F422971

General Info

Members Datasets Scaffolds Average Seq Length
363 232 726 244

Family's Representative Sequence

Representative Sequence 3300014969|Ga0157376_10347010|Ga0157376_103470102
Length 276
Sequence LKFQGFPLGPKLAALDSESVASRQGLKKNQMDNTLYVGLSRQIVLKREMDIVANNIANADTTGFKFESLMTKVAPSPPAFTAGGPKPVKFVAADGVARNFSQGGLRRTDAKFDLAIEGQGFFKVNTKAGERYTRDGHFRTDDTGRVTTQSGAVLADEGGGEITVDVQKPGEISVSEDGVVSQGEERIGKVGVFKFDSLSALEKTGDNLYQNASNQQPTAAADAKVRQGMLENSNVNPIVQITRMIEVNRAYEQVSQMISAESDLSRNSVARLGRLQ

Samples

Sample ID Description Type Environment
1 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
4 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
5 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
63 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
69 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
104 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
105 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
106 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
107 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
110 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
111 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
112 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
113 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
114 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
115 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
116 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
117 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
124 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
125 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
126 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
127 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
128 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
129 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
130 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
131 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
132 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
133 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
134 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
135 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
136 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
137 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
138 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
139 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
140 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
141 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
142 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
143 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
144 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
145 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
146 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
147 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
148 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
149 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
150 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
151 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
152 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
153 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
154 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
155 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
156 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
157 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
158 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
159 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
160 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
161 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
171 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
172 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
173 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
174 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
175 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
176 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
177 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
178 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
182 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
184 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
185 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
186 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
187 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
188 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
189 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
190 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
191 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
192 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
193 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
194 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
195 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
196 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
197 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
198 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
199 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
200 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
201 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
202 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
203 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
204 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
205 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
206 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
207 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
208 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
209 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
210 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
211 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
212 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
213 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
214 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
215 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
216 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
217 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
218 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
219 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
220 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
221 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
222 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
223 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
224 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
225 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
226 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
227 2643221583 Caulobacter sp. Root655 Isolate Unclassified
228 2643221584 Caulobacter sp. Root656 Isolate Unclassified
229 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
230 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
231 2818991435 Caulobacter henricii 536 Isolate Unclassified
232 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.97
Metatranscriptomes 0
Isolates 3.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.49
Nodule 0
Rhizoplane 2.2
Rhizosphere 68.04
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157376_10347010 3300014969 Bacteria 1419
2 rootH1_10084964 3300003316 Bacteria 2101
3 Ga0055537_1001254 3300003773 Bacteria 10591
4 Ga0055524_1019520 3300003775 Bacteria 2314
5 Ga0055524_1019696 3300003775 Bacteria 2297
6 Ga0055528_1008387 3300003790 Bacteria 4436
7 Ga0055530_10007468 3300003791 Bacteria 4590
8 Ga0055531_10000761 3300003794 Bacteria 27006
9 Ga0055531_10002133 3300003794 Bacteria 13543
10 Ga0065165_1000041 3300005262 Bacteria 203876
11 Ga0065165_1000624 3300005262 Bacteria 51434
12 Ga0070658_10036705 3300005327 Bacteria 3950
13 Ga0070658_10045901 3300005327 Bacteria 3534
14 Ga0070658_10221577 3300005327 Bacteria 1600
15 Ga0070658_10267313 3300005327 Bacteria 1453
16 Ga0070670_100010197 3300005331 Bacteria 8019
17 Ga0070670_100139534 3300005331 Bacteria 2096
18 Ga0070666_10099614 3300005335 Bacteria 2002
19 Ga0070666_10175615 3300005335 Bacteria 1502
20 Ga0070680_100004477 3300005336 Bacteria 10526
21 Ga0070660_100073331 3300005339 Bacteria 2676
22 Ga0070660_100112999 3300005339 Bacteria 2162
23 Ga0070691_10004455 3300005341 Bacteria 6363
24 Ga0070661_100184277 3300005344 Bacteria 1590
25 Ga0070668_100000354 3300005347 Bacteria 30316
26 Ga0070668_100002972 3300005347 Bacteria 12533
27 Ga0070668_100010666 3300005347 Bacteria 6831
28 Ga0070668_100030889 3300005347 Bacteria 4076
29 Ga0070669_100013735 3300005353 Bacteria 5756
30 Ga0070669_100034797 3300005353 Bacteria 3647
31 Ga0070671_100006435 3300005355 Bacteria 9385
32 Ga0070671_100295548 3300005355 Bacteria 1379
33 Ga0070659_100000056 3300005366 Bacteria 88478
34 Ga0070667_100013949 3300005367 Bacteria 6642
35 Ga0070663_100250009 3300005455 Bacteria 1403
36 Ga0070681_10002800 3300005458 Bacteria 16108
37 Ga0070681_10042677 3300005458 Bacteria 4544
38 Ga0070679_100027489 3300005530 Bacteria 5600
39 Ga0070679_100127610 3300005530 Bacteria 2525
40 Ga0070684_100382903 3300005535 Bacteria 1296
41 Ga0068853_100187161 3300005539 Bacteria 1880
42 Ga0068853_100463504 3300005539 Bacteria 1193
43 Ga0068853_100548954 3300005539 Bacteria 1094
44 Ga0070665_100000015 3300005548 Bacteria 462744
45 Ga0070665_100095623 3300005548 Bacteria 2976
46 Ga0070665_100100744 3300005548 Bacteria 2893
47 Ga0070665_100128582 3300005548 Bacteria 2536
48 Ga0068855_100009540 3300005563 Bacteria 11722
49 Ga0068855_100069735 3300005563 Bacteria 4091
50 Ga0068855_100233827 3300005563 Bacteria 2056
51 Ga0068855_100460990 3300005563 Bacteria 1386
52 Ga0070664_100410712 3300005564 Bacteria 1239
53 Ga0068857_100055964 3300005577 Bacteria 3500
54 Ga0068854_100168332 3300005578 Bacteria 1703
55 Ga0068856_100241715 3300005614 Bacteria 1821
56 Ga0068859_100000231 3300005617 Bacteria 55036
57 Ga0068859_100005468 3300005617 Bacteria 12925
58 Ga0068864_100001808 3300005618 Bacteria 17540
59 Ga0068864_100121896 3300005618 Bacteria 2332
60 Ga0068864_100217435 3300005618 Bacteria 1762
61 Ga0068863_100008609 3300005841 Bacteria 9972
62 Ga0068863_100047779 3300005841 Bacteria 4059
63 Ga0068858_100000040 3300005842 Bacteria 135911
64 Ga0068858_100009864 3300005842 Bacteria 9074
65 Ga0068858_100356356 3300005842 Bacteria 1402
66 Ga0068860_100000158 3300005843 Bacteria 110478
67 Ga0068860_100004249 3300005843 Bacteria 14669
68 Ga0068862_100011657 3300005844 Bacteria 7253
69 Ga0068862_100029794 3300005844 Bacteria 4599
70 Ga0068862_100124611 3300005844 Bacteria 2274
71 Ga0070717_10083472 3300006028 Bacteria 2687
72 Ga0075365_10224297 3300006038 Bacteria 1319
73 Ga0075368_10000491 3300006042 Bacteria 11705
74 Ga0075363_100140727 3300006048 Bacteria 1358
75 Ga0075364_10000426 3300006051 Bacteria 21063
76 Ga0075362_10005305 3300006177 Bacteria 4707
77 Ga0075367_10001318 3300006178 Bacteria 10522
78 Ga0075366_10009287 3300006195 Bacteria 5492
79 Ga0068871_100504519 3300006358 Bacteria 1091
80 Ga0068865_100009867 3300006881 Bacteria 5931
81 Ga0097620_100000231 3300006931 Bacteria 55036
82 Ga0097620_100005468 3300006931 Bacteria 12925
83 Ga0105240_10019715 3300009093 Bacteria 9007
84 Ga0105240_10041543 3300009093 Bacteria 5869
85 Ga0105240_10046025 3300009093 Bacteria 5531
86 Ga0105240_10057509 3300009093 Bacteria 4858
87 Ga0105240_10159347 3300009093 Bacteria 2682
88 Ga0105241_10088039 3300009174 Bacteria 2445
89 Ga0105242_10340040 3300009176 Bacteria 1383
90 Ga0105248_10000712 3300009177 Bacteria 37675
91 Ga0105248_10005819 3300009177 Bacteria 13549
92 Ga0105248_10094591 3300009177 Bacteria 3364
93 Ga0105248_10421194 3300009177 Bacteria 1504
94 Ga0105248_10512914 3300009177 Bacteria 1352
95 Ga0105237_10179447 3300009545 Bacteria 2118
96 Ga0105237_10222907 3300009545 Bacteria 1886
97 Ga0105237_10375527 3300009545 Bacteria 1426
98 Ga0105238_10021679 3300009551 Bacteria 6545
99 Ga0105238_10138424 3300009551 Bacteria 2412
100 Ga0105238_10177085 3300009551 Bacteria 2109
101 Ga0105238_10184173 3300009551 Bacteria 2065
102 Ga0105238_10528779 3300009551 Bacteria 1182
103 Ga0105238_10546881 3300009551 Bacteria 1162
104 Ga0105239_10048145 3300010375 Bacteria 4674
105 Ga0105239_10310094 3300010375 Bacteria 1778
106 Ga0105239_10550057 3300010375 Bacteria 1314
107 Ga0157370_10151155 3300013104 Bacteria 2160
108 Ga0163162_10061065 3300013306 Bacteria 3807
109 Ga0157372_10572558 3300013307 Bacteria 1316
110 Ga0157375_10588740 3300013308 Bacteria 1272
111 Ga0157375_10661117 3300013308 Bacteria 1201
112 Ga0163163_10002659 3300014325 Bacteria 15121
113 Ga0163163_10026223 3300014325 Bacteria 5568
114 Ga0163163_10305798 3300014325 Bacteria 1642
115 Ga0157379_10001045 3300014968 Bacteria 22478
116 Ga0157379_10036416 3300014968 Bacteria 4388
117 Ga0213876_10000232 3300021384 Bacteria 54674
118 Ga0209148_1011225 3300025254 Bacteria 1670
119 Ga0209148_1012073 3300025254 Bacteria 1588
120 Ga0209565_1000652 3300025263 Bacteria 22290
121 Ga0209673_1000712 3300025273 Bacteria 46760
122 Ga0209675_1008279 3300025291 Bacteria 3846
123 Ga0209564_1028229 3300025295 Bacteria 1800
124 Ga0209758_1001434 3300025297 Bacteria 28162
125 Ga0209758_1001844 3300025297 Bacteria 23263
126 Ga0209758_1002481 3300025297 Bacteria 18757
127 Ga0209050_1000034 3300025298 Bacteria 433906
128 Ga0209050_1021575 3300025298 Bacteria 2342
129 Ga0209256_1009800 3300025299 Bacteria 4127
130 Ga0209257_1000052 3300025304 Bacteria 430947
131 Ga0209257_1000187 3300025304 Bacteria 154077
132 Ga0209257_1001208 3300025304 Bacteria 32440
133 Ga0207680_10095966 3300025903 Bacteria 1896
134 Ga0207705_10000362 3300025909 Bacteria 41196
135 Ga0207705_10166296 3300025909 Bacteria 1659
136 Ga0207654_10348110 3300025911 Bacteria 1020
137 Ga0207707_10027805 3300025912 Bacteria 4944
138 Ga0207707_10047699 3300025912 Bacteria 3730
139 Ga0207695_10000695 3300025913 Bacteria 65865
140 Ga0207695_10012458 3300025913 Bacteria 10210
141 Ga0207695_10074380 3300025913 Bacteria 3459
142 Ga0207695_10178614 3300025913 Bacteria 2044
143 Ga0207695_10269962 3300025913 Bacteria 1597
144 Ga0207660_10012096 3300025917 Bacteria 5641
145 Ga0207657_10000944 3300025919 Bacteria 30787
146 Ga0207657_10063656 3300025919 Bacteria 3152
147 Ga0207649_10127045 3300025920 Bacteria 1727
148 Ga0207652_10007594 3300025921 Bacteria 8731
149 Ga0207681_10118805 3300025923 Bacteria 1935
150 Ga0207694_10084403 3300025924 Bacteria 2498
151 Ga0207694_10086959 3300025924 Bacteria 2461
152 Ga0207694_10318795 3300025924 Bacteria 1282
153 Ga0207650_10014777 3300025925 Bacteria 5429
154 Ga0207650_10073159 3300025925 Bacteria 2581
155 Ga0207650_10098662 3300025925 Bacteria 2245
156 Ga0207687_10135881 3300025927 Bacteria 1859
157 Ga0207644_10001954 3300025931 Bacteria 13356
158 Ga0207644_10047993 3300025931 Bacteria 3050
159 Ga0207644_10269668 3300025931 Bacteria 1363
160 Ga0207644_10350612 3300025931 Bacteria 1198
161 Ga0207690_10003188 3300025932 Bacteria 9842
162 Ga0207690_10087495 3300025932 Bacteria 2192
163 Ga0207706_10097242 3300025933 Bacteria 2589
164 Ga0207704_10001569 3300025938 Bacteria 10248
165 Ga0207711_10003534 3300025941 Bacteria 13532
166 Ga0207711_10005676 3300025941 Bacteria 10542
167 Ga0207711_10085827 3300025941 Bacteria 2759
168 Ga0207711_10250286 3300025941 Bacteria 1627
169 Ga0207667_10045864 3300025949 Bacteria 4628
170 Ga0207667_10047562 3300025949 Bacteria 4540
171 Ga0207667_10117473 3300025949 Bacteria 2741
172 Ga0207668_10006788 3300025972 Bacteria 6778
173 Ga0207668_10007383 3300025972 Bacteria 6534
174 Ga0207668_10074249 3300025972 Bacteria 2440
175 Ga0207658_10386693 3300025986 Bacteria 1227
176 Ga0207703_10000279 3300026035 Bacteria 56629
177 Ga0207703_10001898 3300026035 Bacteria 18517
178 Ga0207639_10124619 3300026041 Bacteria 2122
179 Ga0207639_10168637 3300026041 Bacteria 1852
180 Ga0207639_10266331 3300026041 Bacteria 1501
181 Ga0207639_10450235 3300026041 Bacteria 1169
182 Ga0207702_10497116 3300026078 Bacteria 1188
183 Ga0207641_10017738 3300026088 Bacteria 5831
184 Ga0207641_10041907 3300026088 Bacteria 3839
185 Ga0207641_10174187 3300026088 Bacteria 1966
186 Ga0207676_10216307 3300026095 Bacteria 1703
187 Ga0207674_10139767 3300026116 Bacteria 2382
188 Ga0207675_100010978 3300026118 Bacteria 8486
189 Ga0268266_10000005 3300028379 Bacteria 1448194
190 Ga0268266_10070149 3300028379 Bacteria 3037
191 Ga0268266_10125670 3300028379 Bacteria 2288
192 Ga0268265_10004739 3300028380 Bacteria 9381
193 Ga0268264_10000029 3300028381 Bacteria 419246
194 Ga0268264_10031796 3300028381 Bacteria 4328
195 Ga0268264_10034874 3300028381 Bacteria 4141
196 Ga0307517_10062694 3300028786 Bacteria 3491
197 Ga0307517_10070347 3300028786 Bacteria 3154
198 Ga0307515_10028870 3300028794 Bacteria 9407
199 Ga0307511_10027432 3300030521 Bacteria 5203
200 Ga0265327_10005776 3300031251 Bacteria 10186
201 Ga0307513_10004531 3300031456 Bacteria 18528
202 Ga0307513_10024412 3300031456 Bacteria 7033
203 Ga0307408_100143159 3300031548 Bacteria 1879
204 Ga0265342_10156530 3300031712 Bacteria 1262
205 Ga0307413_10194016 3300031824 Bacteria 1460
206 Ga0307414_10248686 3300032004 Bacteria 1476
207 Ga0307411_10592111 3300032005 Bacteria 952
208 Ga0307510_10025367 3300033180 Bacteria 6836
209 Ga0373940_0026687 3300035088 Bacteria 1513
210 Ga0373944_0025752 3300035089 Bacteria 1734
211 Ga0373927_0000767 3300035695 Bacteria 24571
212 Ga0373925_0000222 3300037068 Bacteria 60920
213 Ga0373925_0073838 3300037068 Bacteria 2582
214 Ga0373925_0181159 3300037068 Bacteria 1668
215 Ga0395899_0000197 3300037312 Bacteria 88596
216 Ga0395900_0000006 3300037418 Bacteria 495364
217 Ga0395898_0060850 3300037466 Bacteria 3668
218 Ga0395898_0099993 3300037466 Bacteria 2785
219 Ga0395905_0018884 3300037471 Bacteria 6538
220 Ga0395905_0334036 3300037471 Bacteria 1406
221 Ga0395905_0805947 3300037471 Bacteria 842
222 Ga0395905_0847079 3300037471 Bacteria 817
223 Ga0395901_0000001 3300038443 Bacteria 800383
224 Ga0436365_0577642 3300039437 Bacteria 77516
225 Ga0436365_0654970 3300039437 Bacteria 1688
226 Ga0436363_0115372 3300039450 Bacteria 2980
227 Ga0451847_0980637 3300041503 Bacteria 891
228 Ga0439431_0054658 3300041997 Bacteria 1042
229 Ga0450916_012500 3300042530 Bacteria 1084
230 Ga0466957_0153759 3300044842 Bacteria 1490
231 Ga0495617_040443 3300046452 Bacteria 1559
232 Ga0495627_000187 3300046453 Bacteria 69012
233 Ga0495629_0023611 3300046459 Bacteria 4381
234 Ga0495638_0001443 3300046460 Bacteria 21511
235 Ga0495638_0001602 3300046460 Bacteria 20202
236 Ga0495638_0033834 3300046460 Bacteria 3265
237 Ga0495638_0146157 3300046460 Bacteria 1375
238 Ga0495650_0000030 3300046471 Bacteria 436318
239 Ga0495596_0123437 3300046500 Bacteria 1005
240 Ga0495607_0086694 3300046501 Bacteria 1706
241 Ga0495583_0000002 3300046506 Bacteria 782521
242 Ga0495583_0037107 3300046506 Bacteria 2313
243 Ga0495606_0015238 3300046507 Bacteria 5935
244 Ga0495610_0002162 3300046512 Bacteria 16715
245 Ga0495616_0000366 3300046513 Bacteria 35310
246 Ga0495616_0056415 3300046513 Bacteria 1940
247 Ga0495620_0028824 3300046515 Bacteria 2577
248 Ga0495620_0063533 3300046515 Bacteria 1530
249 Ga0495631_0080346 3300046518 Bacteria 1407
250 Ga0495632_0145043 3300046519 Bacteria 1099
251 Ga0495637_0006645 3300046520 Bacteria 5789
252 Ga0495643_0011937 3300046522 Bacteria 5261
253 Ga0495643_0193627 3300046522 Bacteria 980
254 Ga0495648_0112533 3300046524 Bacteria 1478
255 Ga0495663_0007562 3300046525 Bacteria 3007
256 Ga0495654_0000048 3300046530 Bacteria 147348
257 Ga0495654_0015841 3300046530 Bacteria 3997
258 Ga0495597_0044991 3300046542 Bacteria 1961
259 Ga0495622_0003047 3300046557 Bacteria 7953
260 Ga0495668_0007252 3300046616 Bacteria 7114
261 Ga0495668_0077649 3300046616 Bacteria 1823
262 Ga0495668_0104257 3300046616 Bacteria 1551
263 Ga0495625_0000058 3300046660 Bacteria 180863
264 Ga0495625_0000505 3300046660 Bacteria 57930
265 Ga0495625_0100463 3300046660 Bacteria 1988
266 Ga0495625_0164542 3300046660 Bacteria 1484
267 Ga0495625_0269386 3300046660 Bacteria 1099
268 Ga0495625_0334773 3300046660 Bacteria 960
269 Ga0495669_0116470 3300046684 Bacteria 1250
270 Ga0495669_0236555 3300046684 Bacteria 876
271 Ga0495670_0172357 3300046691 Bacteria 1140
272 Ga0495589_0004949 3300046794 Bacteria 7058
273 Ga0495660_0053994 3300046810 Bacteria 2178
274 Ga0495672_0001285 3300047320 Bacteria 25031
275 Ga0495672_0019756 3300047320 Bacteria 4437
276 Ga0495679_007975 3300047446 Bacteria 4354
277 Ga0495673_0000163 3300047469 Bacteria 114230
278 Ga0495673_0002555 3300047469 Bacteria 12662
279 Ga0495681_0053861 3300047470 Bacteria 1882
280 Ga0495593_0010488 3300047673 Bacteria 5349
281 Ga0495602_0128157 3300048088 Bacteria 2029
282 Ga0496101_0086080 3300048904 Bacteria 2330
283 Ga0496102_0246006 3300048905 Bacteria 1686
284 Ga0496106_0033121 3300048909 Bacteria 3854
285 Ga0496107_0000137 3300048910 Bacteria 36013
286 Ga0496108_0385533 3300048911 Bacteria 1224
287 Ga0496109_0275653 3300048912 Bacteria 1585
288 Ga0496110_0349546 3300048913 Bacteria 1347
289 Ga0496114_0094011 3300048917 Bacteria 2550
290 Ga0496116_0148083 3300048919 Bacteria 1309
291 Ga0496117_0019610 3300048920 Bacteria 5546
292 Ga0496118_0017717 3300048921 Bacteria 6466
293 Ga0496119_0125177 3300048922 Bacteria 1407
294 Ga0496121_0000130 3300048924 Bacteria 168094
295 Ga0496121_0094222 3300048924 Bacteria 2330
296 Ga0496124_0074953 3300048927 Bacteria 2796
297 Ga0496125_0046054 3300048928 Bacteria 3664
298 Ga0496125_0152144 3300048928 Bacteria 1587
299 Ga0496126_0023914 3300048929 Bacteria 5908
300 Ga0501031_0364638 3300049568 Bacteria 935
301 Ga0501032_0105724 3300049569 Bacteria 1864
302 Ga0501043_0481486 3300049579 Bacteria 929
303 Ga0501238_003053 3300049671 Bacteria 2044
304 Ga0501035_0152724 3300049822 Bacteria 2003
305 Ga0501044_0001036 3300049823 Bacteria 33479
306 nmdc:mga03n38_204850_c1 3300050490 Bacteria 1023
307 nmdc:mga00v17_5454_c1 3300050491 Bacteria 6698
308 nmdc:mga0yw44_155120_c1 3300050492 Bacteria 1496
309 nmdc:mga0k408_226216_c1 3300050493 Bacteria 1117
310 nmdc:mga0k408_32680_c1 3300050493 Bacteria 2004
311 nmdc:mga06z11_6179_c1 3300050494 Bacteria 4854
312 nmdc:mga04h51_30952_c1 3300050495 Bacteria 1688
313 Ga0500635_0000120 3300053080 Bacteria 46183
314 Ga0500651_0014360 3300053093 Bacteria 4845
315 Ga0500566_0035052 3300053094 Bacteria 2917
316 Ga0500641_0026119 3300053096 Bacteria 2265
317 Ga0500650_0037858 3300053098 Bacteria 2218
318 Ga0500554_024925 3300053102 Bacteria 1700
319 Ga0500555_004101 3300053103 Bacteria 4143
320 Ga0500556_0004663 3300053104 Bacteria 3891
321 Ga0500556_0008685 3300053104 Bacteria 2936
322 Ga0500556_0082462 3300053104 Bacteria 1217
323 Ga0500562_000718 3300053108 Bacteria 8030
324 Ga0500569_015904 3300053109 Bacteria 1894
325 Ga0500572_002922 3300053111 Bacteria 4004
326 Ga0500595_003139 3300053119 Bacteria 7834
327 Ga0500595_053103 3300053119 Bacteria 1249
328 Ga0500607_101039 3300053121 Bacteria 1432
329 Ga0500608_037762 3300053122 Bacteria 2308
330 Ga0500614_008279 3300053123 Bacteria 2204
331 Ga0500618_000473 3300053125 Bacteria 26049
332 Ga0500642_0020504 3300053130 Bacteria 2600
333 Ga0500658_0003711 3300053134 Bacteria 5752
334 Ga0500658_0079929 3300053134 Bacteria 1396
335 Ga0500559_0000003 3300053136 Bacteria 252693
336 Ga0500559_0004254 3300053136 Bacteria 6846
337 Ga0500564_083423 3300053138 Bacteria 1430
338 Ga0500577_0000783 3300053142 Bacteria 8190
339 Ga0500590_007627 3300053148 Bacteria 5361
340 Ga0500590_084502 3300053148 Bacteria 1553
341 Ga0500616_0018310 3300053153 Bacteria 3962
342 Ga0500622_0017552 3300053156 Bacteria 3809
343 Ga0500634_0107503 3300053161 Bacteria 1384
344 Ga0500638_072118 3300053162 Bacteria 1650
345 Ga0500637_0071316 3300053178 Bacteria 1998
346 Ga0500637_0093289 3300053178 Bacteria 1744
347 Ga0500611_009887 3300053727 Bacteria 1527
348 Ga0500645_001471 3300053730 Bacteria 11841
349 Ga0500645_006700 3300053730 Bacteria 4085
350 Ga0500656_007443 3300053732 Bacteria 1139
351 Ga0500596_001418 3300053735 Bacteria 4840
352 Ga0500601_002442 3300053737 Bacteria 1995
353 2511120529 2510917020 Bacteria 5657507
354 2585151348 2582581280 Bacteria 5994497
355 2585196061 2582581293 Bacteria 5907401
356 2643749585 2643221545 Bacteria 5083237
357 2643782632 2643221552 Bacteria 5708754
358 2643925880 2643221583 Bacteria 5218014
359 2643928843 2643221584 Bacteria 5511711
360 2643999848 2643221598 Bacteria 4578346
361 2644508542 2643221691 Bacteria 5093099
362 2819537066 2818991435 Bacteria 5433759
363 2819645478 2818991454 Bacteria 5563326
364 Ga0157376_10347010
365 rootH1_10084964
366 Ga0055537_1001254
367 Ga0055524_1019520
368 Ga0055524_1019696
369 Ga0055528_1008387
370 Ga0055530_10007468
371 Ga0055531_10000761
372 Ga0055531_10002133
373 Ga0065165_1000041
374 Ga0065165_1000624
375 Ga0070658_10036705
376 Ga0070658_10045901
377 Ga0070658_10221577
378 Ga0070658_10267313
379 Ga0070670_100010197
380 Ga0070670_100139534
381 Ga0070666_10099614
382 Ga0070666_10175615
383 Ga0070680_100004477
384 Ga0070660_100073331
385 Ga0070660_100112999
386 Ga0070691_10004455
387 Ga0070661_100184277
388 Ga0070668_100000354
389 Ga0070668_100002972
390 Ga0070668_100010666
391 Ga0070668_100030889
392 Ga0070669_100013735
393 Ga0070669_100034797
394 Ga0070671_100006435
395 Ga0070671_100295548
396 Ga0070659_100000056
397 Ga0070667_100013949
398 Ga0070663_100250009
399 Ga0070681_10002800
400 Ga0070681_10042677
401 Ga0070679_100027489
402 Ga0070679_100127610
403 Ga0070684_100382903
404 Ga0068853_100187161
405 Ga0068853_100463504
406 Ga0068853_100548954
407 Ga0070665_100000015
408 Ga0070665_100095623
409 Ga0070665_100100744
410 Ga0070665_100128582
411 Ga0068855_100009540
412 Ga0068855_100069735
413 Ga0068855_100233827
414 Ga0068855_100460990
415 Ga0070664_100410712
416 Ga0068857_100055964
417 Ga0068854_100168332
418 Ga0068856_100241715
419 Ga0068859_100000231
420 Ga0068859_100005468
421 Ga0068864_100001808
422 Ga0068864_100121896
423 Ga0068864_100217435
424 Ga0068863_100008609
425 Ga0068863_100047779
426 Ga0068858_100000040
427 Ga0068858_100009864
428 Ga0068858_100356356
429 Ga0068860_100000158
430 Ga0068860_100004249
431 Ga0068862_100011657
432 Ga0068862_100029794
433 Ga0068862_100124611
434 Ga0070717_10083472
435 Ga0075365_10224297
436 Ga0075368_10000491
437 Ga0075363_100140727
438 Ga0075364_10000426
439 Ga0075362_10005305
440 Ga0075367_10001318
441 Ga0075366_10009287
442 Ga0068871_100504519
443 Ga0068865_100009867
444 Ga0097620_100000231
445 Ga0097620_100005468
446 Ga0105240_10019715
447 Ga0105240_10041543
448 Ga0105240_10046025
449 Ga0105240_10057509
450 Ga0105240_10159347
451 Ga0105241_10088039
452 Ga0105242_10340040
453 Ga0105248_10000712
454 Ga0105248_10005819
455 Ga0105248_10094591
456 Ga0105248_10421194
457 Ga0105248_10512914
458 Ga0105237_10179447
459 Ga0105237_10222907
460 Ga0105237_10375527
461 Ga0105238_10021679
462 Ga0105238_10138424
463 Ga0105238_10177085
464 Ga0105238_10184173
465 Ga0105238_10528779
466 Ga0105238_10546881
467 Ga0105239_10048145
468 Ga0105239_10310094
469 Ga0105239_10550057
470 Ga0157370_10151155
471 Ga0163162_10061065
472 Ga0157372_10572558
473 Ga0157375_10588740
474 Ga0157375_10661117
475 Ga0163163_10002659
476 Ga0163163_10026223
477 Ga0163163_10305798
478 Ga0157379_10001045
479 Ga0157379_10036416
480 Ga0213876_10000232
481 Ga0209148_1011225
482 Ga0209148_1012073
483 Ga0209565_1000652
484 Ga0209673_1000712
485 Ga0209675_1008279
486 Ga0209564_1028229
487 Ga0209758_1001434
488 Ga0209758_1001844
489 Ga0209758_1002481
490 Ga0209050_1000034
491 Ga0209050_1021575
492 Ga0209256_1009800
493 Ga0209257_1000052
494 Ga0209257_1000187
495 Ga0209257_1001208
496 Ga0207680_10095966
497 Ga0207705_10000362
498 Ga0207705_10166296
499 Ga0207654_10348110
500 Ga0207707_10027805
501 Ga0207707_10047699
502 Ga0207695_10000695
503 Ga0207695_10012458
504 Ga0207695_10074380
505 Ga0207695_10178614
506 Ga0207695_10269962
507 Ga0207660_10012096
508 Ga0207657_10000944
509 Ga0207657_10063656
510 Ga0207649_10127045
511 Ga0207652_10007594
512 Ga0207681_10118805
513 Ga0207694_10084403
514 Ga0207694_10086959
515 Ga0207694_10318795
516 Ga0207650_10014777
517 Ga0207650_10073159
518 Ga0207650_10098662
519 Ga0207687_10135881
520 Ga0207644_10001954
521 Ga0207644_10047993
522 Ga0207644_10269668
523 Ga0207644_10350612
524 Ga0207690_10003188
525 Ga0207690_10087495
526 Ga0207706_10097242
527 Ga0207704_10001569
528 Ga0207711_10003534
529 Ga0207711_10005676
530 Ga0207711_10085827
531 Ga0207711_10250286
532 Ga0207667_10045864
533 Ga0207667_10047562
534 Ga0207667_10117473
535 Ga0207668_10006788
536 Ga0207668_10007383
537 Ga0207668_10074249
538 Ga0207658_10386693
539 Ga0207703_10000279
540 Ga0207703_10001898
541 Ga0207639_10124619
542 Ga0207639_10168637
543 Ga0207639_10266331
544 Ga0207639_10450235
545 Ga0207702_10497116
546 Ga0207641_10017738
547 Ga0207641_10041907
548 Ga0207641_10174187
549 Ga0207676_10216307
550 Ga0207674_10139767
551 Ga0207675_100010978
552 Ga0268266_10000005
553 Ga0268266_10070149
554 Ga0268266_10125670
555 Ga0268265_10004739
556 Ga0268264_10000029
557 Ga0268264_10031796
558 Ga0268264_10034874
559 Ga0307517_10062694
560 Ga0307517_10070347
561 Ga0307515_10028870
562 Ga0307511_10027432
563 Ga0265327_10005776
564 Ga0307513_10004531
565 Ga0307513_10024412
566 Ga0307408_100143159
567 Ga0265342_10156530
568 Ga0307413_10194016
569 Ga0307414_10248686
570 Ga0307411_10592111
571 Ga0307510_10025367
572 Ga0373940_0026687
573 Ga0373944_0025752
574 Ga0373927_0000767
575 Ga0373925_0000222
576 Ga0373925_0073838
577 Ga0373925_0181159
578 Ga0395899_0000197
579 Ga0395900_0000006
580 Ga0395898_0060850
581 Ga0395898_0099993
582 Ga0395905_0018884
583 Ga0395905_0334036
584 Ga0395905_0805947
585 Ga0395905_0847079
586 Ga0395901_0000001
587 Ga0436365_0577642
588 Ga0436365_0654970
589 Ga0436363_0115372
590 Ga0451847_0980637
591 Ga0439431_0054658
592 Ga0450916_012500
593 Ga0466957_0153759
594 Ga0495617_040443
595 Ga0495627_000187
596 Ga0495629_0023611
597 Ga0495638_0001443
598 Ga0495638_0001602
599 Ga0495638_0033834
600 Ga0495638_0146157
601 Ga0495650_0000030
602 Ga0495596_0123437
603 Ga0495607_0086694
604 Ga0495583_0000002
605 Ga0495583_0037107
606 Ga0495606_0015238
607 Ga0495610_0002162
608 Ga0495616_0000366
609 Ga0495616_0056415
610 Ga0495620_0028824
611 Ga0495620_0063533
612 Ga0495631_0080346
613 Ga0495632_0145043
614 Ga0495637_0006645
615 Ga0495643_0011937
616 Ga0495643_0193627
617 Ga0495648_0112533
618 Ga0495663_0007562
619 Ga0495654_0000048
620 Ga0495654_0015841
621 Ga0495597_0044991
622 Ga0495622_0003047
623 Ga0495668_0007252
624 Ga0495668_0077649
625 Ga0495668_0104257
626 Ga0495625_0000058
627 Ga0495625_0000505
628 Ga0495625_0100463
629 Ga0495625_0164542
630 Ga0495625_0269386
631 Ga0495625_0334773
632 Ga0495669_0116470
633 Ga0495669_0236555
634 Ga0495670_0172357
635 Ga0495589_0004949
636 Ga0495660_0053994
637 Ga0495672_0001285
638 Ga0495672_0019756
639 Ga0495679_007975
640 Ga0495673_0000163
641 Ga0495673_0002555
642 Ga0495681_0053861
643 Ga0495593_0010488
644 Ga0495602_0128157
645 Ga0496101_0086080
646 Ga0496102_0246006
647 Ga0496106_0033121
648 Ga0496107_0000137
649 Ga0496108_0385533
650 Ga0496109_0275653
651 Ga0496110_0349546
652 Ga0496114_0094011
653 Ga0496116_0148083
654 Ga0496117_0019610
655 Ga0496118_0017717
656 Ga0496119_0125177
657 Ga0496121_0000130
658 Ga0496121_0094222
659 Ga0496124_0074953
660 Ga0496125_0046054
661 Ga0496125_0152144
662 Ga0496126_0023914
663 Ga0501031_0364638
664 Ga0501032_0105724
665 Ga0501043_0481486
666 Ga0501238_003053
667 Ga0501035_0152724
668 Ga0501044_0001036
669 nmdc:mga03n38_204850_c1
670 nmdc:mga00v17_5454_c1
671 nmdc:mga0yw44_155120_c1
672 nmdc:mga0k408_226216_c1
673 nmdc:mga0k408_32680_c1
674 nmdc:mga06z11_6179_c1
675 nmdc:mga04h51_30952_c1
676 Ga0500635_0000120
677 Ga0500651_0014360
678 Ga0500566_0035052
679 Ga0500641_0026119
680 Ga0500650_0037858
681 Ga0500554_024925
682 Ga0500555_004101
683 Ga0500556_0004663
684 Ga0500556_0008685
685 Ga0500556_0082462
686 Ga0500562_000718
687 Ga0500569_015904
688 Ga0500572_002922
689 Ga0500595_003139
690 Ga0500595_053103
691 Ga0500607_101039
692 Ga0500608_037762
693 Ga0500614_008279
694 Ga0500618_000473
695 Ga0500642_0020504
696 Ga0500658_0003711
697 Ga0500658_0079929
698 Ga0500559_0000003
699 Ga0500559_0004254
700 Ga0500564_083423
701 Ga0500577_0000783
702 Ga0500590_007627
703 Ga0500590_084502
704 Ga0500616_0018310
705 Ga0500622_0017552
706 Ga0500634_0107503
707 Ga0500638_072118
708 Ga0500637_0071316
709 Ga0500637_0093289
710 Ga0500611_009887
711 Ga0500645_001471
712 Ga0500645_006700
713 Ga0500656_007443
714 Ga0500596_001418
715 Ga0500601_002442
716 2511120529
717 2585151348
718 2585196061
719 2643749585
720 2643782632
721 2643925880
722 2643928843
723 2643999848
724 2644508542
725 2819537066
726 2819645478

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00460

Flg_bb_rod

Flagella basal body rod protein

35

65

0.98

PF06429

Flg_bbr_C

Flagellar basal body rod FlgEFG protein C-terminal

226

272

0.93

PF22692

LlgE_F_G_D1

Flagellar hook protein FlgE/F/G D1 domain

115

182

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cg0-assembly1.cif.gz_k cryo-em structure of the flagellar proximal rod with flif peptides from salmonella 0.9244 2 39
7cg0-assembly1.cif.gz_m cryo-em structure of the flagellar proximal rod with flif peptides from salmonella 0.9169 2 40
7cgo-assembly1.cif.gz_l cryo-em structure of the flagellar motor-hook complex from salmonella 0.9119 2 40
7cg0-assembly1.cif.gz_o cryo-em structure of the flagellar proximal rod with flif peptides from salmonella 0.9103 1 40
5npy-assembly1.cif.gz_A crystal structure of helicobacter pylori flagellar hook protein flge2 0.8968 76 127
ID Description Score Start End Superfamily
af_H2KZQ6_199_375_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.412 11 69 1.20.120.350
1biaA03 Mainly Beta;Roll;SH3 type barrels.; 0.36 91 133 2.30.30.100
af_Q94AM9_46_130_2.30.30.100 Mainly Beta;Roll;SH3 type barrels.; 0.3587 91 128 2.30.30.100
1biaA03 Mainly Beta;Roll;SH3 type barrels.; 0.3377 91 133 2.30.30.100
af_Q54DW4_990_1130_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.2887 107 231 2.30.29.30
ID Description Score Start End GO Terms
AF-A0A420WNY8-F1-model_v4 Flagellar basal-body rod protein FlgF 0.9638 1 244 GO:0030694
GO:0071978
AF-A0A839CW50-F1-model_v4 Flagellar hook-basal body complex protein 0.9577 1 243 GO:0009425
GO:0071978
AF-A0A1M5UN17-F1-model_v4 Flagellar basal-body rod protein FlgF 0.955 1 243 GO:0030694
GO:0071978
AF-A0A2E1XFB9-F1-model_v4 Flagellar basal-body rod protein FlgF 0.9532 1 244 GO:0030694
GO:0071978
AF-A0A1H5ZAP7-F1-model_v4 Flagellar basal-body rod protein FlgF 0.9528 1 243 GO:0030694
GO:0071978

Map