F422982

General Info

Members Datasets Scaffolds Average Seq Length
363 275 726 300

Family's Representative Sequence

Representative Sequence 3300025915|Ga0207693_10050376|Ga0207693_100503766
Length 335
Sequence MAVLRELFRILILLNPKSKPEMNKHMKNIIVITGASSGFGALTARALAKAGHTVYASIRETKGRNAPQVEEAKKFAKDNNVDLRTIELDVASQASADAAIQKIIADNKRLDVVIHNAGHMVFGPAEAFTPEQLAELYDVNVLSTQRVNRAALPQLRKQRRGLVVWVSPYLAPYFAAKAGMDALAVVYARELTRWGIETTIIVPGAFTGGTNHFAHAGSPADKARAAEYEAGPYKGFADDVLKGFASIVPPDANVEGVADAIVKVVETPFGKRPFRVHYDPTQDGAEVVNAVSDRVRAELLRRIGLTDVLTPRSLAVELQSAAWSSHVEGESNRRT

Samples

Sample ID Description Type Environment
1 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
56 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
57 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
76 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
79 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
114 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
118 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
122 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
126 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
127 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
128 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
131 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
132 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
133 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
134 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
135 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
136 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
137 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
138 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
139 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
140 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
141 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
142 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
143 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
144 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
145 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
146 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
147 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
148 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
149 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
150 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
151 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
152 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
153 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
154 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
155 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
156 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
157 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
158 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
159 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
160 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
161 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
162 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
163 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
164 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
165 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
166 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
167 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
168 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
169 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
170 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
171 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
172 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
173 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
174 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
175 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
176 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
177 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
178 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
179 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
180 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
181 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
182 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
183 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
184 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
185 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
186 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
190 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
193 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
194 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
195 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
196 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
197 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
198 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
200 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
201 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
202 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
205 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
206 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
207 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
208 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
209 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
210 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
211 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
212 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
213 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
214 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
215 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
216 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
217 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
218 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
219 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
220 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
221 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
222 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
223 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
224 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
225 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
226 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
227 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
228 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
229 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
230 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
231 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
232 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
233 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
234 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
235 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
236 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
237 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
238 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
239 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
240 2791355267 Rhizobium sp. L18 Isolate Nodule
241 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
242 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
243 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
244 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
245 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
246 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
247 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
248 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
249 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
250 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
251 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
252 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
253 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
254 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
255 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
256 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
257 2919404418 Luteibacter sp. 3190 Isolate Unclassified
258 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
259 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
260 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
261 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
262 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
263 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
264 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
265 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
266 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
267 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
268 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
269 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
270 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
271 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
272 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
273 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
274 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
275 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.27
Metatranscriptomes 1.65
Isolates 17.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.34
Nodule 12.4
Rhizoplane 3.03
Rhizosphere 70.52
Stem 0
Stem Tuber 0
Unclassified 3.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207693_10050376 3300025915 Bacteria 3270
2 JGI24739J22299_10001766 3300001989 Bacteria 8228
3 JGI24739J22299_10012599 3300001989 Bacteria 3101
4 JGI24739J22299_10023484 3300001989 Bacteria 2180
5 JGI25151J46595_10005362 3300003187 Bacteria 6631
6 rootH1_10129263 3300003323 Bacteria 3824
7 JGI25160J50197_1024691 3300003354 Bacteria 1699
8 Ga0006562J51391_1060906 3300003578 Bacteria 2440
9 Ga0055535_1009571 3300003761 Bacteria 1657
10 Ga0065165_1000992 3300005262 Bacteria 35037
11 Ga0065715_10283429 3300005293 Bacteria 1080
12 Ga0070676_10184198 3300005328 Bacteria 1359
13 Ga0070683_100099991 3300005329 Bacteria 2730
14 Ga0070670_100062608 3300005331 Bacteria 3194
15 Ga0068869_100068939 3300005334 Bacteria 2614
16 Ga0070666_10079318 3300005335 Bacteria 2242
17 Ga0070666_10105503 3300005335 Bacteria 1946
18 Ga0070689_100171768 3300005340 Bacteria 1757
19 Ga0070668_100076109 3300005347 Bacteria 2621
20 Ga0070669_100012042 3300005353 Bacteria 6137
21 Ga0070669_100037916 3300005353 Bacteria 3497
22 Ga0070675_100031475 3300005354 Bacteria 4289
23 Ga0070675_100282250 3300005354 Unclassified 1460
24 Ga0070671_100144133 3300005355 Bacteria 2011
25 Ga0070674_100037028 3300005356 Bacteria 3279
26 Ga0070673_100246872 3300005364 Bacteria 1554
27 Ga0070667_100020653 3300005367 Bacteria 5468
28 Ga0070667_100108185 3300005367 Bacteria 2408
29 Ga0070667_100244732 3300005367 Bacteria 1602
30 Ga0070709_10025367 3300005434 Bacteria 3502
31 Ga0070709_10058724 3300005434 Bacteria 2440
32 Ga0070710_10144775 3300005437 Bacteria 1460
33 Ga0070711_100261578 3300005439 Bacteria 1361
34 Ga0070708_100077710 3300005445 Bacteria 2999
35 Ga0070708_100156158 3300005445 Unclassified 2124
36 Ga0070708_100289940 3300005445 Bacteria 1541
37 Ga0070663_100101749 3300005455 Bacteria 2145
38 Ga0070662_100005125 3300005457 Bacteria 8354
39 Ga0070662_100179249 3300005457 Bacteria 1669
40 Ga0068867_100169789 3300005459 Bacteria 1727
41 Ga0070707_100188504 3300005468 Bacteria 2011
42 Ga0070707_100364570 3300005468 Bacteria 1404
43 Ga0070707_100392032 3300005468 Unclassified 1349
44 Ga0070707_100394313 3300005468 Bacteria 1344
45 Ga0070707_100614007 3300005468 Bacteria 1050
46 Ga0070698_100013857 3300005471 Bacteria 8525
47 Ga0070698_100065655 3300005471 Bacteria 3653
48 Ga0070698_100275315 3300005471 Bacteria 1615
49 Ga0070697_100117840 3300005536 Bacteria 2218
50 Ga0070697_100159228 3300005536 Bacteria 1907
51 Ga0070697_100337199 3300005536 Bacteria 1300
52 Ga0068855_100282180 3300005563 Bacteria 1844
53 Ga0070664_100327146 3300005564 Bacteria 1390
54 Ga0068857_100031310 3300005577 Bacteria 4700
55 Ga0068857_100255563 3300005577 Bacteria 1607
56 Ga0068854_100121011 3300005578 Unclassified 1987
57 Ga0070702_100061118 3300005615 Bacteria 2193
58 Ga0068864_100035883 3300005618 Bacteria 4222
59 Ga0068866_10261213 3300005718 Bacteria 1064
60 Ga0068861_100040497 3300005719 Bacteria 3485
61 Ga0068863_100084420 3300005841 Bacteria 3009
62 Ga0068860_100182819 3300005843 Bacteria 2027
63 Ga0068860_100216824 3300005843 Bacteria 1857
64 Ga0068862_100129616 3300005844 Bacteria 2230
65 Ga0081540_1029216 3300005983 Bacteria 3076
66 Ga0070717_10201538 3300006028 Bacteria 1743
67 Ga0070717_10477404 3300006028 Bacteria 1125
68 Ga0070717_10616989 3300006028 Bacteria 984
69 Ga0075363_100165047 3300006048 Bacteria 1255
70 Ga0070716_100027000 3300006173 Bacteria 3079
71 Ga0070716_100299539 3300006173 Bacteria 1118
72 Ga0075367_10006784 3300006178 Bacteria 5815
73 Ga0075366_10106526 3300006195 Bacteria 1685
74 Ga0097621_100098040 3300006237 Bacteria 2462
75 Ga0097621_100113010 3300006237 Bacteria 2297
76 Ga0075370_10002374 3300006353 Bacteria 8712
77 Ga0068871_100046744 3300006358 Bacteria 3487
78 Ga0075433_10218061 3300006852 Bacteria 1695
79 Ga0068865_100003170 3300006881 Bacteria 9854
80 Ga0068865_100170337 3300006881 Unclassified 1669
81 Ga0099794_10090652 3300007265 Bacteria 1517
82 Ga0099794_10130336 3300007265 Bacteria 1269
83 Ga0099795_10041120 3300007788 Bacteria 1645
84 Ga0099795_10063559 3300007788 Bacteria 1376
85 Ga0105244_10019817 3300009036 Bacteria 3745
86 Ga0111539_10001523 3300009094 Bacteria 30909
87 Ga0105245_10198203 3300009098 Unclassified 1927
88 Ga0105245_10384628 3300009098 Bacteria 1398
89 Ga0105243_10141845 3300009148 Unclassified 2051
90 Ga0105242_10082036 3300009176 Bacteria 2698
91 Ga0105248_10058074 3300009177 Bacteria 4344
92 Ga0105248_10499198 3300009177 Bacteria 1372
93 Ga0105249_10017305 3300009553 Bacteria 6400
94 Ga0099796_10059815 3300010159 Unclassified 1347
95 Ga0099796_10063102 3300010159 Bacteria 1318
96 Ga0105239_10166483 3300010375 Bacteria 2465
97 Ga0105239_10296460 3300010375 Bacteria 1821
98 Ga0105239_10499010 3300010375 Bacteria 1383
99 Ga0105246_10143743 3300011119 Bacteria 1797
100 Ga0157373_10038934 3300013100 Bacteria 3405
101 Ga0157369_10198112 3300013105 Bacteria 2108
102 Ga0157374_10070815 3300013296 Bacteria 3286
103 Ga0157374_10204906 3300013296 Bacteria 1933
104 Ga0157374_10433877 3300013296 Unclassified 1314
105 Ga0157378_10091328 3300013297 Bacteria 2768
106 Ga0157378_10399509 3300013297 Bacteria 1354
107 Ga0163162_10007506 3300013306 Bacteria 10617
108 Ga0163162_10037908 3300013306 Bacteria 4811
109 Ga0163162_10136123 3300013306 Bacteria 2567
110 Ga0163162_10232022 3300013306 Bacteria 1976
111 Ga0157375_10016284 3300013308 Bacteria 6672
112 Ga0157375_10092701 3300013308 Bacteria 3085
113 Ga0157375_10096241 3300013308 Bacteria 3033
114 Ga0157375_10319344 3300013308 Bacteria 1717
115 Ga0163163_10021951 3300014325 Bacteria 6034
116 Ga0157376_10370492 3300014969 Bacteria 1376
117 Ga0182005_1005940 3300015265 Bacteria 3777
118 Ga0183368_1002 3300015687 Bacteria 1865598
119 Ga0163161_10025480 3300017792 Bacteria 4185
120 Ga0163161_10183130 3300017792 Bacteria 1607
121 Ga0224572_1012203 3300024225 Bacteria 1630
122 Ga0209258_100391 3300025242 Bacteria 55848
123 Ga0207426_1000649 3300025302 Bacteria 42959
124 Ga0207697_10013707 3300025315 Bacteria 3378
125 Ga0207697_10020866 3300025315 Bacteria 2682
126 Ga0207655_1018137 3300025728 Bacteria 3753
127 Ga0207642_10192852 3300025899 Bacteria 1119
128 Ga0207680_10013810 3300025903 Bacteria 4159
129 Ga0207685_10065192 3300025905 Bacteria 1457
130 Ga0207645_10047350 3300025907 Bacteria 2746
131 Ga0207657_10151249 3300025919 Unclassified 1890
132 Ga0207681_10011781 3300025923 Bacteria 5378
133 Ga0207694_10335607 3300025924 Bacteria 1249
134 Ga0207650_10164069 3300025925 Bacteria 1762
135 Ga0207659_10375162 3300025926 Bacteria 1185
136 Ga0207700_10338912 3300025928 Bacteria 1307
137 Ga0207644_10145802 3300025931 Bacteria 1827
138 Ga0207706_10004433 3300025933 Bacteria 13194
139 Ga0207706_10033755 3300025933 Bacteria 4554
140 Ga0207706_10314093 3300025933 Bacteria 1364
141 Ga0207709_10340941 3300025935 Bacteria 1128
142 Ga0207669_10113741 3300025937 Bacteria 1820
143 Ga0207704_10095305 3300025938 Bacteria 1967
144 Ga0207665_10092869 3300025939 Unclassified 2094
145 Ga0207665_10119183 3300025939 Bacteria 1863
146 Ga0207665_10139676 3300025939 Bacteria 1726
147 Ga0207691_10031408 3300025940 Bacteria 4957
148 Ga0207689_10032896 3300025942 Bacteria 4310
149 Ga0207661_10042524 3300025944 Bacteria 3582
150 Ga0207667_10298275 3300025949 Bacteria 1646
151 Ga0207712_10095352 3300025961 Bacteria 2200
152 Ga0207668_10083647 3300025972 Bacteria 2323
153 Ga0207668_10424199 3300025972 Unclassified 1129
154 Ga0207658_10027643 3300025986 Bacteria 3988
155 Ga0207658_10178243 3300025986 Bacteria 1757
156 Ga0207678_10103605 3300026067 Bacteria 2429
157 Ga0207648_10020299 3300026089 Bacteria 5986
158 Ga0207676_10015669 3300026095 Bacteria 5476
159 Ga0207674_10007165 3300026116 Bacteria 13026
160 Ga0207674_10234020 3300026116 Bacteria 1785
161 Ga0207675_100437861 3300026118 Bacteria 1294
162 Ga0207683_10042297 3300026121 Bacteria 3980
163 Ga0207683_10109529 3300026121 Bacteria 2472
164 Ga0209588_1055424 3300027671 Bacteria 1281
165 Ga0207428_10031395 3300027907 Bacteria 4382
166 Ga0265356_1000821 3300028017 Bacteria 5167
167 Ga0268265_10066259 3300028380 Bacteria 2791
168 Ga0268264_10257789 3300028381 Bacteria 1623
169 Ga0268264_10368676 3300028381 Bacteria 1372
170 Ga0307517_10169292 3300028786 Bacteria 1441
171 Ga0265762_1004991 3300030760 Bacteria 2377
172 Ga0265762_1007357 3300030760 Bacteria 1963
173 Ga0265760_10000508 3300031090 Bacteria 10899
174 Ga0265760_10008183 3300031090 Bacteria 2988
175 Ga0265760_10037269 3300031090 Bacteria 1443
176 Ga0307408_100225849 3300031548 Bacteria 1530
177 Ga0307410_10365015 3300031852 Bacteria 1157
178 Ga0307406_10010460 3300031901 Bacteria 5234
179 Ga0307406_10529097 3300031901 Bacteria 961
180 Ga0307409_100102197 3300031995 Bacteria 2381
181 Ga0307416_100279131 3300032002 Bacteria 1646
182 Ga0307414_10015739 3300032004 Bacteria 4575
183 Ga0307411_10304119 3300032005 Bacteria 1280
184 Ga0316212_1002965 3300033547 Bacteria 2440
185 Ga0373931_0145112 3300035691 Bacteria 1379
186 Ga0395905_0354885 3300037471 Bacteria 1359
187 Ga0451837_0721538 3300041494 Bacteria 1567
188 Ga0451839_0942834 3300041496 Bacteria 3921
189 Ga0451841_0136112 3300041498 Bacteria 1685
190 Ga0451847_0121881 3300041503 Bacteria 5042
191 Ga0451851_0543407 3300041507 Bacteria 1218
192 Ga0451855_1582628 3300041511 Bacteria 2936
193 Ga0466969_0000502 3300044656 Bacteria 21431
194 Ga0466969_0002573 3300044656 Bacteria 9696
195 Ga0466966_0060989 3300044684 Bacteria 2379
196 Ga0466961_0003571 3300044693 Bacteria 9696
197 Ga0466961_0011835 3300044693 Bacteria 5576
198 Ga0466971_0055060 3300044719 Bacteria 1793
199 Ga0466968_0046873 3300044735 Bacteria 1837
200 Ga0466970_0001435 3300044765 Bacteria 11530
201 Ga0466957_0008497 3300044842 Bacteria 5842
202 Ga0466959_0039772 3300045049 Bacteria 3475
203 Ga0451576_0220911 3300045051 Unclassified 1978
204 Ga0466958_0054466 3300045836 Bacteria 2426
205 Ga0466967_0296774 3300045976 Bacteria 1554
206 Ga0495603_0001310 3300046455 Bacteria 14465
207 Ga0495629_0098411 3300046459 Bacteria 2041
208 Ga0495638_0000024 3300046460 Bacteria 362116
209 Ga0495638_0023878 3300046460 Bacteria 3993
210 Ga0495650_0036231 3300046471 Bacteria 2161
211 Ga0495580_0039464 3300046472 Bacteria 3378
212 Ga0495605_0011049 3300046474 Bacteria 5045
213 Ga0495585_0001962 3300046492 Bacteria 15334
214 Ga0495585_0003904 3300046492 Bacteria 9891
215 Ga0495594_0000200 3300046499 Bacteria 29166
216 Ga0495596_0008730 3300046500 Bacteria 4490
217 Ga0495596_0073436 3300046500 Bacteria 1328
218 Ga0495607_0018271 3300046501 Bacteria 4474
219 Ga0495583_0000080 3300046506 Bacteria 169455
220 Ga0495583_0008150 3300046506 Bacteria 6449
221 Ga0495606_0000248 3300046507 Bacteria 94934
222 Ga0495616_0081703 3300046513 Bacteria 1545
223 Ga0495620_0012265 3300046515 Bacteria 4438
224 Ga0495631_0003679 3300046518 Bacteria 8364
225 Ga0495631_0075458 3300046518 Bacteria 1455
226 Ga0495631_0141129 3300046518 Bacteria 1034
227 Ga0495632_0001850 3300046519 Bacteria 17029
228 Ga0495643_0093005 3300046522 Bacteria 1553
229 Ga0495643_0151473 3300046522 Bacteria 1148
230 Ga0495644_0000011 3300046523 Bacteria 97543
231 Ga0495644_0021955 3300046523 Bacteria 2433
232 Ga0495648_0000005 3300046524 Bacteria 362116
233 Ga0495648_0064439 3300046524 Bacteria 2159
234 Ga0495642_0002226 3300046528 Bacteria 7941
235 Ga0495609_0010705 3300046538 Bacteria 4389
236 Ga0495597_0062165 3300046542 Bacteria 1625
237 Ga0495668_0000002 3300046616 Bacteria 763179
238 Ga0495668_0030409 3300046616 Bacteria 3049
239 Ga0495611_0164667 3300046648 Bacteria 1036
240 Ga0495625_0002480 3300046660 Bacteria 19884
241 Ga0495625_0006211 3300046660 Bacteria 10701
242 Ga0495625_0021206 3300046660 Bacteria 5005
243 Ga0495625_0206560 3300046660 Bacteria 1293
244 Ga0495669_0007791 3300046684 Bacteria 4497
245 Ga0495669_0009171 3300046684 Bacteria 4168
246 Ga0495669_0009548 3300046684 Bacteria 4093
247 Ga0495669_0110193 3300046684 Bacteria 1285
248 Ga0495670_0003503 3300046691 Bacteria 7704
249 Ga0495670_0121583 3300046691 Bacteria 1356
250 Ga0495671_0000030 3300046692 Bacteria 219127
251 Ga0495589_0008013 3300046794 Bacteria 5527
252 Ga0495636_0034115 3300047318 Bacteria 2094
253 Ga0495672_0023632 3300047320 Bacteria 3974
254 Ga0495676_0237270 3300047321 Bacteria 1250
255 Ga0495687_037396 3300047443 Bacteria 2163
256 Ga0495677_0005673 3300047445 Bacteria 4730
257 Ga0495685_040320 3300047447 Bacteria 1597
258 Ga0495673_0000068 3300047469 Bacteria 219127
259 Ga0495673_0013177 3300047469 Bacteria 4353
260 Ga0495686_0004010 3300047472 Bacteria 12318
261 Ga0495686_0063864 3300047472 Bacteria 2280
262 Ga0495686_0073708 3300047472 Bacteria 2096
263 Ga0495686_0146610 3300047472 Bacteria 1389
264 Ga0495626_0011382 3300048091 Bacteria 4708
265 Ga0495626_0048689 3300048091 Bacteria 1966
266 Ga0496100_0163033 3300048903 Bacteria 1599
267 Ga0496101_0022321 3300048904 Bacteria 4356
268 Ga0496102_0077210 3300048905 Bacteria 3065
269 Ga0496104_0095698 3300048907 Bacteria 2841
270 Ga0496108_0135471 3300048911 Bacteria 2118
271 Ga0496109_0087586 3300048912 Bacteria 2876
272 Ga0496112_0006753 3300048915 Bacteria 10109
273 Ga0496114_0253709 3300048917 Bacteria 1548
274 Ga0496115_0289863 3300048918 Bacteria 1343
275 Ga0496117_0073396 3300048920 Bacteria 2283
276 Ga0496121_0000729 3300048924 Bacteria 60664
277 Ga0496121_0087241 3300048924 Bacteria 2450
278 Ga0496121_0123389 3300048924 Bacteria 1952
279 Ga0496121_0229980 3300048924 Bacteria 1299
280 Ga0496126_0001112 3300048929 Bacteria 45021
281 Ga0496126_0009620 3300048929 Bacteria 10250
282 Ga0496126_0333915 3300048929 Bacteria 1243
283 Ga0495678_049092 3300049459 Bacteria 1642
284 Ga0501034_0124335 3300049571 Bacteria 2565
285 Ga0501044_0215495 3300049823 Bacteria 1873
286 nmdc:mga03n38_181672_c1 3300050490 Bacteria 1078
287 nmdc:mga07m45_3065_c1 3300050496 Bacteria 7982
288 nmdc:mga09592_95124_c1 3300050508 Bacteria 2548
289 nmdc:mga08y16_1166_c1 3300050511 Bacteria 25900
290 Ga0500643_000317 3300053087 Bacteria 39125
291 Ga0500643_003190 3300053087 Bacteria 8010
292 Ga0500644_0024398 3300053088 Bacteria 1848
293 Ga0500646_0008966 3300053090 Bacteria 2561
294 Ga0500646_0035244 3300053090 Bacteria 1390
295 Ga0500651_0034594 3300053093 Bacteria 3186
296 Ga0500556_0000794 3300053104 Bacteria 18507
297 Ga0500569_045291 3300053109 Bacteria 1306
298 Ga0500559_0041197 3300053136 Bacteria 2013
299 Ga0500645_007433 3300053730 Bacteria 3813
300 Ga0500587_012724 3300053739 Bacteria 1061
301 Ga0466962_0007164 3300061719 Bacteria 5342
302 2509146798 2508501128 Bacteria 8613869
303 2510895874 2510461076 Bacteria 8618824
304 2513577774 2513237085 Bacteria 7695351
305 2513632079 2513237093 Bacteria 7545552
306 2513712451 2513237103 Bacteria 7647401
307 2513861579 2513237137 Bacteria 9558895
308 2515113611 2515075009 Bacteria 7288508
309 2515635324 2515154113 Bacteria 7807172
310 2515646064 2515154114 Bacteria 7848616
311 2515654858 2515154116 Bacteria 7552979
312 2515739968 2515154134 Bacteria 7220242
313 2516019670 2515154189 Bacteria 9629850
314 2517037226 2516653077 Bacteria 7555578
315 2517077565 2516653085 Bacteria 7346596
316 2517096335 2517093000 Bacteria 7412387
317 2524442573 2524023205 Bacteria 8918781
318 2585270237 2582581306 Bacteria 6450535
319 2585390459 2582581865 Bacteria 6644329
320 2585395817 2582581866 Bacteria 6859583
321 2585524993 2585427526 Bacteria 7258840
322 2599336365 2599185156 Bacteria 5403036
323 2600197954 2599185352 Bacteria 7228948
324 2721025553 2718218334 Bacteria 4765486
325 2739349389 2738543031 Bacteria 5769731
326 2745075538 2744054633 Bacteria 8678936
327 2766066363 2765235942 Bacteria 7445910
328 2793369959 2791355267 Bacteria 7222458
329 2838686556 2838686498 Bacteria 7807632
330 2838734798 2838729681 Bacteria 7400765
331 2838747413 2838742623 Bacteria 7396178
332 2841854385 2841851746 Bacteria 7532261
333 2842158596 2842156927 Bacteria 6894975
334 2842168958 2842163707 Bacteria 6916235
335 2842182210 2842180545 Bacteria 6888678
336 2842218441 2842217011 Bacteria 7497767
337 2842229790 2842229732 Bacteria 7475766
338 2842243679 2842243621 Bacteria 7421798
339 2842258236 2842257432 Bacteria 7401195
340 2842271906 2842271015 Bacteria 7807131
341 2842305518 2842304105 Bacteria 7023636
342 2844457854 2844454524 Bacteria 7952546
343 2857516927 2857516855 Bacteria 7787325
344 2883092117 2883087390 Bacteria 9532701
345 2919407216 2919404418 Bacteria 4232372
346 2928158763 2928157003 Bacteria 7522202
347 2933571325 2933570622 Bacteria 7023390
348 2933591909 2933586486 Bacteria 7667493
349 2935901400 2935901341 Bacteria 7341747
350 2935961370 2935959822 Bacteria 7869783
351 2936371546 2936367885 Bacteria 7324495
352 2936376917 2936375103 Bacteria 6652732
353 639649653 639633055 Bacteria 7751309
354 8005314154 8005307578 Bacteria 7395396
355 8005382606 8005376324 Bacteria 6590079
356 8005464297 8005460587 Bacteria 7157962
357 8005561711 8005556819 Bacteria 6908598
358 8018163268 8018163183 Bacteria 7277977
359 8023682676 8023680758 Bacteria 7729763
360 8024486033 8024479707 Bacteria 6954785
361 8047719449 8047710418 Bacteria 11023148
362 8056377095 8056375014 Bacteria 7006639
363 8057881846 8057874678 Bacteria 7494653
364 Ga0207693_10050376
365 JGI24739J22299_10001766
366 JGI24739J22299_10012599
367 JGI24739J22299_10023484
368 JGI25151J46595_10005362
369 rootH1_10129263
370 JGI25160J50197_1024691
371 Ga0006562J51391_1060906
372 Ga0055535_1009571
373 Ga0065165_1000992
374 Ga0065715_10283429
375 Ga0070676_10184198
376 Ga0070683_100099991
377 Ga0070670_100062608
378 Ga0068869_100068939
379 Ga0070666_10079318
380 Ga0070666_10105503
381 Ga0070689_100171768
382 Ga0070668_100076109
383 Ga0070669_100012042
384 Ga0070669_100037916
385 Ga0070675_100031475
386 Ga0070675_100282250
387 Ga0070671_100144133
388 Ga0070674_100037028
389 Ga0070673_100246872
390 Ga0070667_100020653
391 Ga0070667_100108185
392 Ga0070667_100244732
393 Ga0070709_10025367
394 Ga0070709_10058724
395 Ga0070710_10144775
396 Ga0070711_100261578
397 Ga0070708_100077710
398 Ga0070708_100156158
399 Ga0070708_100289940
400 Ga0070663_100101749
401 Ga0070662_100005125
402 Ga0070662_100179249
403 Ga0068867_100169789
404 Ga0070707_100188504
405 Ga0070707_100364570
406 Ga0070707_100392032
407 Ga0070707_100394313
408 Ga0070707_100614007
409 Ga0070698_100013857
410 Ga0070698_100065655
411 Ga0070698_100275315
412 Ga0070697_100117840
413 Ga0070697_100159228
414 Ga0070697_100337199
415 Ga0068855_100282180
416 Ga0070664_100327146
417 Ga0068857_100031310
418 Ga0068857_100255563
419 Ga0068854_100121011
420 Ga0070702_100061118
421 Ga0068864_100035883
422 Ga0068866_10261213
423 Ga0068861_100040497
424 Ga0068863_100084420
425 Ga0068860_100182819
426 Ga0068860_100216824
427 Ga0068862_100129616
428 Ga0081540_1029216
429 Ga0070717_10201538
430 Ga0070717_10477404
431 Ga0070717_10616989
432 Ga0075363_100165047
433 Ga0070716_100027000
434 Ga0070716_100299539
435 Ga0075367_10006784
436 Ga0075366_10106526
437 Ga0097621_100098040
438 Ga0097621_100113010
439 Ga0075370_10002374
440 Ga0068871_100046744
441 Ga0075433_10218061
442 Ga0068865_100003170
443 Ga0068865_100170337
444 Ga0099794_10090652
445 Ga0099794_10130336
446 Ga0099795_10041120
447 Ga0099795_10063559
448 Ga0105244_10019817
449 Ga0111539_10001523
450 Ga0105245_10198203
451 Ga0105245_10384628
452 Ga0105243_10141845
453 Ga0105242_10082036
454 Ga0105248_10058074
455 Ga0105248_10499198
456 Ga0105249_10017305
457 Ga0099796_10059815
458 Ga0099796_10063102
459 Ga0105239_10166483
460 Ga0105239_10296460
461 Ga0105239_10499010
462 Ga0105246_10143743
463 Ga0157373_10038934
464 Ga0157369_10198112
465 Ga0157374_10070815
466 Ga0157374_10204906
467 Ga0157374_10433877
468 Ga0157378_10091328
469 Ga0157378_10399509
470 Ga0163162_10007506
471 Ga0163162_10037908
472 Ga0163162_10136123
473 Ga0163162_10232022
474 Ga0157375_10016284
475 Ga0157375_10092701
476 Ga0157375_10096241
477 Ga0157375_10319344
478 Ga0163163_10021951
479 Ga0157376_10370492
480 Ga0182005_1005940
481 Ga0183368_1002
482 Ga0163161_10025480
483 Ga0163161_10183130
484 Ga0224572_1012203
485 Ga0209258_100391
486 Ga0207426_1000649
487 Ga0207697_10013707
488 Ga0207697_10020866
489 Ga0207655_1018137
490 Ga0207642_10192852
491 Ga0207680_10013810
492 Ga0207685_10065192
493 Ga0207645_10047350
494 Ga0207657_10151249
495 Ga0207681_10011781
496 Ga0207694_10335607
497 Ga0207650_10164069
498 Ga0207659_10375162
499 Ga0207700_10338912
500 Ga0207644_10145802
501 Ga0207706_10004433
502 Ga0207706_10033755
503 Ga0207706_10314093
504 Ga0207709_10340941
505 Ga0207669_10113741
506 Ga0207704_10095305
507 Ga0207665_10092869
508 Ga0207665_10119183
509 Ga0207665_10139676
510 Ga0207691_10031408
511 Ga0207689_10032896
512 Ga0207661_10042524
513 Ga0207667_10298275
514 Ga0207712_10095352
515 Ga0207668_10083647
516 Ga0207668_10424199
517 Ga0207658_10027643
518 Ga0207658_10178243
519 Ga0207678_10103605
520 Ga0207648_10020299
521 Ga0207676_10015669
522 Ga0207674_10007165
523 Ga0207674_10234020
524 Ga0207675_100437861
525 Ga0207683_10042297
526 Ga0207683_10109529
527 Ga0209588_1055424
528 Ga0207428_10031395
529 Ga0265356_1000821
530 Ga0268265_10066259
531 Ga0268264_10257789
532 Ga0268264_10368676
533 Ga0307517_10169292
534 Ga0265762_1004991
535 Ga0265762_1007357
536 Ga0265760_10000508
537 Ga0265760_10008183
538 Ga0265760_10037269
539 Ga0307408_100225849
540 Ga0307410_10365015
541 Ga0307406_10010460
542 Ga0307406_10529097
543 Ga0307409_100102197
544 Ga0307416_100279131
545 Ga0307414_10015739
546 Ga0307411_10304119
547 Ga0316212_1002965
548 Ga0373931_0145112
549 Ga0395905_0354885
550 Ga0451837_0721538
551 Ga0451839_0942834
552 Ga0451841_0136112
553 Ga0451847_0121881
554 Ga0451851_0543407
555 Ga0451855_1582628
556 Ga0466969_0000502
557 Ga0466969_0002573
558 Ga0466966_0060989
559 Ga0466961_0003571
560 Ga0466961_0011835
561 Ga0466971_0055060
562 Ga0466968_0046873
563 Ga0466970_0001435
564 Ga0466957_0008497
565 Ga0466959_0039772
566 Ga0451576_0220911
567 Ga0466958_0054466
568 Ga0466967_0296774
569 Ga0495603_0001310
570 Ga0495629_0098411
571 Ga0495638_0000024
572 Ga0495638_0023878
573 Ga0495650_0036231
574 Ga0495580_0039464
575 Ga0495605_0011049
576 Ga0495585_0001962
577 Ga0495585_0003904
578 Ga0495594_0000200
579 Ga0495596_0008730
580 Ga0495596_0073436
581 Ga0495607_0018271
582 Ga0495583_0000080
583 Ga0495583_0008150
584 Ga0495606_0000248
585 Ga0495616_0081703
586 Ga0495620_0012265
587 Ga0495631_0003679
588 Ga0495631_0075458
589 Ga0495631_0141129
590 Ga0495632_0001850
591 Ga0495643_0093005
592 Ga0495643_0151473
593 Ga0495644_0000011
594 Ga0495644_0021955
595 Ga0495648_0000005
596 Ga0495648_0064439
597 Ga0495642_0002226
598 Ga0495609_0010705
599 Ga0495597_0062165
600 Ga0495668_0000002
601 Ga0495668_0030409
602 Ga0495611_0164667
603 Ga0495625_0002480
604 Ga0495625_0006211
605 Ga0495625_0021206
606 Ga0495625_0206560
607 Ga0495669_0007791
608 Ga0495669_0009171
609 Ga0495669_0009548
610 Ga0495669_0110193
611 Ga0495670_0003503
612 Ga0495670_0121583
613 Ga0495671_0000030
614 Ga0495589_0008013
615 Ga0495636_0034115
616 Ga0495672_0023632
617 Ga0495676_0237270
618 Ga0495687_037396
619 Ga0495677_0005673
620 Ga0495685_040320
621 Ga0495673_0000068
622 Ga0495673_0013177
623 Ga0495686_0004010
624 Ga0495686_0063864
625 Ga0495686_0073708
626 Ga0495686_0146610
627 Ga0495626_0011382
628 Ga0495626_0048689
629 Ga0496100_0163033
630 Ga0496101_0022321
631 Ga0496102_0077210
632 Ga0496104_0095698
633 Ga0496108_0135471
634 Ga0496109_0087586
635 Ga0496112_0006753
636 Ga0496114_0253709
637 Ga0496115_0289863
638 Ga0496117_0073396
639 Ga0496121_0000729
640 Ga0496121_0087241
641 Ga0496121_0123389
642 Ga0496121_0229980
643 Ga0496126_0001112
644 Ga0496126_0009620
645 Ga0496126_0333915
646 Ga0495678_049092
647 Ga0501034_0124335
648 Ga0501044_0215495
649 nmdc:mga03n38_181672_c1
650 nmdc:mga07m45_3065_c1
651 nmdc:mga09592_95124_c1
652 nmdc:mga08y16_1166_c1
653 Ga0500643_000317
654 Ga0500643_003190
655 Ga0500644_0024398
656 Ga0500646_0008966
657 Ga0500646_0035244
658 Ga0500651_0034594
659 Ga0500556_0000794
660 Ga0500569_045291
661 Ga0500559_0041197
662 Ga0500645_007433
663 Ga0500587_012724
664 Ga0466962_0007164
665 2509146798
666 2510895874
667 2513577774
668 2513632079
669 2513712451
670 2513861579
671 2515113611
672 2515635324
673 2515646064
674 2515654858
675 2515739968
676 2516019670
677 2517037226
678 2517077565
679 2517096335
680 2524442573
681 2585270237
682 2585390459
683 2585395817
684 2585524993
685 2599336365
686 2600197954
687 2721025553
688 2739349389
689 2745075538
690 2766066363
691 2793369959
692 2838686556
693 2838734798
694 2838747413
695 2841854385
696 2842158596
697 2842168958
698 2842182210
699 2842218441
700 2842229790
701 2842243679
702 2842258236
703 2842271906
704 2842305518
705 2844457854
706 2857516927
707 2883092117
708 2919407216
709 2928158763
710 2933571325
711 2933591909
712 2935901400
713 2935961370
714 2936371546
715 2936376917
716 639649653
717 8005314154
718 8005382606
719 8005464297
720 8005561711
721 8018163268
722 8023682676
723 8024486033
724 8047719449
725 8056377095
726 8057881846

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

28

218

0.9

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

30

167

0.87

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

34

238

0.85

PF08659

KR

KR domain

28

201

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3u9l-assembly1.cif.gz_A-2 the crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase (nadph) from sinorhizobium meliloti 0.9873 3 297
3u9l-assembly1.cif.gz_A-2 the crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase (nadph) from sinorhizobium meliloti 0.9839 3 297
8jf9-assembly1.cif.gz_A crystal structure of 3-oxoacyl-acp reductase fabg from helicobacter pylori 0.9462 1 189
5g4l-assembly1.cif.gz_A phloroglucinol reductase from clostridium sp. with bound nadph 0.9221 3 188
2ewm-assembly1.cif.gz_B-2 crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1 0.9157 4 188
ID Description Score Start End Superfamily
3u9lA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.987 3 297 3.40.50.720
3u9lA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9835 3 297 3.40.50.720
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9352 96 193 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9229 4 187 3.40.50.720
af_Q0E0D3_22_224_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9189 4 190 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1E1VEH7-F1-model_v4 Short-chain dehydrogenase/reductase SDR 0.992 2 259
AF-A0A072TCI1-F1-model_v4 Short-chain dehydrogenase/reductase 0.9905 2 299
AF-A0A2G7DLB9-F1-model_v4 deleted 0.9896 1 134
AF-A0A5E4YKP3-F1-model_v4 Oxidoreductase 0.9895 2 299
AF-A0A2S7NGN9-F1-model_v4 deleted 0.9893 1 299

Map