F423008

General Info

Members Datasets Scaffolds Average Seq Length
363 221 363 256

Family's Representative Sequence

Representative Sequence 3300030521|Ga0307511_10013740|Ga0307511_100137404
Length 272
Sequence MKLRDSLSEAVRTASLDGEPALVAFLTAGYPSKSQFREHLQAVAAGADVVEIGVPFTDPMADGVTIQRSSQAALAQGVSLRWILAELEEMPRVKTPLVLMSYLNPLLAFGLDRLADAAARSHVAGFIVPDLPLDEGTDLRKALDAKGVAMIQMVTPVTKPERLQQLCDSSQGFVYAVTMTGTTGKNVAIPAEVMDYLDRVRALSKTPVCAGFGIRSREQVELLRGHVDGVVVGSALVEVLERGGNPTEWLAALRGPAHSKAGAREKERQSSP

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
121 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
122 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
123 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
124 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
125 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
126 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
130 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
131 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
132 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
133 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
134 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
135 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
139 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
140 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
141 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
142 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
143 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
144 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
145 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
146 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
147 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
148 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
149 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
150 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
151 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
152 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
153 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
154 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
155 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
156 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
157 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
158 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
159 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
162 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
163 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
164 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
165 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
166 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
167 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
168 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
169 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
170 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
171 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
172 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
173 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
174 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
175 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
176 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
177 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
178 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
179 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
180 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
181 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
189 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
190 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
191 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
192 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
193 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
194 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
195 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
196 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
197 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
201 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
202 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
203 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
204 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
205 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
206 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
207 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
208 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
209 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
210 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
213 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
214 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
215 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
216 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
217 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
218 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
219 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
220 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
221 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.1
Nodule 0
Rhizoplane 3.31
Rhizosphere 87.05
Stem 0
Stem Tuber 0
Unclassified 8.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10009453 3300003316 Bacteria 2890
2 rootH1_10138102 3300003323 Bacteria 5026
3 Ga0070676_10020068 3300005328 Bacteria 3725
4 Ga0070683_100109685 3300005329 Bacteria 2603
5 Ga0070683_100157325 3300005329 Bacteria 2155
6 Ga0070670_100442181 3300005331 Bacteria 1151
7 Ga0070677_10014355 3300005333 Bacteria 2786
8 Ga0068869_100276486 3300005334 Bacteria 1349
9 Ga0070680_100023397 3300005336 Bacteria 4927
10 Ga0070682_100048353 3300005337 Bacteria 2648
11 Ga0070682_100104129 3300005337 Bacteria 1879
12 Ga0070682_100108734 3300005337 Bacteria 1844
13 Ga0070689_100004301 3300005340 Bacteria 9608
14 Ga0070689_100682415 3300005340 Bacteria 896
15 Ga0070691_10243913 3300005341 Bacteria 961
16 Ga0070687_100197778 3300005343 Bacteria 1216
17 Ga0070687_100228173 3300005343 Bacteria 1144
18 Ga0070668_100320079 3300005347 Bacteria 1306
19 Ga0070669_100388389 3300005353 Bacteria 1139
20 Ga0070675_100118663 3300005354 Bacteria 2246
21 Ga0070671_100001010 3300005355 Bacteria 20683
22 Ga0070674_100080915 3300005356 Bacteria 2320
23 Ga0070673_100501868 3300005364 Bacteria 1097
24 Ga0070667_100010926 3300005367 Bacteria 7511
25 Ga0070667_100314712 3300005367 Unclassified 1412
26 Ga0070709_10077812 3300005434 Unclassified 2157
27 Ga0070714_100236142 3300005435 Bacteria 1686
28 Ga0070713_100145205 3300005436 Unclassified 2105
29 Ga0070713_100672957 3300005436 Unclassified 987
30 Ga0070713_100706386 3300005436 Unclassified 963
31 Ga0070701_10009685 3300005438 Bacteria 4227
32 Ga0070705_100060499 3300005440 Bacteria 2246
33 Ga0070700_100059055 3300005441 Bacteria 2413
34 Ga0070708_100480703 3300005445 Unclassified 1172
35 Ga0070663_100098181 3300005455 Unclassified 2181
36 Ga0070678_100520926 3300005456 Bacteria 1052
37 Ga0070681_10005500 3300005458 Bacteria 12241
38 Ga0070681_10144066 3300005458 Bacteria 2312
39 Ga0068867_100078949 3300005459 Bacteria 2476
40 Ga0070685_10208594 3300005466 Bacteria 1274
41 Ga0070679_100026915 3300005530 Bacteria 5655
42 Ga0070679_100070499 3300005530 Bacteria 3487
43 Ga0070684_100016127 3300005535 Bacteria 6103
44 Ga0070686_100001885 3300005544 Bacteria 11683
45 Ga0070693_100062416 3300005547 Bacteria 2168
46 Ga0070665_100002877 3300005548 Bacteria 18604
47 Ga0070665_100006965 3300005548 Bacteria 11494
48 Ga0070665_100009367 3300005548 Bacteria 9912
49 Ga0070665_100038265 3300005548 Bacteria 4822
50 Ga0070665_100057889 3300005548 Bacteria 3886
51 Ga0070665_100122857 3300005548 Bacteria 2598
52 Ga0070665_100135448 3300005548 Bacteria 2465
53 Ga0070665_100255976 3300005548 Bacteria 1751
54 Ga0070704_100037435 3300005549 Bacteria 3315
55 Ga0070704_100053848 3300005549 Bacteria 2845
56 Ga0068855_100001279 3300005563 Bacteria 31174
57 Ga0068855_100020245 3300005563 Bacteria 7987
58 Ga0070664_100705884 3300005564 Bacteria 940
59 Ga0070702_100029218 3300005615 Bacteria 2995
60 Ga0070702_100030528 3300005615 Bacteria 2939
61 Ga0068852_100493986 3300005616 Bacteria 1218
62 Ga0068859_100000220 3300005617 Bacteria 56619
63 Ga0068859_100039209 3300005617 Bacteria 4752
64 Ga0068859_100649565 3300005617 Bacteria 1147
65 Ga0068864_100035913 3300005618 Bacteria 4221
66 Ga0068864_100566549 3300005618 Bacteria 1099
67 Ga0068864_100752465 3300005618 Bacteria 955
68 Ga0068866_10425103 3300005718 Bacteria 863
69 Ga0068861_100003471 3300005719 Bacteria 10460
70 Ga0068861_100006972 3300005719 Bacteria 7719
71 Ga0068861_100023945 3300005719 Bacteria 4410
72 Ga0068861_100036533 3300005719 Bacteria 3646
73 Ga0068870_10201292 3300005840 Bacteria 1208
74 Ga0068870_10273551 3300005840 Bacteria 1056
75 Ga0068863_100003136 3300005841 Bacteria 16324
76 Ga0068863_100005805 3300005841 Bacteria 12098
77 Ga0068863_100011415 3300005841 Bacteria 8593
78 Ga0068858_100005149 3300005842 Bacteria 12811
79 Ga0068858_100015251 3300005842 Bacteria 7230
80 Ga0068858_100068390 3300005842 Bacteria 3291
81 Ga0068860_100000355 3300005843 Bacteria 61547
82 Ga0068860_100010920 3300005843 Bacteria 8953
83 Ga0068860_100013181 3300005843 Bacteria 8112
84 Ga0068860_100197792 3300005843 Bacteria 1947
85 Ga0068860_100629888 3300005843 Bacteria 1079
86 Ga0068862_100009065 3300005844 Bacteria 8238
87 Ga0068862_100050943 3300005844 Bacteria 3540
88 Ga0068862_100065355 3300005844 Bacteria 3133
89 Ga0068862_100259149 3300005844 Bacteria 1587
90 Ga0068862_100303299 3300005844 Bacteria 1470
91 Ga0081455_10000270 3300005937 Bacteria 68460
92 Ga0081455_10012476 3300005937 Bacteria 8478
93 Ga0097621_100003831 3300006237 Bacteria 10419
94 Ga0097621_100029632 3300006237 Bacteria 4325
95 Ga0097621_100047556 3300006237 Bacteria 3477
96 Ga0068871_100242325 3300006358 Bacteria 1568
97 Ga0068871_100257466 3300006358 Bacteria 1521
98 Ga0075428_100011586 3300006844 Bacteria 9810
99 Ga0075428_100733397 3300006844 Bacteria 1052
100 Ga0075434_100000232 3300006871 Bacteria 38374
101 Ga0068865_100130330 3300006881 Bacteria 1883
102 Ga0097620_100000220 3300006931 Bacteria 56619
103 Ga0097620_100039210 3300006931 Bacteria 4752
104 Ga0097620_100649594 3300006931 Bacteria 1147
105 Ga0105250_10019074 3300009092 Bacteria 2774
106 Ga0105240_10000634 3300009093 Bacteria 64881
107 Ga0105240_10023051 3300009093 Bacteria 8244
108 Ga0105240_10041892 3300009093 Bacteria 5839
109 Ga0105240_10055536 3300009093 Bacteria 4958
110 Ga0105240_10139283 3300009093 Bacteria 2902
111 Ga0111539_10026835 3300009094 Bacteria 7036
112 Ga0111539_10183429 3300009094 Bacteria 2444
113 Ga0105247_10002776 3300009101 Bacteria 11724
114 Ga0105247_10005678 3300009101 Bacteria 7818
115 Ga0114129_10872088 3300009147 Bacteria 1142
116 Ga0105242_10033715 3300009176 Bacteria 4101
117 Ga0105248_10032039 3300009177 Bacteria 5874
118 Ga0105248_10677384 3300009177 Bacteria 1163
119 Ga0105237_10064836 3300009545 Bacteria 3649
120 Ga0105237_10080380 3300009545 Bacteria 3250
121 Ga0105237_10140757 3300009545 Bacteria 2407
122 Ga0105237_10216191 3300009545 Bacteria 1917
123 Ga0105237_10251406 3300009545 Bacteria 1770
124 Ga0105238_10986419 3300009551 Bacteria 863
125 Ga0105249_10015445 3300009553 Bacteria 6758
126 Ga0105249_10046565 3300009553 Unclassified 3947
127 Ga0105249_10416191 3300009553 Bacteria 1377
128 Ga0105239_10016032 3300010375 Bacteria 8292
129 Ga0105239_10842695 3300010375 Bacteria 1051
130 Ga0157369_10070216 3300013105 Bacteria 3763
131 Ga0157369_10078497 3300013105 Bacteria 3537
132 Ga0157374_10402264 3300013296 Unclassified 1366
133 Ga0157374_10527730 3300013296 Bacteria 1187
134 Ga0163162_10032553 3300013306 Bacteria 5179
135 Ga0163162_10056237 3300013306 Bacteria 3963
136 Ga0157372_10758256 3300013307 Bacteria 1128
137 Ga0157375_10028497 3300013308 Bacteria 5235
138 Ga0163163_10021385 3300014325 Bacteria 6104
139 Ga0163163_10150222 3300014325 Bacteria 2374
140 Ga0163163_10150923 3300014325 Bacteria 2367
141 Ga0163163_10365548 3300014325 Bacteria 1499
142 Ga0157380_10108478 3300014326 Bacteria 2327
143 Ga0157380_10313596 3300014326 Bacteria 1451
144 Ga0157380_10416444 3300014326 Bacteria 1280
145 Ga0157379_10001978 3300014968 Bacteria 16948
146 Ga0157379_10047960 3300014968 Bacteria 3812
147 Ga0157379_10240556 3300014968 Unclassified 1642
148 Ga0157379_10669266 3300014968 Bacteria 973
149 Ga0157379_10741806 3300014968 Bacteria 924
150 Ga0157376_10065346 3300014969 Bacteria 3071
151 Ga0157376_10245117 3300014969 Bacteria 1671
152 Ga0157376_10281780 3300014969 Unclassified 1566
153 Ga0163161_10183649 3300017792 Bacteria 1605
154 Ga0207682_10003231 3300025893 Bacteria 7129
155 Ga0207682_10089920 3300025893 Bacteria 1330
156 Ga0207710_10000989 3300025900 Bacteria 14887
157 Ga0207710_10033431 3300025900 Bacteria 2256
158 Ga0207645_10019968 3300025907 Bacteria 4386
159 Ga0207643_10102125 3300025908 Bacteria 1682
160 Ga0207707_10007002 3300025912 Bacteria 9838
161 Ga0207707_10036036 3300025912 Bacteria 4326
162 Ga0207695_10006944 3300025913 Bacteria 14538
163 Ga0207695_10276661 3300025913 Bacteria 1573
164 Ga0207671_10062355 3300025914 Bacteria 2768
165 Ga0207671_10095151 3300025914 Bacteria 2249
166 Ga0207671_10140264 3300025914 Bacteria 1862
167 Ga0207660_10026010 3300025917 Bacteria 3981
168 Ga0207662_10175777 3300025918 Bacteria 1375
169 Ga0207652_10068004 3300025921 Bacteria 3090
170 Ga0207652_10230295 3300025921 Bacteria 1670
171 Ga0207681_10246829 3300025923 Bacteria 1392
172 Ga0207694_10352791 3300025924 Unclassified 1218
173 Ga0207650_10065016 3300025925 Bacteria 2732
174 Ga0207659_10213231 3300025926 Bacteria 1549
175 Ga0207700_10340921 3300025928 Unclassified 1303
176 Ga0207700_10432926 3300025928 Bacteria 1157
177 Ga0207644_10012111 3300025931 Bacteria 5721
178 Ga0207670_10019235 3300025936 Bacteria 4167
179 Ga0207704_10024300 3300025938 Bacteria 3283
180 Ga0207691_10012618 3300025940 Bacteria 8098
181 Ga0207691_10048547 3300025940 Bacteria 3892
182 Ga0207711_10227742 3300025941 Bacteria 1707
183 Ga0207711_10692983 3300025941 Bacteria 950
184 Ga0207689_10039242 3300025942 Bacteria 3920
185 Ga0207689_10352272 3300025942 Bacteria 1224
186 Ga0207661_10370804 3300025944 Bacteria 1294
187 Ga0207679_10125309 3300025945 Bacteria 2052
188 Ga0207667_10001150 3300025949 Bacteria 33284
189 Ga0207667_10151864 3300025949 Bacteria 2383
190 Ga0207667_10300329 3300025949 Bacteria 1640
191 Ga0207651_10062328 3300025960 Bacteria 2598
192 Ga0207651_10586520 3300025960 Bacteria 973
193 Ga0207712_10040012 3300025961 Bacteria 3215
194 Ga0207668_10232312 3300025972 Bacteria 1488
195 Ga0207658_10020181 3300025986 Bacteria 4615
196 Ga0207658_10044212 3300025986 Bacteria 3242
197 Ga0207677_10228929 3300026023 Bacteria 1496
198 Ga0207703_10003459 3300026035 Bacteria 13220
199 Ga0207703_10012274 3300026035 Bacteria 6681
200 Ga0207703_10194859 3300026035 Bacteria 1797
201 Ga0207639_10056508 3300026041 Bacteria 3008
202 Ga0207639_10564949 3300026041 Bacteria 1046
203 Ga0207678_10214377 3300026067 Bacteria 1647
204 Ga0207708_10034933 3300026075 Bacteria 3824
205 Ga0207641_10001484 3300026088 Bacteria 23002
206 Ga0207641_10110945 3300026088 Bacteria 2431
207 Ga0207641_10179234 3300026088 Bacteria 1939
208 Ga0207641_10256545 3300026088 Bacteria 1635
209 Ga0207648_10082439 3300026089 Bacteria 2805
210 Ga0207675_100004090 3300026118 Bacteria 14120
211 Ga0207675_100012590 3300026118 Bacteria 7901
212 Ga0207675_100185355 3300026118 Bacteria 1994
213 Ga0207683_10073397 3300026121 Bacteria 3027
214 Ga0207428_10010554 3300027907 Bacteria 8245
215 Ga0268266_10000702 3300028379 Bacteria 45182
216 Ga0268266_10008042 3300028379 Bacteria 9425
217 Ga0268266_10020212 3300028379 Bacteria 5677
218 Ga0268266_10041721 3300028379 Bacteria 3917
219 Ga0268266_10070213 3300028379 Bacteria 3035
220 Ga0268266_10089800 3300028379 Bacteria 2691
221 Ga0268266_10529403 3300028379 Bacteria 1127
222 Ga0268265_10029541 3300028380 Bacteria 3936
223 Ga0268265_10029594 3300028380 Bacteria 3933
224 Ga0268265_10105179 3300028380 Bacteria 2290
225 Ga0268265_10133571 3300028380 Bacteria 2067
226 Ga0268265_10243343 3300028380 Bacteria 1589
227 Ga0268264_10000085 3300028381 Bacteria 240739
228 Ga0268264_10013944 3300028381 Bacteria 6607
229 Ga0268264_10172165 3300028381 Bacteria 1959
230 Ga0268264_10188734 3300028381 Bacteria 1877
231 Ga0268264_10843747 3300028381 Bacteria 917
232 Ga0307511_10001897 3300030521 Bacteria 21953
233 Ga0307511_10013740 3300030521 Bacteria 7900
234 Ga0265331_10013622 3300031250 Bacteria 4365
235 Ga0307509_10000008 3300031507 Bacteria 354271
236 Ga0307508_10230625 3300031616 Bacteria 1450
237 Ga0316576_10011674 3300031727 Bacteria 5768
238 Ga0316578_10002000 3300031728 Bacteria 8660
239 Ga0307413_10042075 3300031824 Bacteria 2681
240 Ga0307416_100738991 3300032002 Bacteria 1076
241 Ga0307414_10132078 3300032004 Bacteria 1940
242 Ga0307411_10167975 3300032005 Bacteria 1651
243 Ga0307411_10691093 3300032005 Bacteria 887
244 Ga0307510_10000004 3300033180 Bacteria 654130
245 Ga0307510_10056445 3300033180 Bacteria 4089
246 Ga0373923_0032416 3300035111 Bacteria 2111
247 Ga0373936_0000391 3300035113 Bacteria 14885
248 Ga0373936_0022235 3300035113 Bacteria 2469
249 Ga0373955_0032929 3300035172 Bacteria 2726
250 Ga0316574_0056310 3300035398 Bacteria 2460
251 Ga0316574_0315228 3300035398 Bacteria 993
252 Ga0373933_0067625 3300035724 Bacteria 2168
253 Ga0373937_0005493 3300036401 Bacteria 10863
254 Ga0373937_0038359 3300036401 Bacteria 4365
255 Ga0395900_0295757 3300037418 Bacteria 1607
256 Ga0436365_0086931 3300039437 Bacteria 6754
257 Ga0436363_0954335 3300039450 Bacteria 2703
258 Ga0451791_0310099 3300041451 Bacteria 2486
259 Ga0451800_1388597 3300041459 Bacteria 1400
260 Ga0451804_0883722 3300041463 Bacteria 1279
261 Ga0451807_2382065 3300041486 Bacteria 3640
262 Ga0451833_0178066 3300041491 Bacteria 1488
263 Ga0451837_1232143 3300041494 Bacteria 1138
264 Ga0451853_0026066 3300041512 Bacteria 1242
265 Ga0466969_0000845 3300044656 Bacteria 16627
266 Ga0466969_0002836 3300044656 Bacteria 9273
267 Ga0466969_0102610 3300044656 Bacteria 1345
268 Ga0466972_0200407 3300044658 Unclassified 935
269 Ga0466965_0148521 3300044683 Bacteria 1224
270 Ga0466966_0000352 3300044684 Bacteria 29833
271 Ga0466966_0033647 3300044684 Bacteria 3318
272 Ga0466961_0000364 3300044693 Bacteria 29379
273 Ga0466963_0212218 3300044694 Bacteria 1355
274 Ga0466964_0000030 3300044706 Bacteria 29509
275 Ga0466971_0000333 3300044719 Bacteria 18049
276 Ga0466968_0076249 3300044735 Bacteria 1467
277 Ga0466970_0000166 3300044765 Bacteria 31421
278 Ga0466957_0037274 3300044842 Bacteria 2927
279 Ga0466959_0002160 3300045049 Bacteria 12495
280 Ga0466959_0011735 3300045049 Bacteria 6305
281 Ga0466959_0322383 3300045049 Bacteria 1056
282 Ga0466959_0324445 3300045049 Bacteria 1052
283 Ga0466958_0049694 3300045836 Bacteria 2538
284 Ga0466958_0227859 3300045836 Bacteria 1190
285 Ga0466967_0625255 3300045976 Unclassified 1064
286 Ga0495590_0003552 3300046457 Bacteria 6350
287 Ga0495638_0077968 3300046460 Bacteria 2016
288 Ga0495580_0067558 3300046472 Bacteria 2501
289 Ga0495584_0043891 3300046491 Bacteria 2257
290 Ga0495585_0104557 3300046492 Bacteria 1511
291 Ga0495606_0049113 3300046507 Bacteria 2770
292 Ga0495606_0151249 3300046507 Unclassified 1362
293 Ga0495616_0017043 3300046513 Bacteria 4010
294 Ga0495632_0050802 3300046519 Bacteria 2043
295 Ga0495644_0103340 3300046523 Bacteria 1079
296 Ga0495648_0023117 3300046524 Bacteria 4264
297 Ga0495668_0037796 3300046616 Bacteria 2700
298 Ga0495625_0130580 3300046660 Bacteria 1702
299 Ga0495623_0061591 3300046679 Bacteria 2353
300 Ga0495604_0099431 3300047317 Bacteria 2141
301 Ga0495674_0564203 3300047319 Bacteria 905
302 Ga0495687_037498 3300047443 Bacteria 2159
303 Ga0495687_039837 3300047443 Unclassified 2076
304 Ga0495686_0136440 3300047472 Bacteria 1451
305 Ga0495602_0340135 3300048088 Bacteria 1086
306 Ga0495615_0020217 3300048090 Bacteria 1489
307 Ga0495626_0086788 3300048091 Bacteria 1382
308 Ga0496100_0048363 3300048903 Bacteria 2745
309 Ga0496102_0008758 3300048905 Bacteria 8681
310 Ga0496102_0040203 3300048905 Bacteria 4229
311 Ga0496103_0111605 3300048906 Bacteria 1737
312 Ga0496104_0431518 3300048907 Bacteria 1230
313 Ga0496106_0110375 3300048909 Bacteria 2141
314 Ga0496108_0275770 3300048911 Bacteria 1464
315 Ga0496112_0085475 3300048915 Bacteria 3121
316 Ga0496116_0052765 3300048919 Bacteria 2691
317 Ga0496117_0000251 3300048920 Bacteria 101431
318 Ga0496118_0000611 3300048921 Bacteria 58835
319 Ga0496118_0152927 3300048921 Bacteria 1441
320 Ga0496119_0000965 3300048922 Bacteria 36888
321 Ga0496120_0000025 3300048923 Bacteria 235805
322 Ga0496120_0025498 3300048923 Bacteria 3668
323 Ga0496121_0002537 3300048924 Bacteria 27677
324 Ga0496121_0023028 3300048924 Bacteria 6018
325 Ga0496124_0330670 3300048927 Bacteria 1087
326 Ga0496125_0002047 3300048928 Bacteria 27258
327 Ga0496125_0014480 3300048928 Bacteria 7680
328 Ga0496125_0035367 3300048928 Bacteria 4383
329 Ga0496125_0122983 3300048928 Bacteria 1846
330 Ga0496126_0001746 3300048929 Bacteria 32210
331 Ga0496126_0026171 3300048929 Bacteria 5599
332 Ga0496126_0271233 3300048929 Bacteria 1408
333 Ga0496126_0362980 3300048929 Bacteria 1182
334 Ga0501037_0078366 3300049573 Bacteria 2398
335 Ga0501041_0225238 3300049577 Bacteria 1177
336 Ga0501042_0013714 3300049578 Bacteria 5520
337 Ga0501042_0130937 3300049578 Bacteria 1808
338 Ga0501068_0310156 3300049584 Bacteria 1011
339 Ga0501069_0231706 3300049585 Bacteria 1075
340 Ga0501070_0026878 3300049586 Bacteria 4827
341 Ga0501071_0377650 3300049587 Bacteria 1080
342 Ga0501074_0095937 3300049590 Bacteria 2124
343 Ga0501077_0271126 3300049593 Bacteria 1080
344 Ga0501079_0023673 3300049741 Bacteria 4712
345 Ga0501081_0215515 3300049743 Bacteria 1395
346 Ga0501083_0241221 3300049744 Bacteria 1177
347 Ga0501083_0246614 3300049744 Bacteria 1163
348 Ga0501045_0089427 3300049824 Bacteria 2275
349 Ga0501045_0158432 3300049824 Bacteria 1685
350 nmdc:mga0qj67_638591_c1 3300050509 Bacteria 850
351 nmdc:mga08y16_1352_c2 3300050511 Bacteria 15858
352 nmdc:mga08y16_173204_c1 3300050511 Bacteria 2241
353 nmdc:mga0n895_2080_c1 3300050512 Bacteria 15412
354 nmdc:mga0rr50_131786_c1 3300050513 Bacteria 2002
355 nmdc:mga0a205_1796_c1 3300050515 Bacteria 18545
356 Ga0500558_160643 3300053106 Bacteria 824
357 Ga0500588_0001250 3300053146 Bacteria 4734
358 Ga0500637_0005121 3300053178 Bacteria 6315
359 Ga0500637_0223612 3300053178 Bacteria 1063
360 Ga0501084_0279652 3300054114 Bacteria 1409
361 Ga0501082_0050831 3300060353 Bacteria 3574
362 Ga0466962_0000084 3300061719 Bacteria 37853
363 Ga0530510_0468928 3300061734 Bacteria 953

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049573 Ga0501037_0078366 Ga0501037_0078366_228_1034 224
2 3300049590 Ga0501074_0095937 Ga0501074_0095937_1112_1918 224
3 3300049741 Ga0501079_0023673 Ga0501079_0023673_506_1312 224
4 3300049824 Ga0501045_0089427 Ga0501045_0089427_1388_2194 224
5 3300060353 Ga0501082_0050831 Ga0501082_0050831_2738_3517 224
6 3300049584 Ga0501068_0310156 Ga0501068_0310156_67_873 225
7 3300061734 Ga0530510_0468928 Ga0530510_0468928_60_866 225
8 3300009094 Ga0111539_10026835 Ga0111539_100268355 229
9 3300050511 nmdc:mga08y16_173204_c1 nmdc:mga08y16_173204_c1_1362_2075 229
10 3300050513 nmdc:mga0rr50_131786_c1 nmdc:mga0rr50_131786_c1_1175_1960 229
11 3300046616 Ga0495668_0037796 Ga0495668_0037796_10_720 235
12 3300048922 Ga0496119_0000965 Ga0496119_0000965_33843_34550 235
13 3300048923 Ga0496120_0000025 Ga0496120_0000025_13690_14397 235
14 3300048929 Ga0496126_0362980 Ga0496126_0362980_42_749 235
15 3300050509 nmdc:mga0qj67_638591_c1 nmdc:mga0qj67_638591_c1_17_730 236
16 3300049577 Ga0501041_0225238 Ga0501041_0225238_11_799 237
17 3300049743 Ga0501081_0215515 Ga0501081_0215515_127_915 237
18 3300049744 Ga0501083_0246614 Ga0501083_0246614_364_1152 237
19 3300041463 Ga0451804_0883722 Ga0451804_0883722_344_1111 243
20 3300006871 Ga0075434_100000232 Ga0075434_10000023229 244
21 3300009094 Ga0111539_10183429 Ga0111539_101834292 244
22 3300050512 nmdc:mga0n895_2080_c1 nmdc:mga0n895_2080_c1_6342_7112 244
23 3300050515 nmdc:mga0a205_1796_c1 nmdc:mga0a205_1796_c1_14509_15279 244
24 3300025942 Ga0207689_10352272 Ga0207689_103522722 251
25 3300005334 Ga0068869_100276486 Ga0068869_1002764862 252
26 3300005340 Ga0070689_100004301 Ga0070689_1000043012 252
27 3300005341 Ga0070691_10243913 Ga0070691_102439131 252
28 3300005438 Ga0070701_10009685 Ga0070701_100096853 252
29 3300005440 Ga0070705_100060499 Ga0070705_1000604992 252
30 3300005445 Ga0070708_100480703 Ga0070708_1004807032 252
31 3300005466 Ga0070685_10208594 Ga0070685_102085942 252
32 3300005544 Ga0070686_100001885 Ga0070686_1000018853 252
33 3300005547 Ga0070693_100062416 Ga0070693_1000624162 252
34 3300005549 Ga0070704_100053848 Ga0070704_1000538483 252
35 3300005564 Ga0070664_100705884 Ga0070664_1007058842 252
36 3300005615 Ga0070702_100029218 Ga0070702_1000292182 252
37 3300005615 Ga0070702_100030528 Ga0070702_1000305282 252
38 3300005617 Ga0068859_100039209 Ga0068859_1000392095 252
39 3300005618 Ga0068864_100035913 Ga0068864_1000359134 252
40 3300005719 Ga0068861_100003471 Ga0068861_1000034717 252
41 3300005719 Ga0068861_100006972 Ga0068861_1000069725 252
42 3300005842 Ga0068858_100068390 Ga0068858_1000683901 252
43 3300005843 Ga0068860_100013181 Ga0068860_1000131815 252
44 3300005844 Ga0068862_100009065 Ga0068862_10000906510 252
45 3300006237 Ga0097621_100003831 Ga0097621_1000038312 252
46 3300006931 Ga0097620_100039210 Ga0097620_1000392105 252
47 3300009551 Ga0105238_10986419 Ga0105238_109864192 252
48 3300009553 Ga0105249_10416191 Ga0105249_104161912 252
49 3300014969 Ga0157376_10245117 Ga0157376_102451172 252
50 3300025936 Ga0207670_10019235 Ga0207670_100192353 252
51 3300025945 Ga0207679_10125309 Ga0207679_101253091 252
52 3300026035 Ga0207703_10194859 Ga0207703_101948592 252
53 3300026118 Ga0207675_100004090 Ga0207675_1000040907 252
54 3300026118 Ga0207675_100012590 Ga0207675_1000125905 252
55 3300028380 Ga0268265_10029541 Ga0268265_100295414 252
56 3300035172 Ga0373955_0032929 Ga0373955_0032929_1136_1897 252
57 3300036401 Ga0373937_0038359 Ga0373937_0038359_3183_3944 252
58 3300041451 Ga0451791_0310099 Ga0451791_0310099_1389_2150 252
59 3300041459 Ga0451800_1388597 Ga0451800_1388597_320_1081 252
60 3300041486 Ga0451807_2382065 Ga0451807_2382065_321_1097 252
61 3300041491 Ga0451833_0178066 Ga0451833_0178066_85_846 252
62 3300041494 Ga0451837_1232143 Ga0451837_1232143_299_1060 252
63 3300041512 Ga0451853_0026066 Ga0451853_0026066_375_1136 252
64 3300046457 Ga0495590_0003552 Ga0495590_0003552_4568_5329 252
65 3300046460 Ga0495638_0077968 Ga0495638_0077968_997_1758 252
66 3300046491 Ga0495584_0043891 Ga0495584_0043891_1177_1938 252
67 3300046492 Ga0495585_0104557 Ga0495585_0104557_295_1056 252
68 3300046513 Ga0495616_0017043 Ga0495616_0017043_1465_2226 252
69 3300046660 Ga0495625_0130580 Ga0495625_0130580_448_1209 252
70 3300048091 Ga0495626_0086788 Ga0495626_0086788_269_1030 252
71 3300005328 Ga0070676_10020068 Ga0070676_100200682 253
72 3300005331 Ga0070670_100442181 Ga0070670_1004421812 253
73 3300005333 Ga0070677_10014355 Ga0070677_100143553 253
74 3300005337 Ga0070682_100048353 Ga0070682_1000483532 253
75 3300005337 Ga0070682_100104129 Ga0070682_1001041292 253
76 3300005337 Ga0070682_100108734 Ga0070682_1001087342 253
77 3300005340 Ga0070689_100682415 Ga0070689_1006824151 253
78 3300005343 Ga0070687_100197778 Ga0070687_1001977782 253
79 3300005347 Ga0070668_100320079 Ga0070668_1003200792 253
80 3300005353 Ga0070669_100388389 Ga0070669_1003883892 253
81 3300005356 Ga0070674_100080915 Ga0070674_1000809152 253
82 3300005364 Ga0070673_100501868 Ga0070673_1005018682 253
83 3300005441 Ga0070700_100059055 Ga0070700_1000590553 253
84 3300005456 Ga0070678_100520926 Ga0070678_1005209261 253
85 3300005459 Ga0068867_100078949 Ga0068867_1000789491 253
86 3300005548 Ga0070665_100135448 Ga0070665_1001354482 253
87 3300005617 Ga0068859_100649565 Ga0068859_1006495652 253
88 3300005618 Ga0068864_100566549 Ga0068864_1005665492 253
89 3300005718 Ga0068866_10425103 Ga0068866_104251031 253
90 3300005719 Ga0068861_100036533 Ga0068861_1000365333 253
91 3300005840 Ga0068870_10201292 Ga0068870_102012921 253
92 3300005841 Ga0068863_100011415 Ga0068863_1000114155 253
93 3300005844 Ga0068862_100303299 Ga0068862_1003032992 253
94 3300006237 Ga0097621_100047556 Ga0097621_1000475564 253
95 3300006358 Ga0068871_100257466 Ga0068871_1002574662 253
96 3300006881 Ga0068865_100130330 Ga0068865_1001303302 253
97 3300006931 Ga0097620_100649594 Ga0097620_1006495942 253
98 3300009176 Ga0105242_10033715 Ga0105242_100337151 253
99 3300009177 Ga0105248_10677384 Ga0105248_106773842 253
100 3300013306 Ga0163162_10056237 Ga0163162_100562372 253
101 3300013308 Ga0157375_10028497 Ga0157375_100284973 253
102 3300014326 Ga0157380_10108478 Ga0157380_101084782 253
103 3300014326 Ga0157380_10313596 Ga0157380_103135962 253
104 3300014968 Ga0157379_10669266 Ga0157379_106692661 253
105 3300014969 Ga0157376_10065346 Ga0157376_100653463 253
106 3300017792 Ga0163161_10183649 Ga0163161_101836492 253
107 3300025893 Ga0207682_10003231 Ga0207682_100032317 253
108 3300025893 Ga0207682_10089920 Ga0207682_100899202 253
109 3300025907 Ga0207645_10019968 Ga0207645_100199683 253
110 3300025908 Ga0207643_10102125 Ga0207643_101021252 253
111 3300025918 Ga0207662_10175777 Ga0207662_101757772 253
112 3300025923 Ga0207681_10246829 Ga0207681_102468292 253
113 3300025926 Ga0207659_10213231 Ga0207659_102132312 253
114 3300025938 Ga0207704_10024300 Ga0207704_100243002 253
115 3300025940 Ga0207691_10012618 Ga0207691_100126187 253
116 3300025940 Ga0207691_10048547 Ga0207691_100485473 253
117 3300025941 Ga0207711_10692983 Ga0207711_106929831 253
118 3300025942 Ga0207689_10039242 Ga0207689_100392425 253
119 3300025960 Ga0207651_10062328 Ga0207651_100623283 253
120 3300025960 Ga0207651_10586520 Ga0207651_105865202 253
121 3300026023 Ga0207677_10228929 Ga0207677_102289292 253
122 3300026041 Ga0207639_10564949 Ga0207639_105649491 253
123 3300026067 Ga0207678_10214377 Ga0207678_102143772 253
124 3300026075 Ga0207708_10034933 Ga0207708_100349332 253
125 3300026088 Ga0207641_10110945 Ga0207641_101109452 253
126 3300026088 Ga0207641_10256545 Ga0207641_102565452 253
127 3300026089 Ga0207648_10082439 Ga0207648_100824393 253
128 3300026118 Ga0207675_100185355 Ga0207675_1001853552 253
129 3300026121 Ga0207683_10073397 Ga0207683_100733972 253
130 3300028379 Ga0268266_10020212 Ga0268266_100202122 253
131 3300028380 Ga0268265_10105179 Ga0268265_101051792 253
132 3300028381 Ga0268264_10172165 Ga0268264_101721652 253
133 3300031824 Ga0307413_10042075 Ga0307413_100420753 253
134 3300032004 Ga0307414_10132078 Ga0307414_101320782 253
135 3300032005 Ga0307411_10167975 Ga0307411_101679752 253
136 3300032005 Ga0307411_10691093 Ga0307411_106910931 253
137 3300035398 Ga0316574_0056310 Ga0316574_0056310_1293_2060 253
138 3300035398 Ga0316574_0315228 Ga0316574_0315228_16_795 253
139 3300046523 Ga0495644_0103340 Ga0495644_0103340_140_904 253
140 3300047472 Ga0495686_0136440 Ga0495686_0136440_152_916 253
141 3300048088 Ga0495602_0340135 Ga0495602_0340135_136_900 253
142 3300048090 Ga0495615_0020217 Ga0495615_0020217_672_1436 253
143 3300048907 Ga0496104_0431518 Ga0496104_0431518_241_1005 253
144 3300049578 Ga0501042_0013714 Ga0501042_0013714_3135_3899 253
145 3300049585 Ga0501069_0231706 Ga0501069_0231706_110_886 253
146 3300049587 Ga0501071_0377650 Ga0501071_0377650_258_1022 253
147 3300049593 Ga0501077_0271126 Ga0501077_0271126_166_942 253
148 3300049824 Ga0501045_0158432 Ga0501045_0158432_654_1430 253
149 3300005343 Ga0070687_100228173 Ga0070687_1002281731 254
150 3300005458 Ga0070681_10005500 Ga0070681_100055004 254
151 3300005530 Ga0070679_100026915 Ga0070679_1000269152 254
152 3300005548 Ga0070665_100038265 Ga0070665_1000382655 254
153 3300005844 Ga0068862_100259149 Ga0068862_1002591491 254
154 3300005937 Ga0081455_10012476 Ga0081455_100124764 254
155 3300006358 Ga0068871_100242325 Ga0068871_1002423252 254
156 3300006844 Ga0075428_100011586 Ga0075428_1000115864 254
157 3300006844 Ga0075428_100733397 Ga0075428_1007333972 254
158 3300009147 Ga0114129_10872088 Ga0114129_108720882 254
159 3300025912 Ga0207707_10007002 Ga0207707_100070024 254
160 3300025921 Ga0207652_10230295 Ga0207652_102302952 254
161 3300027907 Ga0207428_10010554 Ga0207428_100105546 254
162 3300028379 Ga0268266_10529403 Ga0268266_105294032 254
163 3300028380 Ga0268265_10133571 Ga0268265_101335712 254
164 3300031727 Ga0316576_10011674 Ga0316576_100116746 254
165 3300031728 Ga0316578_10002000 Ga0316578_100020008 254
166 3300032002 Ga0307416_100738991 Ga0307416_1007389912 254
167 3300035111 Ga0373923_0032416 Ga0373923_0032416_537_1304 254
168 3300035724 Ga0373933_0067625 Ga0373933_0067625_283_1050 254
169 3300044656 Ga0466969_0002836 Ga0466969_0002836_5681_6448 254
170 3300044658 Ga0466972_0200407 Ga0466972_0200407_87_854 254
171 3300044684 Ga0466966_0033647 Ga0466966_0033647_1633_2400 254
172 3300049578 Ga0501042_0130937 Ga0501042_0130937_130_900 254
173 3300049586 Ga0501070_0026878 Ga0501070_0026878_377_1162 254
174 3300050511 nmdc:mga08y16_1352_c2 nmdc:mga08y16_1352_c2_12540_13310 254
175 3300005329 Ga0070683_100157325 Ga0070683_1001573252 255
176 3300005336 Ga0070680_100023397 Ga0070680_1000233975 255
177 3300005354 Ga0070675_100118663 Ga0070675_1001186633 255
178 3300005355 Ga0070671_100001010 Ga0070671_1000010104 255
179 3300005367 Ga0070667_100010926 Ga0070667_1000109264 255
180 3300005434 Ga0070709_10077812 Ga0070709_100778122 255
181 3300005436 Ga0070713_100145205 Ga0070713_1001452052 255
182 3300005436 Ga0070713_100672957 Ga0070713_1006729571 255
183 3300005436 Ga0070713_100706386 Ga0070713_1007063861 255
184 3300005458 Ga0070681_10144066 Ga0070681_101440662 255
185 3300005530 Ga0070679_100070499 Ga0070679_1000704994 255
186 3300005535 Ga0070684_100016127 Ga0070684_1000161277 255
187 3300005548 Ga0070665_100002877 Ga0070665_1000028773 255
188 3300005548 Ga0070665_100006965 Ga0070665_10000696512 255
189 3300005548 Ga0070665_100009367 Ga0070665_1000093678 255
190 3300005549 Ga0070704_100037435 Ga0070704_1000374352 255
191 3300005563 Ga0068855_100001279 Ga0068855_10000127912 255
192 3300005617 Ga0068859_100000220 Ga0068859_1000002207 255
193 3300005618 Ga0068864_100752465 Ga0068864_1007524651 255
194 3300005840 Ga0068870_10273551 Ga0068870_102735512 255
195 3300005841 Ga0068863_100005805 Ga0068863_1000058056 255
196 3300005842 Ga0068858_100005149 Ga0068858_1000051495 255
197 3300005843 Ga0068860_100010920 Ga0068860_1000109202 255
198 3300006237 Ga0097621_100029632 Ga0097621_1000296322 255
199 3300006931 Ga0097620_100000220 Ga0097620_1000002207 255
200 3300009092 Ga0105250_10019074 Ga0105250_100190742 255
201 3300009093 Ga0105240_10000634 Ga0105240_1000063453 255
202 3300009093 Ga0105240_10139283 Ga0105240_101392833 255
203 3300009101 Ga0105247_10002776 Ga0105247_1000277610 255
204 3300009177 Ga0105248_10032039 Ga0105248_100320393 255
205 3300009545 Ga0105237_10064836 Ga0105237_100648362 255
206 3300009545 Ga0105237_10216191 Ga0105237_102161912 255
207 3300009545 Ga0105237_10251406 Ga0105237_102514062 255
208 3300009553 Ga0105249_10015445 Ga0105249_100154457 255
209 3300013105 Ga0157369_10078497 Ga0157369_100784972 255
210 3300013296 Ga0157374_10527730 Ga0157374_105277302 255
211 3300013307 Ga0157372_10758256 Ga0157372_107582562 255
212 3300014325 Ga0163163_10021385 Ga0163163_100213854 255
213 3300014325 Ga0163163_10150923 Ga0163163_101509232 255
214 3300014326 Ga0157380_10416444 Ga0157380_104164442 255
215 3300014968 Ga0157379_10001978 Ga0157379_1000197814 255
216 3300014969 Ga0157376_10281780 Ga0157376_102817802 255
217 3300025900 Ga0207710_10000989 Ga0207710_100009898 255
218 3300025912 Ga0207707_10036036 Ga0207707_100360364 255
219 3300025913 Ga0207695_10006944 Ga0207695_100069448 255
220 3300025913 Ga0207695_10276661 Ga0207695_102766612 255
221 3300025914 Ga0207671_10062355 Ga0207671_100623553 255
222 3300025914 Ga0207671_10140264 Ga0207671_101402642 255
223 3300025917 Ga0207660_10026010 Ga0207660_100260103 255
224 3300025921 Ga0207652_10068004 Ga0207652_100680043 255
225 3300025928 Ga0207700_10340921 Ga0207700_103409212 255
226 3300025928 Ga0207700_10432926 Ga0207700_104329262 255
227 3300025931 Ga0207644_10012111 Ga0207644_100121114 255
228 3300025949 Ga0207667_10001150 Ga0207667_1000115022 255
229 3300025961 Ga0207712_10040012 Ga0207712_100400122 255
230 3300025986 Ga0207658_10020181 Ga0207658_100201812 255
231 3300026035 Ga0207703_10012274 Ga0207703_100122744 255
232 3300026088 Ga0207641_10179234 Ga0207641_101792342 255
233 3300028379 Ga0268266_10000702 Ga0268266_1000070228 255
234 3300028379 Ga0268266_10008042 Ga0268266_1000804211 255
235 3300028381 Ga0268264_10013944 Ga0268264_100139442 255
236 3300030521 Ga0307511_10001897 Ga0307511_1000189714 255
237 3300031250 Ga0265331_10013622 Ga0265331_100136222 255
238 3300036401 Ga0373937_0005493 Ga0373937_0005493_6719_7489 255
239 3300037418 Ga0395900_0295757 Ga0395900_0295757_356_1129 255
240 3300044656 Ga0466969_0102610 Ga0466969_0102610_536_1306 255
241 3300044694 Ga0466963_0212218 Ga0466963_0212218_382_1155 255
242 3300045049 Ga0466959_0011735 Ga0466959_0011735_1085_1855 255
243 3300045049 Ga0466959_0322383 Ga0466959_0322383_106_876 255
244 3300045049 Ga0466959_0324445 Ga0466959_0324445_231_1001 255
245 3300045836 Ga0466958_0227859 Ga0466958_0227859_173_943 255
246 3300045976 Ga0466967_0625255 Ga0466967_0625255_46_819 255
247 3300046472 Ga0495580_0067558 Ga0495580_0067558_760_1530 255
248 3300046679 Ga0495623_0061591 Ga0495623_0061591_1177_1947 255
249 3300047317 Ga0495604_0099431 Ga0495604_0099431_104_874 255
250 3300048903 Ga0496100_0048363 Ga0496100_0048363_1788_2558 255
251 3300048905 Ga0496102_0040203 Ga0496102_0040203_3250_4020 255
252 3300048909 Ga0496106_0110375 Ga0496106_0110375_317_1087 255
253 3300048915 Ga0496112_0085475 Ga0496112_0085475_658_1428 255
254 3300048924 Ga0496121_0002537 Ga0496121_0002537_22073_22843 255
255 3300048927 Ga0496124_0330670 Ga0496124_0330670_88_858 255
256 3300048928 Ga0496125_0014480 Ga0496125_0014480_5333_6103 255
257 3300048928 Ga0496125_0122983 Ga0496125_0122983_571_1341 255
258 3300048929 Ga0496126_0001746 Ga0496126_0001746_28001_28771 255
259 3300048929 Ga0496126_0271233 Ga0496126_0271233_45_815 255
260 3300054114 Ga0501084_0279652 Ga0501084_0279652_346_1116 255
261 3300003316 rootH1_10009453 rootH1_100094532 256
262 3300003323 rootH1_10138102 rootH1_101381024 256
263 3300005329 Ga0070683_100109685 Ga0070683_1001096852 256
264 3300005367 Ga0070667_100314712 Ga0070667_1003147122 256
265 3300005435 Ga0070714_100236142 Ga0070714_1002361422 256
266 3300005455 Ga0070663_100098181 Ga0070663_1000981812 256
267 3300005548 Ga0070665_100057889 Ga0070665_1000578892 256
268 3300005548 Ga0070665_100122857 Ga0070665_1001228572 256
269 3300005548 Ga0070665_100255976 Ga0070665_1002559762 256
270 3300005563 Ga0068855_100020245 Ga0068855_1000202454 256
271 3300005616 Ga0068852_100493986 Ga0068852_1004939862 256
272 3300005719 Ga0068861_100023945 Ga0068861_1000239453 256
273 3300005841 Ga0068863_100003136 Ga0068863_10000313612 256
274 3300005842 Ga0068858_100015251 Ga0068858_1000152516 256
275 3300005843 Ga0068860_100000355 Ga0068860_1000003552 256
276 3300005843 Ga0068860_100197792 Ga0068860_1001977921 256
277 3300005843 Ga0068860_100629888 Ga0068860_1006298882 256
278 3300005844 Ga0068862_100050943 Ga0068862_1000509431 256
279 3300005844 Ga0068862_100065355 Ga0068862_1000653552 256
280 3300005937 Ga0081455_10000270 Ga0081455_1000027058 256
281 3300009093 Ga0105240_10023051 Ga0105240_100230513 256
282 3300009093 Ga0105240_10041892 Ga0105240_100418926 256
283 3300009093 Ga0105240_10055536 Ga0105240_100555362 256
284 3300009101 Ga0105247_10005678 Ga0105247_100056781 256
285 3300009545 Ga0105237_10080380 Ga0105237_100803803 256
286 3300009545 Ga0105237_10140757 Ga0105237_101407572 256
287 3300009553 Ga0105249_10046565 Ga0105249_100465652 256
288 3300010375 Ga0105239_10016032 Ga0105239_100160325 256
289 3300010375 Ga0105239_10842695 Ga0105239_108426951 256
290 3300013105 Ga0157369_10070216 Ga0157369_100702164 256
291 3300013296 Ga0157374_10402264 Ga0157374_104022642 256
292 3300013306 Ga0163162_10032553 Ga0163162_100325535 256
293 3300014325 Ga0163163_10150222 Ga0163163_101502223 256
294 3300014325 Ga0163163_10365548 Ga0163163_103655481 256
295 3300014968 Ga0157379_10047960 Ga0157379_100479604 256
296 3300014968 Ga0157379_10240556 Ga0157379_102405562 256
297 3300014968 Ga0157379_10741806 Ga0157379_107418061 256
298 3300025900 Ga0207710_10033431 Ga0207710_100334312 256
299 3300025914 Ga0207671_10095151 Ga0207671_100951511 256
300 3300025924 Ga0207694_10352791 Ga0207694_103527912 256
301 3300025925 Ga0207650_10065016 Ga0207650_100650162 256
302 3300025941 Ga0207711_10227742 Ga0207711_102277422 256
303 3300025944 Ga0207661_10370804 Ga0207661_103708041 256
304 3300025949 Ga0207667_10151864 Ga0207667_101518642 256
305 3300025949 Ga0207667_10300329 Ga0207667_103003292 256
306 3300025972 Ga0207668_10232312 Ga0207668_102323122 256
307 3300025986 Ga0207658_10044212 Ga0207658_100442123 256
308 3300026035 Ga0207703_10003459 Ga0207703_1000345911 256
309 3300026041 Ga0207639_10056508 Ga0207639_100565082 256
310 3300026088 Ga0207641_10001484 Ga0207641_1000148415 256
311 3300028379 Ga0268266_10041721 Ga0268266_100417214 256
312 3300028379 Ga0268266_10070213 Ga0268266_100702132 256
313 3300028379 Ga0268266_10089800 Ga0268266_100898003 256
314 3300028380 Ga0268265_10029594 Ga0268265_100295945 256
315 3300028380 Ga0268265_10243343 Ga0268265_102433432 256
316 3300028381 Ga0268264_10000085 Ga0268264_1000008547 256
317 3300028381 Ga0268264_10188734 Ga0268264_101887341 256
318 3300028381 Ga0268264_10843747 Ga0268264_108437471 256
319 3300030521 Ga0307511_10013740 Ga0307511_100137404 256
320 3300031507 Ga0307509_10000008 Ga0307509_10000008193 256
321 3300031616 Ga0307508_10230625 Ga0307508_102306252 256
322 3300033180 Ga0307510_10000004 Ga0307510_10000004198 256
323 3300033180 Ga0307510_10056445 Ga0307510_100564452 256
324 3300035113 Ga0373936_0000391 Ga0373936_0000391_11710_12528 256
325 3300035113 Ga0373936_0022235 Ga0373936_0022235_686_1465 256
326 3300039437 Ga0436365_0086931 Ga0436365_0086931_5311_6087 256
327 3300039450 Ga0436363_0954335 Ga0436363_0954335_1252_2028 256
328 3300044656 Ga0466969_0000845 Ga0466969_0000845_14242_15033 256
329 3300044683 Ga0466965_0148521 Ga0466965_0148521_123_914 256
330 3300044684 Ga0466966_0000352 Ga0466966_0000352_19615_20406 256
331 3300044693 Ga0466961_0000364 Ga0466961_0000364_1067_1858 256
332 3300044706 Ga0466964_0000030 Ga0466964_0000030_3766_4557 256
333 3300044719 Ga0466971_0000333 Ga0466971_0000333_4371_5162 256
334 3300044735 Ga0466968_0076249 Ga0466968_0076249_165_956 256
335 3300044765 Ga0466970_0000166 Ga0466970_0000166_4533_5324 256
336 3300044842 Ga0466957_0037274 Ga0466957_0037274_543_1334 256
337 3300045049 Ga0466959_0002160 Ga0466959_0002160_9882_10673 256
338 3300045836 Ga0466958_0049694 Ga0466958_0049694_55_846 256
339 3300046507 Ga0495606_0049113 Ga0495606_0049113_1543_2313 256
340 3300046507 Ga0495606_0151249 Ga0495606_0151249_106_906 256
341 3300046519 Ga0495632_0050802 Ga0495632_0050802_691_1461 256
342 3300046524 Ga0495648_0023117 Ga0495648_0023117_918_1688 256
343 3300047319 Ga0495674_0564203 Ga0495674_0564203_56_874 256
344 3300047443 Ga0495687_037498 Ga0495687_037498_377_1195 256
345 3300047443 Ga0495687_039837 Ga0495687_039837_723_1523 256
346 3300048905 Ga0496102_0008758 Ga0496102_0008758_6630_7400 256
347 3300048906 Ga0496103_0111605 Ga0496103_0111605_79_849 256
348 3300048911 Ga0496108_0275770 Ga0496108_0275770_317_1087 256
349 3300048919 Ga0496116_0052765 Ga0496116_0052765_1313_2083 256
350 3300048920 Ga0496117_0000251 Ga0496117_0000251_45154_45924 256
351 3300048921 Ga0496118_0000611 Ga0496118_0000611_55752_56522 256
352 3300048921 Ga0496118_0152927 Ga0496118_0152927_265_1035 256
353 3300048923 Ga0496120_0025498 Ga0496120_0025498_2574_3344 256
354 3300048924 Ga0496121_0023028 Ga0496121_0023028_4188_4958 256
355 3300048928 Ga0496125_0002047 Ga0496125_0002047_7033_7803 256
356 3300048928 Ga0496125_0035367 Ga0496125_0035367_137_907 256
357 3300048929 Ga0496126_0026171 Ga0496126_0026171_3987_4757 256
358 3300049744 Ga0501083_0241221 Ga0501083_0241221_352_1131 256
359 3300053106 Ga0500558_160643 Ga0500558_160643_30_800 256
360 3300053146 Ga0500588_0001250 Ga0500588_0001250_3373_4149 256
361 3300053178 Ga0500637_0005121 Ga0500637_0005121_3839_4657 256
362 3300053178 Ga0500637_0223612 Ga0500637_0223612_37_816 256
363 3300061719 Ga0466962_0000084 Ga0466962_0000084_12309_13100 256

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00290

Trp_syntA

Tryptophan synthase alpha chain

12

261

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5tcf-assembly2.cif.gz_E crystal structure of tryptophan synthase from m. tuberculosis - ligand-free form 0.9384 7 252
5tch-assembly2.cif.gz_G crystal structure of tryptophan synthase from m. tuberculosis - ligand-free form, trpa-g66v mutant 0.9344 7 252
6e9p-assembly2.cif.gz_C crystal structure of tryptophan synthase from m. tuberculosis - open form with brd0059 bound 0.9343 6 252
6uap-assembly2.cif.gz_C crystal structure of tryptophan synthase from m. tuberculosis - open form with brd6309 bound 0.9321 7 252
1wdw-assembly2.cif.gz_E structural basis of mutual activation of the tryptophan synthase a2b2 complex from a hyperthermophile, pyrococcus furiosus 0.9315 19 252
ID Description Score Start End Superfamily
af_A0A1D8PMH6_3_266_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9388 6 252 3.20.20.70
6du1C00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9321 7 252 3.20.20.70
1wdwE00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9315 19 252 3.20.20.70
af_Q2FYR3_1_242_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9268 19 252 3.20.20.70
5kinA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9227 7 256 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A523MJK9-F1-model_v4 Tryptophan synthase alpha chain (EC 4.2.1.20) 0.9824 1 253 GO:0004834
GO:0005829
GO:0006568
AF-A0A523LWJ8-F1-model_v4 Tryptophan synthase alpha chain (EC 4.2.1.20) 0.9773 1 253 GO:0004834
GO:0005829
GO:0006568
AF-A0A2E6E5G9-F1-model_v4 Tryptophan synthase alpha chain (EC 4.2.1.20) 0.9745 1 253 GO:0004834
GO:0005829
GO:0006568
AF-A0A523MJK9-F1-model_v4 Tryptophan synthase alpha chain (EC 4.2.1.20) 0.9673 1 253 GO:0004834
GO:0005829
GO:0006568
AF-A0A523LWJ8-F1-model_v4 Tryptophan synthase alpha chain (EC 4.2.1.20) 0.9659 1 253 GO:0004834
GO:0005829
GO:0006568

Feature Viewer

pLDDT pTM Quality
92.85 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map