661_0003220
657 Ga0495670_0069475
658 Ga0495649_0000054
659 Ga0495649_0074641
660 Ga0495660_0078823
661 Ga0495683_0038971
662 Ga0495687_001083
663 Ga0495687_002879
664 Ga0495685_040045
665 Ga0495673_0035812
666 Ga0495686_0000783
667 Ga0495686_0001252
668 Ga0495686_0108544
669 Ga0495614_0072355
670 Ga0496100_0020389
671 Ga0496101_0197322
672 Ga0496102_0389927
673 Ga0496104_0377535
674 Ga0496105_0202861
675 Ga0496114_0298071
676 Ga0496115_0045793
677 Ga0496116_0005899
678 Ga0496117_0005949
679 Ga0496118_0106467
680 Ga0496122_0003774
681 Ga0496123_0018910
682 Ga0496125_0003293
683 Ga0496126_0021822
684 Ga0496126_0377907
685 Ga0495678_010512
686 Ga0501034_0037681
687 Ga0501036_0305702
688 Ga0501043_0266503
689 Ga0501047_0050690
690 Ga0501217_070423
691 Ga0501044_0013100
692 nmdc:mga0k408_106_c1
693 nmdc:mga0k408_3774_c1
694 nmdc:mga0k408_626_c1
695 Ga0500635_0005805
696 Ga0500608_001805
697 Ga0500614_004410
698 Ga0500618_000006
699 Ga0500622_0000891
700 Ga0500624_000514
701 2599479977
702 2722730553
703 2819677351
704 2842905219
705 2852625727
706 2881250588
707 2884797284
708 2884935748
709 2890739349
710 2896319555
711 2896346000
712 2898713644
713 2904785177
714 2911142742
715 2919181747
716 2919440180
717 2928081107
718 2928152472
719 2929177247
720 2932087757
721 2945979616
722 2946014517
723 2958514410
724 2977235581
725 3003236716
726 8055588900

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17763

Asparaginase_C

Glutaminase/Asparaginase C-terminal domain

233

348

0.98

PF00710

Asparaginase

Asparaginase, N-terminal

22

216

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7r6b-assembly1.cif.gz_B crystal structure of mutant r43d/l124d/r125a/c273s of l-asparaginase i from yersinia pestis 0.935 1 336
5ot0-assembly2.cif.gz_D the thermostable l-asparaginase from thermococcus kodakarensis 0.9333 3 338
3ntx-assembly1.cif.gz_A crystal structure of l-asparaginase i from yersinia pestis 0.9325 2 338
2p2d-assembly1.cif.gz_B crystal structure and allosteric regulation of the cytoplasmic escherichia coli l-asparaginase i 0.9318 1 338
2ocd-assembly1.cif.gz_A crystal structure of l-asparaginase i from vibrio cholerae o1 biovar eltor str. n16961 0.9302 2 337
ID Description Score Start End Superfamily
af_Q86I82_300_429_3.40.50.40 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9426 210 338 3.40.50.40
af_A4IDM2_236_364_3.40.50.40 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9374 213 336 3.40.50.40
af_Q4DZN4_253_381_3.40.50.40 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9362 213 336 3.40.50.40
2p2dB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9315 210 338 3.40.50.40
af_Q86I82_300_429_3.40.50.40 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9289 210 338 3.40.50.40
ID Description Score Start End GO Terms
AF-A0A4R1LW28-F1-model_v4 L-asparaginase 0.9878 1 337 GO:0004067
GO:0006520
AF-A0A3D6ES15-F1-model_v4 L-asparaginase 1 0.9856 2 181 GO:0004067
AF-A0A349QW88-F1-model_v4 Type I asparaginase 0.9816 1 339 GO:0004067
GO:0006520
AF-A0A349D522-F1-model_v4 L-asparaginase 1 0.9814 2 338 GO:0004067
GO:0006520
AF-A0A1G9W9D9-F1-model_v4 L-asparaginase 0.9802 1 338 GO:0004067
GO:0006520

Map