F422962

General Info

Members Datasets Scaffolds Average Seq Length
363 247 726 367

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10111405|Ga0157380_101114052
Length 397
Sequence MIDSTVRVPAHDPEKWVPVFGQDHAPKGERPMNIEVRQPLRAQKTRYGIVDCDIHPKLTYDELRPYLSNQWWSHLQTYGLRPRHGFAKTYPMPKITPQAARRDAWPPTGGLPGSDLAFMQQQLLDFYDMDYGIMNPLSPTGQGDQNPDFSAAMAFASNEAQVARWTSREKRLKASVVVPYENPEASKAEIKRRAGNKDYAQVFMLSRTAEAHGRRRYWPIYEAAVEAGLPVGIHVFGYSGWAMTNSGWPSFYIEEMTEHATGQAAVVASMIFEGLFEQYRDLKVVLIESGFGWLPALGWRLDKHWERMRDEVPHVRRPPSEYIREHFWVSTQPMEEAEDPDHVMDAMRWIGFDRILFASDYPHWDFDDPFLALPPSLTEQQRQMIYAGNAKKLYGLG

Samples

Sample ID Description Type Environment
1 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
85 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
129 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
130 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
131 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
132 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
133 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
134 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
135 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
136 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
137 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
138 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
139 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
140 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
141 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
144 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
145 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
150 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
151 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
152 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
153 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
154 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
155 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
156 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
157 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
158 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
159 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
160 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
161 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
162 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
163 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
164 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
165 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
166 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
167 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
168 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
169 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
170 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
171 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
172 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
173 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
174 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
175 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
176 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
177 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
178 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
179 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
180 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
181 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
182 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
186 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
187 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
188 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
189 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
190 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
207 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
208 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
209 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
219 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
220 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
221 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
224 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
225 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
226 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
227 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
228 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
229 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
230 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
231 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
232 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
233 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
234 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
235 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
236 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
237 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
238 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
239 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
240 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
241 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
242 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
243 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
244 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
245 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
246 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
247 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.07
Metatranscriptomes 0.83
Isolates 1.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.13
Nodule 0
Rhizoplane 8.82
Rhizosphere 83.47
Stem 0
Stem Tuber 0
Unclassified 0.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157380_10111405 3300014326 Bacteria 2300
2 JGI24750J21931_1001106 3300002070 Bacteria 3491
3 JGI24744J21845_10011934 3300002077 Bacteria 1768
4 JGI25153J46596_10031975 3300003215 Bacteria 1762
5 JGI25404J52841_10000913 3300003659 Bacteria 4799
6 JGI25405J52794_10001601 3300003911 Bacteria 3758
7 Ga0070658_10109749 3300005327 Bacteria 2284
8 Ga0070676_10134247 3300005328 Bacteria 1568
9 Ga0070683_100033091 3300005329 Bacteria 4712
10 Ga0070683_100291652 3300005329 Bacteria 1551
11 Ga0070670_100093731 3300005331 Bacteria 2583
12 Ga0070680_100006835 3300005336 Bacteria 8695
13 Ga0070680_100090650 3300005336 Bacteria 2531
14 Ga0068868_100005973 3300005338 Bacteria 8590
15 Ga0070689_100276138 3300005340 Bacteria 1393
16 Ga0070661_100108715 3300005344 Unclassified 2069
17 Ga0070692_10124319 3300005345 Bacteria 1442
18 Ga0070669_100099627 3300005353 Bacteria 2190
19 Ga0070671_100106347 3300005355 Bacteria 2355
20 Ga0070674_100003515 3300005356 Bacteria 8801
21 Ga0070673_100034886 3300005364 Bacteria 3811
22 Ga0070673_100039540 3300005364 Bacteria 3611
23 Ga0070688_100018857 3300005365 Bacteria 3988
24 Ga0070688_100194913 3300005365 Bacteria 1414
25 Ga0070667_100067133 3300005367 Bacteria 3049
26 Ga0070703_10001575 3300005406 Bacteria 6793
27 Ga0070709_10094648 3300005434 Bacteria 1977
28 Ga0070714_100090388 3300005435 Bacteria 2681
29 Ga0070705_100000277 3300005440 Bacteria 30646
30 Ga0070700_100079315 3300005441 Bacteria 2116
31 Ga0070694_100024161 3300005444 Bacteria 3920
32 Ga0070708_100001133 3300005445 Bacteria 20453
33 Ga0070663_100073968 3300005455 Bacteria 2487
34 Ga0070678_100069567 3300005456 Bacteria 2628
35 Ga0070662_100025624 3300005457 Bacteria 4074
36 Ga0070662_100053704 3300005457 Bacteria 2918
37 Ga0070681_10011683 3300005458 Bacteria 8698
38 Ga0070681_10218410 3300005458 Bacteria 1822
39 Ga0068867_100015548 3300005459 Bacteria 5399
40 Ga0068867_100060267 3300005459 Bacteria 2815
41 Ga0070685_10038700 3300005466 Bacteria 2705
42 Ga0070699_100000435 3300005518 Bacteria 40050
43 Ga0070684_100017443 3300005535 Bacteria 5893
44 Ga0070697_100011752 3300005536 Bacteria 6850
45 Ga0068853_100159483 3300005539 Bacteria 2035
46 Ga0070672_100030934 3300005543 Bacteria 4026
47 Ga0070696_100000789 3300005546 Bacteria 20381
48 Ga0070693_100094277 3300005547 Bacteria 1811
49 Ga0070704_100000598 3300005549 Bacteria 17320
50 Ga0068855_100109487 3300005563 Bacteria 3172
51 Ga0070702_100082371 3300005615 Bacteria 1930
52 Ga0068859_100012527 3300005617 Bacteria 8531
53 Ga0068864_100169356 3300005618 Bacteria 1991
54 Ga0068870_10031635 3300005840 Bacteria 2683
55 Ga0068860_100002995 3300005843 Bacteria 17450
56 Ga0068862_100000834 3300005844 Bacteria 30467
57 Ga0081455_10023684 3300005937 Bacteria 5707
58 Ga0081455_10024718 3300005937 Bacteria 5557
59 Ga0081538_10011003 3300005981 Bacteria 7362
60 Ga0081538_10033310 3300005981 Bacteria 3432
61 Ga0081540_1000183 3300005983 Bacteria 65356
62 Ga0081540_1008066 3300005983 Bacteria 7402
63 Ga0081540_1027266 3300005983 Bacteria 3241
64 Ga0070717_10048242 3300006028 Bacteria 3492
65 Ga0075365_10013485 3300006038 Bacteria 4892
66 Ga0075364_10055222 3300006051 Bacteria 2598
67 Ga0070716_100036221 3300006173 Bacteria 2719
68 Ga0070712_100132174 3300006175 Bacteria 1893
69 Ga0075362_10007255 3300006177 Bacteria 4187
70 Ga0075367_10049494 3300006178 Bacteria 2477
71 Ga0075366_10056049 3300006195 Bacteria 2340
72 Ga0097621_100060742 3300006237 Bacteria 3099
73 Ga0075428_100005749 3300006844 Bacteria 13779
74 Ga0075428_100064730 3300006844 Bacteria 4005
75 Ga0075428_100131814 3300006844 Bacteria 2718
76 Ga0075430_100016861 3300006846 Bacteria 6222
77 Ga0075430_100054106 3300006846 Bacteria 3377
78 Ga0075430_100061093 3300006846 Bacteria 3167
79 Ga0075431_100000004 3300006847 Bacteria 106006
80 Ga0075431_100002116 3300006847 Bacteria 18969
81 Ga0075431_100010686 3300006847 Bacteria 9223
82 Ga0075431_100200753 3300006847 Bacteria 2040
83 Ga0075431_100296303 3300006847 Bacteria 1635
84 Ga0075434_100124057 3300006871 Bacteria 2599
85 Ga0075429_100008566 3300006880 Bacteria 8898
86 Ga0075436_100017326 3300006914 Bacteria 4931
87 Ga0097620_100012528 3300006931 Bacteria 8531
88 Ga0075435_100037094 3300007076 Bacteria 3880
89 Ga0075435_100116946 3300007076 Bacteria 2222
90 Ga0111539_10001363 3300009094 Bacteria 32517
91 Ga0111539_10072555 3300009094 Bacteria 4059
92 Ga0111539_10150715 3300009094 Bacteria 2722
93 Ga0111539_10343780 3300009094 Bacteria 1737
94 Ga0111539_10525323 3300009094 Bacteria 1379
95 Ga0105245_10153066 3300009098 Bacteria 2182
96 Ga0114129_10000327 3300009147 Bacteria 55595
97 Ga0114129_10004711 3300009147 Bacteria 19257
98 Ga0114129_10352385 3300009147 Bacteria 1949
99 Ga0105248_10100961 3300009177 Bacteria 3252
100 Ga0105238_10049356 3300009551 Bacteria 4239
101 Ga0105238_10372873 3300009551 Bacteria 1418
102 Ga0105249_10002048 3300009553 Bacteria 17485
103 Ga0105249_10043653 3300009553 Bacteria 4077
104 Ga0105246_10065968 3300011119 Bacteria 2533
105 Ga0157374_10017481 3300013296 Bacteria 6316
106 Ga0157378_10363360 3300013297 Bacteria 1417
107 Ga0163163_10013323 3300014325 Bacteria 7524
108 Ga0163163_10042825 3300014325 Bacteria 4435
109 Ga0163163_10328937 3300014325 Bacteria 1582
110 Ga0157377_10043980 3300014745 Bacteria 2488
111 Ga0157376_10226035 3300014969 Bacteria 1736
112 Ga0206356_10536564 3300020070 Bacteria 1346
113 Ga0206350_10651046 3300020080 Bacteria 2258
114 Ga0213875_10000040 3300021388 Bacteria 156362
115 Ga0213875_10004663 3300021388 Bacteria 7469
116 Ga0224712_10065144 3300022467 Bacteria 1463
117 Ga0209758_1000362 3300025297 Bacteria 80796
118 Ga0207656_10030823 3300025321 Bacteria 2218
119 Ga0207653_10003194 3300025885 Bacteria 5177
120 Ga0207682_10006764 3300025893 Bacteria 4604
121 Ga0207682_10062057 3300025893 Bacteria 1566
122 Ga0207642_10115464 3300025899 Bacteria 1375
123 Ga0207710_10013511 3300025900 Bacteria 3435
124 Ga0207688_10001315 3300025901 Bacteria 12902
125 Ga0207688_10093926 3300025901 Bacteria 1725
126 Ga0207680_10127170 3300025903 Bacteria 1674
127 Ga0207647_10078224 3300025904 Bacteria 1987
128 Ga0207645_10046253 3300025907 Bacteria 2780
129 Ga0207643_10017902 3300025908 Bacteria 3880
130 Ga0207707_10213390 3300025912 Bacteria 1681
131 Ga0207693_10037474 3300025915 Bacteria 3821
132 Ga0207663_10116521 3300025916 Bacteria 1822
133 Ga0207660_10002338 3300025917 Bacteria 12483
134 Ga0207662_10004381 3300025918 Bacteria 7418
135 Ga0207662_10024128 3300025918 Bacteria 3499
136 Ga0207657_10122402 3300025919 Bacteria 2140
137 Ga0207646_10169569 3300025922 Bacteria 1971
138 Ga0207681_10213993 3300025923 Bacteria 1487
139 Ga0207659_10067109 3300025926 Bacteria 2605
140 Ga0207659_10096196 3300025926 Bacteria 2222
141 Ga0207687_10082109 3300025927 Bacteria 2331
142 Ga0207706_10032819 3300025933 Bacteria 4621
143 Ga0207706_10053085 3300025933 Bacteria 3578
144 Ga0207686_10047787 3300025934 Bacteria 2648
145 Ga0207670_10036272 3300025936 Bacteria 3205
146 Ga0207669_10049173 3300025937 Bacteria 2511
147 Ga0207669_10068829 3300025937 Bacteria 2212
148 Ga0207665_10137788 3300025939 Bacteria 1738
149 Ga0207691_10016511 3300025940 Bacteria 7010
150 Ga0207691_10019307 3300025940 Bacteria 6451
151 Ga0207689_10013733 3300025942 Bacteria 6902
152 Ga0207679_10158191 3300025945 Bacteria 1852
153 Ga0207712_10008490 3300025961 Bacteria 6495
154 Ga0207712_10038173 3300025961 Bacteria 3283
155 Ga0207639_10116733 3300026041 Bacteria 2186
156 Ga0207678_10036897 3300026067 Bacteria 4255
157 Ga0207678_10049770 3300026067 Bacteria 3621
158 Ga0207641_10260507 3300026088 Bacteria 1623
159 Ga0207648_10011741 3300026089 Bacteria 8238
160 Ga0207648_10036903 3300026089 Bacteria 4305
161 Ga0207676_10062866 3300026095 Bacteria 2946
162 Ga0207676_10069672 3300026095 Bacteria 2817
163 Ga0207676_10182146 3300026095 Bacteria 1840
164 Ga0207674_10000934 3300026116 Bacteria 38036
165 Ga0207674_10055409 3300026116 Bacteria 4031
166 Ga0207674_10080008 3300026116 Bacteria 3271
167 Ga0207675_100052205 3300026118 Bacteria 3815
168 Ga0207675_100103042 3300026118 Bacteria 2689
169 Ga0207683_10008611 3300026121 Bacteria 8727
170 Ga0207683_10021138 3300026121 Bacteria 5570
171 Ga0209588_1022122 3300027671 Bacteria 2000
172 Ga0207428_10034064 3300027907 Bacteria 4177
173 Ga0268265_10198643 3300028380 Bacteria 1738
174 Ga0268264_10001956 3300028381 Bacteria 18511
175 Ga0265340_10014951 3300031247 Bacteria 4042
176 Ga0265340_10027490 3300031247 Bacteria 2868
177 Ga0265340_10101418 3300031247 Bacteria 1337
178 Ga0265339_10049455 3300031249 Bacteria 2302
179 Ga0265316_10075990 3300031344 Bacteria 2582
180 Ga0373926_0022957 3300035083 Bacteria 2165
181 Ga0373944_0004843 3300035089 Bacteria 3524
182 Ga0373944_0022377 3300035089 Bacteria 1836
183 Ga0373923_0006924 3300035111 Bacteria 3952
184 Ga0373936_0004483 3300035113 Bacteria 5280
185 Ga0373953_0012170 3300035117 Bacteria 3040
186 Ga0373954_0014471 3300035118 Bacteria 3517
187 Ga0373954_0032343 3300035118 Bacteria 2418
188 Ga0373956_0031712 3300035119 Bacteria 2317
189 Ga0373946_0000366 3300035171 Bacteria 14664
190 Ga0373946_0052945 3300035171 Bacteria 1704
191 Ga0373955_0026589 3300035172 Bacteria 2982
192 Ga0373924_0006122 3300035410 Bacteria 4294
193 Ga0373931_0144596 3300035691 Bacteria 1381
194 Ga0373935_0109332 3300035692 Bacteria 1833
195 Ga0373927_0004468 3300035695 Bacteria 9791
196 Ga0373927_0013928 3300035695 Bacteria 5335
197 Ga0373927_0062651 3300035695 Bacteria 2405
198 Ga0373933_0030739 3300035724 Bacteria 3111
199 Ga0373947_0051576 3300035725 Bacteria 2475
200 Ga0373937_0000003 3300036401 Bacteria 235408
201 Ga0373925_0000052 3300037068 Bacteria 127490
202 Ga0395898_0053912 3300037466 Bacteria 3926
203 Ga0436364_0411364 3300037853 Bacteria 19778
204 Ga0436364_0633592 3300037853 Bacteria 16701
205 Ga0436365_0375308 3300039437 Bacteria 5622
206 Ga0436365_1131801 3300039437 Bacteria 2944
207 Ga0436365_1149266 3300039437 Bacteria 1274
208 Ga0436362_0184614 3300039453 Bacteria 1730
209 Ga0451853_3566880 3300041512 Bacteria 1801
210 Ga0439446_0037347 3300042156 Bacteria 1422
211 Ga0466957_0045506 3300044842 Bacteria 2662
212 Ga0495592_0000331 3300046454 Bacteria 39293
213 Ga0495629_0126770 3300046459 Bacteria 1778
214 Ga0495641_0049048 3300046461 Bacteria 1934
215 Ga0495651_0000832 3300046462 Bacteria 24002
216 Ga0495653_0002755 3300046463 Bacteria 14019
217 Ga0495662_0032626 3300046476 Bacteria 2516
218 Ga0495662_0035119 3300046476 Bacteria 2419
219 Ga0495664_0000162 3300046477 Bacteria 32874
220 Ga0495608_0000239 3300046511 Bacteria 39851
221 Ga0495608_0202328 3300046511 Bacteria 1251
222 Ga0495618_0000022 3300046514 Bacteria 127582
223 Ga0495628_0000011 3300046516 Bacteria 225267
224 Ga0495630_0001372 3300046517 Bacteria 16772
225 Ga0495652_0000014 3300046529 Bacteria 225484
226 Ga0495640_0000008 3300046533 Bacteria 220320
227 Ga0495587_0000347 3300046536 Bacteria 33002
228 Ga0495598_0002570 3300046537 Bacteria 3754
229 Ga0495645_0000007 3300046543 Bacteria 376299
230 Ga0495645_0163041 3300046543 Bacteria 1540
231 Ga0495667_0000013 3300046559 Bacteria 220294
232 Ga0495656_0011146 3300046615 Bacteria 3293
233 Ga0495634_0001295 3300046642 Bacteria 22846
234 Ga0495635_0000012 3300046663 Bacteria 225271
235 Ga0495659_0012900 3300046664 Bacteria 2715
236 Ga0495657_0035191 3300046675 Bacteria 3472
237 Ga0495599_0000008 3300046678 Bacteria 225534
238 Ga0495623_0000500 3300046679 Bacteria 25998
239 Ga0495646_0000004 3300046680 Bacteria 268993
240 Ga0495624_0013461 3300046690 Bacteria 5578
241 Ga0495624_0029118 3300046690 Bacteria 3605
242 Ga0495670_0009469 3300046691 Bacteria 4788
243 Ga0495600_0000084 3300046809 Bacteria 51484
244 Ga0495604_0000001 3300047317 Bacteria 708627
245 Ga0495674_0000630 3300047319 Bacteria 33002
246 Ga0495674_0177776 3300047319 Bacteria 1773
247 Ga0495680_0002587 3300047322 Bacteria 18422
248 Ga0495680_0054582 3300047322 Bacteria 3102
249 Ga0495675_0000023 3300047444 Bacteria 111081
250 Ga0495684_0000007 3300047471 Bacteria 225614
251 Ga0495686_0064740 3300047472 Bacteria 2262
252 Ga0495593_0001338 3300047673 Bacteria 14404
253 Ga0495593_0109790 3300047673 Bacteria 1409
254 Ga0495602_0000431 3300048088 Bacteria 39378
255 Ga0496100_0140319 3300048903 Bacteria 1712
256 Ga0496100_0211438 3300048903 Bacteria 1419
257 Ga0496101_0052891 3300048904 Bacteria 2928
258 Ga0496101_0188982 3300048904 Bacteria 1589
259 Ga0496102_0026659 3300048905 Bacteria 5157
260 Ga0496102_0111147 3300048905 Bacteria 2554
261 Ga0496104_0002475 3300048907 Bacteria 15914
262 Ga0496104_0003224 3300048907 Bacteria 14042
263 Ga0496104_0017349 3300048907 Bacteria 6553
264 Ga0496104_0046473 3300048907 Bacteria 4089
265 Ga0496104_0143699 3300048907 Bacteria 2292
266 Ga0496105_0011082 3300048908 Bacteria 7107
267 Ga0496105_0039946 3300048908 Bacteria 3868
268 Ga0496106_0001461 3300048909 Bacteria 17761
269 Ga0496106_0009961 3300048909 Bacteria 7016
270 Ga0496106_0059366 3300048909 Bacteria 2897
271 Ga0496107_0142858 3300048910 Bacteria 1769
272 Ga0496108_0003879 3300048911 Bacteria 12007
273 Ga0496108_0049199 3300048911 Bacteria 3526
274 Ga0496109_0023471 3300048912 Bacteria 5476
275 Ga0496109_0148308 3300048912 Bacteria 2195
276 Ga0496109_0302777 3300048912 Bacteria 1508
277 Ga0496110_0004052 3300048913 Bacteria 11304
278 Ga0496110_0050641 3300048913 Bacteria 3647
279 Ga0496111_0006481 3300048914 Bacteria 7605
280 Ga0496111_0015139 3300048914 Bacteria 5286
281 Ga0496112_0148449 3300048915 Bacteria 2312
282 Ga0496112_0320959 3300048915 Bacteria 1493
283 Ga0496113_0060602 3300048916 Bacteria 2853
284 Ga0496114_0044828 3300048917 Bacteria 3671
285 Ga0496114_0085724 3300048917 Bacteria 2668
286 Ga0496115_0169068 3300048918 Bacteria 1808
287 Ga0496119_0030166 3300048922 Bacteria 3661
288 Ga0496119_0031777 3300048922 Bacteria 3531
289 Ga0496120_0059877 3300048923 Bacteria 2133
290 Ga0496126_0157924 3300048929 Bacteria 1940
291 Ga0501031_0036232 3300049568 Bacteria 3218
292 Ga0501033_0048418 3300049570 Bacteria 3157
293 Ga0501033_0065433 3300049570 Bacteria 2675
294 Ga0501033_0107681 3300049570 Bacteria 2030
295 Ga0501033_0249020 3300049570 Bacteria 1260
296 Ga0501034_0050779 3300049571 Bacteria 4182
297 Ga0501034_0303789 3300049571 Bacteria 1532
298 Ga0501038_0074204 3300049574 Bacteria 2878
299 Ga0501039_0084029 3300049575 Bacteria 2479
300 Ga0501039_0299506 3300049575 Bacteria 1264
301 Ga0501046_0082599 3300049580 Bacteria 2481
302 Ga0501046_0168426 3300049580 Bacteria 1645
303 Ga0501046_0303283 3300049580 Bacteria 1166
304 Ga0501047_0011509 3300049581 Bacteria 8373
305 Ga0501072_0002942 3300049588 Bacteria 12814
306 Ga0501072_0003002 3300049588 Bacteria 12723
307 Ga0501072_0146069 3300049588 Unclassified 1886
308 Ga0501074_0015252 3300049590 Bacteria 5585
309 Ga0501076_0082410 3300049592 Bacteria 2582
310 Ga0501077_0058628 3300049593 Bacteria 2444
311 Ga0501079_0256564 3300049741 Unclassified 1366
312 Ga0501081_0161270 3300049743 Bacteria 1616
313 Ga0501044_0042775 3300049823 Bacteria 4710
314 Ga0501044_0227654 3300049823 Bacteria 1813
315 Ga0501045_0064346 3300049824 Bacteria 2692
316 nmdc:mga03683_65129_c1 3300050489 Bacteria 1548
317 nmdc:mga03683_89243_c1 3300050489 Bacteria 1342
318 nmdc:mga00v17_126358_c1 3300050491 Bacteria 1632
319 nmdc:mga0yw44_220150_c1 3300050492 Bacteria 1258
320 nmdc:mga0yw44_8753_c1 3300050492 Bacteria 5063
321 nmdc:mga0k408_27793_c1 3300050493 Bacteria 3214
322 nmdc:mga05p37_165076_c2 3300050507 Bacteria 2402
323 nmdc:mga05p37_40_c1 3300050507 Bacteria 108168
324 nmdc:mga05p37_9654_c1 3300050507 Bacteria 11434
325 nmdc:mga09592_136375_c1 3300050508 Bacteria 2114
326 nmdc:mga09592_148829_c1 3300050508 Bacteria 2019
327 nmdc:mga0qj67_100286_c1 3300050509 Bacteria 2334
328 nmdc:mga0qj67_167513_c1 3300050509 Bacteria 1784
329 nmdc:mga0qj67_1747_c1 3300050509 Bacteria 15356
330 nmdc:mga0qj67_19995_c1 3300050509 Bacteria 5124
331 nmdc:mga06r32_118221_c1 3300050510 Bacteria 2613
332 nmdc:mga06r32_140_c1 3300050510 Bacteria 53994
333 nmdc:mga06r32_21927_c1 3300050510 Bacteria 5898
334 nmdc:mga06r32_232031_c1 3300050510 Bacteria 1833
335 nmdc:mga06r32_89151_c2 3300050510 Bacteria 2655
336 nmdc:mga08y16_237334_c1 3300050511 Bacteria 1885
337 nmdc:mga08y16_294314_c1 3300050511 Bacteria 1674
338 nmdc:mga08y16_3354_c1 3300050511 Bacteria 16591
339 nmdc:mga08y16_99048_c1 3300050511 Bacteria 3035
340 nmdc:mga0n895_172768_c1 3300050512 Bacteria 2193
341 nmdc:mga0rr50_28592_c1 3300050513 Bacteria 3920
342 nmdc:mga0rr50_93904_c1 3300050513 Bacteria 2341
343 nmdc:mga08x19_22655_c1 3300050514 Bacteria 3890
344 nmdc:mga0a205_201051_c1 3300050515 Bacteria 1883
345 Ga0495601_0000014 3300053077 Bacteria 220318
346 Ga0495601_0050962 3300053077 Bacteria 2612
347 Ga0495612_0000123 3300053078 Bacteria 32874
348 Ga0495595_0000601 3300053084 Bacteria 13704
349 Ga0495619_0000006 3300053085 Bacteria 384835
350 Ga0495619_0204557 3300053085 Bacteria 1367
351 Ga0500616_0030246 3300053153 Bacteria 2975
352 Ga0500616_0048603 3300053153 Bacteria 2248
353 Ga0501084_0010467 3300054114 Bacteria 7665
354 Ga0501082_0003348 3300060353 Bacteria 13998
355 Ga0501082_0079126 3300060353 Bacteria 2836
356 Ga0501082_0116410 3300060353 Bacteria 2315
357 Ga0501082_0156091 3300060353 Bacteria 1983
358 Ga0501082_0188403 3300060353 Bacteria 1795
359 Ga0530510_0042117 3300061734 Bacteria 3298
360 2865001749 2864997549 Bacteria 5139696
361 2889297478 2889295896 Bacteria 4704906
362 2889297483 2889295896 Bacteria 4704906
363 2894772951 2894772417 Bacteria 5305674
364 Ga0157380_10111405
365 JGI24750J21931_1001106
366 JGI24744J21845_10011934
367 JGI25153J46596_10031975
368 JGI25404J52841_10000913
369 JGI25405J52794_10001601
370 Ga0070658_10109749
371 Ga0070676_10134247
372 Ga0070683_100033091
373 Ga0070683_100291652
374 Ga0070670_100093731
375 Ga0070680_100006835
376 Ga0070680_100090650
377 Ga0068868_100005973
378 Ga0070689_100276138
379 Ga0070661_100108715
380 Ga0070692_10124319
381 Ga0070669_100099627
382 Ga0070671_100106347
383 Ga0070674_100003515
384 Ga0070673_100034886
385 Ga0070673_100039540
386 Ga0070688_100018857
387 Ga0070688_100194913
388 Ga0070667_100067133
389 Ga0070703_10001575
390 Ga0070709_10094648
391 Ga0070714_100090388
392 Ga0070705_100000277
393 Ga0070700_100079315
394 Ga0070694_100024161
395 Ga0070708_100001133
396 Ga0070663_100073968
397 Ga0070678_100069567
398 Ga0070662_100025624
399 Ga0070662_100053704
400 Ga0070681_10011683
401 Ga0070681_10218410
402 Ga0068867_100015548
403 Ga0068867_100060267
404 Ga0070685_10038700
405 Ga0070699_100000435
406 Ga0070684_100017443
407 Ga0070697_100011752
408 Ga0068853_100159483
409 Ga0070672_100030934
410 Ga0070696_100000789
411 Ga0070693_100094277
412 Ga0070704_100000598
413 Ga0068855_100109487
414 Ga0070702_100082371
415 Ga0068859_100012527
416 Ga0068864_100169356
417 Ga0068870_10031635
418 Ga0068860_100002995
419 Ga0068862_100000834
420 Ga0081455_10023684
421 Ga0081455_10024718
422 Ga0081538_10011003
423 Ga0081538_10033310
424 Ga0081540_1000183
425 Ga0081540_1008066
426 Ga0081540_1027266
427 Ga0070717_10048242
428 Ga0075365_10013485
429 Ga0075364_10055222
430 Ga0070716_100036221
431 Ga0070712_100132174
432 Ga0075362_10007255
433 Ga0075367_10049494
434 Ga0075366_10056049
435 Ga0097621_100060742
436 Ga0075428_100005749
437 Ga0075428_100064730
438 Ga0075428_100131814
439 Ga0075430_100016861
440 Ga0075430_100054106
441 Ga0075430_100061093
442 Ga0075431_100000004
443 Ga0075431_100002116
444 Ga0075431_100010686
445 Ga0075431_100200753
446 Ga0075431_100296303
447 Ga0075434_100124057
448 Ga0075429_100008566
449 Ga0075436_100017326
450 Ga0097620_100012528
451 Ga0075435_100037094
452 Ga0075435_100116946
453 Ga0111539_10001363
454 Ga0111539_10072555
455 Ga0111539_10150715
456 Ga0111539_10343780
457 Ga0111539_10525323
458 Ga0105245_10153066
459 Ga0114129_10000327
460 Ga0114129_10004711
461 Ga0114129_10352385
462 Ga0105248_10100961
463 Ga0105238_10049356
464 Ga0105238_10372873
465 Ga0105249_10002048
466 Ga0105249_10043653
467 Ga0105246_10065968
468 Ga0157374_10017481
469 Ga0157378_10363360
470 Ga0163163_10013323
471 Ga0163163_10042825
472 Ga0163163_10328937
473 Ga0157377_10043980
474 Ga0157376_10226035
475 Ga0206356_10536564
476 Ga0206350_10651046
477 Ga0213875_10000040
478 Ga0213875_10004663
479 Ga0224712_10065144
480 Ga0209758_1000362
481 Ga0207656_10030823
482 Ga0207653_10003194
483 Ga0207682_10006764
484 Ga0207682_10062057
485 Ga0207642_10115464
486 Ga0207710_10013511
487 Ga0207688_10001315
488 Ga0207688_10093926
489 Ga0207680_10127170
490 Ga0207647_10078224
491 Ga0207645_10046253
492 Ga0207643_10017902
493 Ga0207707_10213390
494 Ga0207693_10037474
495 Ga0207663_10116521
496 Ga0207660_10002338
497 Ga0207662_10004381
498 Ga0207662_10024128
499 Ga0207657_10122402
500 Ga0207646_10169569
501 Ga0207681_10213993
502 Ga0207659_10067109
503 Ga0207659_10096196
504 Ga0207687_10082109
505 Ga0207706_10032819
506 Ga0207706_10053085
507 Ga0207686_10047787
508 Ga0207670_10036272
509 Ga0207669_10049173
510 Ga0207669_10068829
511 Ga0207665_10137788
512 Ga0207691_10016511
513 Ga0207691_10019307
514 Ga0207689_10013733
515 Ga0207679_10158191
516 Ga0207712_10008490
517 Ga0207712_10038173
518 Ga0207639_10116733
519 Ga0207678_10036897
520 Ga0207678_10049770
521 Ga0207641_10260507
522 Ga0207648_10011741
523 Ga0207648_10036903
524 Ga0207676_10062866
525 Ga0207676_10069672
526 Ga0207676_10182146
527 Ga0207674_10000934
528 Ga0207674_10055409
529 Ga0207674_10080008
530 Ga0207675_100052205
531 Ga0207675_100103042
532 Ga0207683_10008611
533 Ga0207683_10021138
534 Ga0209588_1022122
535 Ga0207428_10034064
536 Ga0268265_10198643
537 Ga0268264_10001956
538 Ga0265340_10014951
539 Ga0265340_10027490
540 Ga0265340_10101418
541 Ga0265339_10049455
542 Ga0265316_10075990
543 Ga0373926_0022957
544 Ga0373944_0004843
545 Ga0373944_0022377
546 Ga0373923_0006924
547 Ga0373936_0004483
548 Ga0373953_0012170
549 Ga0373954_0014471
550 Ga0373954_0032343
551 Ga0373956_0031712
552 Ga0373946_0000366
553 Ga0373946_0052945
554 Ga0373955_0026589
555 Ga0373924_0006122
556 Ga0373931_0144596
557 Ga0373935_0109332
558 Ga0373927_0004468
559 Ga0373927_0013928
560 Ga0373927_0062651
561 Ga0373933_0030739
562 Ga0373947_0051576
563 Ga0373937_0000003
564 Ga0373925_0000052
565 Ga0395898_0053912
566 Ga0436364_0411364
567 Ga0436364_0633592
568 Ga0436365_0375308
569 Ga0436365_1131801
570 Ga0436365_1149266
571 Ga0436362_0184614
572 Ga0451853_3566880
573 Ga0439446_0037347
574 Ga0466957_0045506
575 Ga0495592_0000331
576 Ga0495629_0126770
577 Ga0495641_0049048
578 Ga0495651_0000832
579 Ga0495653_0002755
580 Ga0495662_0032626
581 Ga0495662_0035119
582 Ga0495664_0000162
583 Ga0495608_0000239
584 Ga0495608_0202328
585 Ga0495618_0000022
586 Ga0495628_0000011
587 Ga0495630_0001372
588 Ga0495652_0000014
589 Ga0495640_0000008
590 Ga0495587_0000347
591 Ga0495598_0002570
592 Ga0495645_0000007
593 Ga0495645_0163041
594 Ga0495667_0000013
595 Ga0495656_0011146
596 Ga0495634_0001295
597 Ga0495635_0000012
598 Ga0495659_0012900
599 Ga0495657_0035191
600 Ga0495599_0000008
601 Ga0495623_0000500
602 Ga0495646_0000004
603 Ga0495624_0013461
604 Ga0495624_0029118
605 Ga0495670_0009469
606 Ga0495600_0000084
607 Ga0495604_0000001
608 Ga0495674_0000630
609 Ga0495674_0177776
610 Ga0495680_0002587
611 Ga0495680_0054582
612 Ga0495675_0000023
613 Ga0495684_0000007
614 Ga0495686_0064740
615 Ga0495593_0001338
616 Ga0495593_0109790
617 Ga0495602_0000431
618 Ga0496100_0140319
619 Ga0496100_0211438
620 Ga0496101_0052891
621 Ga0496101_0188982
622 Ga0496102_0026659
623 Ga0496102_0111147
624 Ga0496104_0002475
625 Ga0496104_0003224
626 Ga0496104_0017349
627 Ga0496104_0046473
628 Ga0496104_0143699
629 Ga0496105_0011082
630 Ga0496105_0039946
631 Ga0496106_0001461
632 Ga0496106_0009961
633 Ga0496106_0059366
634 Ga0496107_0142858
635 Ga0496108_0003879
636 Ga0496108_0049199
637 Ga0496109_0023471
638 Ga0496109_0148308
639 Ga0496109_0302777
640 Ga0496110_0004052
641 Ga0496110_0050641
642 Ga0496111_0006481
643 Ga0496111_0015139
644 Ga0496112_0148449
645 Ga0496112_0320959
646 Ga0496113_0060602
647 Ga0496114_0044828
648 Ga0496114_0085724
649 Ga0496115_0169068
650 Ga0496119_0030166
651 Ga0496119_0031777
652 Ga0496120_0059877
653 Ga0496126_0157924
654 Ga0501031_0036232
655 Ga0501033_0048418
656 Ga0501033_0065433
657 Ga0501033_0107681
658 Ga0501033_0249020
659 Ga0501034_0050779
660 Ga0501034_0303789
661 Ga0501038_0074204
662 Ga0501039_0084029
663 Ga0501039_0299506
664 Ga0501046_0082599
665 Ga0501046_0168426
666 Ga0501046_0303283
667 Ga0501047_0011509
668 Ga0501072_0002942
669 Ga0501072_0003002
670 Ga0501072_0146069
671 Ga0501074_0015252
672 Ga0501076_0082410
673 Ga0501077_0058628
674 Ga0501079_0256564
675 Ga0501081_0161270
676 Ga0501044_0042775
677 Ga0501044_0227654
678 Ga0501045_0064346
679 nmdc:mga03683_65129_c1
680 nmdc:mga03683_89243_c1
681 nmdc:mga00v17_126358_c1
682 nmdc:mga0yw44_220150_c1
683 nmdc:mga0yw44_8753_c1
684 nmdc:mga0k408_27793_c1
685 nmdc:mga05p37_165076_c2
686 nmdc:mga05p37_40_c1
687 nmdc:mga05p37_9654_c1
688 nmdc:mga09592_136375_c1
689 nmdc:mga09592_148829_c1
690 nmdc:mga0qj67_100286_c1
691 nmdc:mga0qj67_167513_c1
692 nmdc:mga0qj67_1747_c1
693 nmdc:mga0qj67_19995_c1
694 nmdc:mga06r32_118221_c1
695 nmdc:mga06r32_140_c1
696 nmdc:mga06r32_21927_c1
697 nmdc:mga06r32_232031_c1
698 nmdc:mga06r32_89151_c2
699 nmdc:mga08y16_237334_c1
700 nmdc:mga08y16_294314_c1
701 nmdc:mga08y16_3354_c1
702 nmdc:mga08y16_99048_c1
703 nmdc:mga0n895_172768_c1
704 nmdc:mga0rr50_28592_c1
705 nmdc:mga0rr50_93904_c1
706 nmdc:mga08x19_22655_c1
707 nmdc:mga0a205_201051_c1
708 Ga0495601_0000014
709 Ga0495601_0050962
710 Ga0495612_0000123
711 Ga0495595_0000601
712 Ga0495619_0000006
713 Ga0495619_0204557
714 Ga0500616_0030246
715 Ga0500616_0048603
716 Ga0501084_0010467
717 Ga0501082_0003348
718 Ga0501082_0079126
719 Ga0501082_0116410
720 Ga0501082_0156091
721 Ga0501082_0188403
722 Ga0530510_0042117
723 2865001749
724 2889297478
725 2889297483
726 2894772951

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04909

Amidohydro_2

Amidohydrolase

50

396

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6m1w-assembly1.cif.gz_B-2 structure of the 2-aminoisobutyric acid monooxygenase hydroxylase 0.9048 17 366
8fun-assembly1.cif.gz_D enzymatically active, mn/fe metallated form of aibh1h2 0.892 4 366
8fun-assembly1.cif.gz_D enzymatically active, mn/fe metallated form of aibh1h2 0.8826 4 366
6m1w-assembly1.cif.gz_B-2 structure of the 2-aminoisobutyric acid monooxygenase hydroxylase 0.8746 17 366
6m2i-assembly1.cif.gz_B-2 structure of the 2-aminoisobutyric acid monooxygenase hydroxylase 0.8717 5 366
ID Description Score Start End Superfamily
4ofcD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7912 18 366 3.20.20.140
3nurA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7786 82 365 3.20.20.140
3ij6C00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7744 18 363 3.20.20.140
4ofcD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7738 18 366 3.20.20.140
4icmA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7725 17 366 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A7C9VI65-F1-model_v4 Amidohydrolase 0.9681 223 365 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A1Q3YXF2-F1-model_v4 Hydrolase 0.9568 18 365 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A401U1S4-F1-model_v4 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase (EC 4.1.1.45) (Picolinate carboxylase) 0.956 23 201 GO:0001760
GO:0005829
GO:0016787
GO:0019748
GO:1904985
AF-A0A2D6CZR2-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9555 243 366 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A7C9VI65-F1-model_v4 Amidohydrolase 0.955 223 365 GO:0005737
GO:0016787
GO:0016831
GO:0019748

Map