F423014

General Info

Members Datasets Scaffolds Average Seq Length
363 189 726 249

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100100745|Ga0307408_1001007452
Length 241
Sequence MERYKNLHLWMIIPMAIMQIGIFYDYWGDLTENAWSVHIHYWTATLWYVYLIIQPYYATRNKLEKHRTNGIIGFFLAGGVAMTALSALHRDIVNAERSAQMPEVFGPFEPWFFYGIAAVEIVMMSAFIFAIIQSIRYRHSVEDHAWWLISTVFIIMMPALGRGMGVLLIIIFGPTSVVNNASLYLTTGIIIAITLWAAVKYGRVNHPATWLAIGVNLFNLLFEPLGKWEWLQGVLRAMIKG

Samples

Sample ID Description Type Environment
1 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
129 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
145 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
146 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
147 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
150 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
151 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
152 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
153 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
154 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
155 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
156 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
157 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
158 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
159 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
160 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
161 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
162 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
163 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
164 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
165 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
166 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
167 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
168 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
169 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
170 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
171 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
172 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
173 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
174 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
175 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
176 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
177 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
178 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
179 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
180 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
181 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
182 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
183 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
184 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
185 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
186 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
187 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
188 2739367651 Pedobacter sp. OK291 Isolate Unclassified
189 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.45
Metatranscriptomes 0
Isolates 0.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.55
Nodule 0
Rhizoplane 0.55
Rhizosphere 97.8
Stem 0
Stem Tuber 0
Unclassified 19.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307408_100100745 3300031548 Bacteria 2201
2 JGI24741J21665_1027736 3300001915 Unclassified 857
3 JGI24740J21852_10003511 3300001979 Bacteria 6872
4 JGI24739J22299_10001448 3300001989 Bacteria 8950
5 JGI24737J22298_10000410 3300001990 Bacteria 14666
6 JGI24738J21930_10001309 3300002075 Bacteria 6961
7 JGI24034J26672_10002635 3300002239 Bacteria 2471
8 JGI24751J29686_10000732 3300002459 Bacteria 7929
9 Ga0065714_10118312 3300005288 Bacteria 1380
10 Ga0065712_10284537 3300005290 Bacteria 883
11 Ga0065712_10338364 3300005290 Bacteria 793
12 Ga0065715_10103373 3300005293 Bacteria 3039
13 Ga0065715_10293209 3300005293 Bacteria 1050
14 Ga0070658_10001117 3300005327 Bacteria 22909
15 Ga0070658_10098318 3300005327 Unclassified 2417
16 Ga0070676_10000162 3300005328 Bacteria 26894
17 Ga0070676_10002241 3300005328 Bacteria 9869
18 Ga0070676_10027630 3300005328 Bacteria 3219
19 Ga0070670_100010999 3300005331 Bacteria 7730
20 Ga0070670_100215482 3300005331 Bacteria 1670
21 Ga0070670_100256497 3300005331 Bacteria 1524
22 Ga0070670_100425760 3300005331 Bacteria 1174
23 Ga0070677_10141328 3300005333 Unclassified 1111
24 Ga0070677_10301603 3300005333 Unclassified 814
25 Ga0068869_100000198 3300005334 Bacteria 31224
26 Ga0068869_100075695 3300005334 Bacteria 2501
27 Ga0068869_100118686 3300005334 Unclassified 2020
28 Ga0068869_100170784 3300005334 Bacteria 1698
29 Ga0068869_100204952 3300005334 Bacteria 1557
30 Ga0070682_100289501 3300005337 Unclassified 1197
31 Ga0068868_100005453 3300005338 Bacteria 8940
32 Ga0068868_100396454 3300005338 Bacteria 1190
33 Ga0068868_100752178 3300005338 Unclassified 876
34 Ga0070660_100007976 3300005339 Bacteria 7398
35 Ga0070660_100035692 3300005339 Unclassified 3764
36 Ga0070661_100225674 3300005344 Unclassified 1438
37 Ga0070692_10254987 3300005345 Unclassified 1052
38 Ga0070668_100003957 3300005347 Bacteria 10951
39 Ga0070668_100629430 3300005347 Bacteria 941
40 Ga0070669_100005945 3300005353 Bacteria 8804
41 Ga0070675_100085037 3300005354 Bacteria 2642
42 Ga0070675_100377555 3300005354 Bacteria 1261
43 Ga0070671_100310692 3300005355 Bacteria 1343
44 Ga0070674_100074092 3300005356 Bacteria 2415
45 Ga0070674_100592365 3300005356 Unclassified 936
46 Ga0070673_100003953 3300005364 Bacteria 9315
47 Ga0070673_100039657 3300005364 Bacteria 3606
48 Ga0070688_100017650 3300005365 Bacteria 4099
49 Ga0070659_100159430 3300005366 Bacteria 1844
50 Ga0070667_100108662 3300005367 Bacteria 2403
51 Ga0070667_100247665 3300005367 Bacteria 1592
52 Ga0070701_10098507 3300005438 Bacteria 1615
53 Ga0070663_100002083 3300005455 Bacteria 11184
54 Ga0070663_100132143 3300005455 Bacteria 1897
55 Ga0070678_100028880 3300005456 Bacteria 3789
56 Ga0070662_100136783 3300005457 Bacteria 1895
57 Ga0068867_100028807 3300005459 Bacteria 3998
58 Ga0068867_100046729 3300005459 Bacteria 3180
59 Ga0070685_10011933 3300005466 Bacteria 4555
60 Ga0070698_100119180 3300005471 Bacteria 2600
61 Ga0068853_100011123 3300005539 Bacteria 7300
62 Ga0068853_100215595 3300005539 Unclassified 1751
63 Ga0070672_100009126 3300005543 Bacteria 6823
64 Ga0070672_100133357 3300005543 Bacteria 2043
65 Ga0070686_100152260 3300005544 Unclassified 1621
66 Ga0070693_100076725 3300005547 Unclassified 1981
67 Ga0070665_100560837 3300005548 Bacteria 1155
68 Ga0070704_100067615 3300005549 Bacteria 2581
69 Ga0068855_100047224 3300005563 Bacteria 5087
70 Ga0068857_100013740 3300005577 Bacteria 7055
71 Ga0068854_100000599 3300005578 Bacteria 21420
72 Ga0070702_100029342 3300005615 Bacteria 2990
73 Ga0068852_100079115 3300005616 Bacteria 2911
74 Ga0068852_100382621 3300005616 Unclassified 1381
75 Ga0068859_100001069 3300005617 Bacteria 28045
76 Ga0068859_100027955 3300005617 Bacteria 5655
77 Ga0068859_100041431 3300005617 Bacteria 4625
78 Ga0068859_100057579 3300005617 Bacteria 3915
79 Ga0068859_100175498 3300005617 Bacteria 2225
80 Ga0068859_100243299 3300005617 Bacteria 1889
81 Ga0068859_100583462 3300005617 Bacteria 1211
82 Ga0068864_100007601 3300005618 Bacteria 8927
83 Ga0068864_100038363 3300005618 Bacteria 4091
84 Ga0068864_100251039 3300005618 Bacteria 1643
85 Ga0068866_10028343 3300005718 Bacteria 2667
86 Ga0068861_100177225 3300005719 Bacteria 1771
87 Ga0068851_10087516 3300005834 Bacteria 1636
88 Ga0068851_10155049 3300005834 Unclassified 1254
89 Ga0068851_10407926 3300005834 Unclassified 800
90 Ga0068870_10180928 3300005840 Bacteria 1265
91 Ga0068863_100004142 3300005841 Bacteria 14326
92 Ga0068863_100021780 3300005841 Bacteria 6116
93 Ga0068863_100034558 3300005841 Bacteria 4815
94 Ga0068863_100043383 3300005841 Bacteria 4270
95 Ga0068863_100061185 3300005841 Bacteria 3559
96 Ga0068863_100639974 3300005841 Unclassified 1054
97 Ga0068858_100004047 3300005842 Bacteria 14457
98 Ga0068860_100084177 3300005843 Bacteria 3025
99 Ga0068860_100099851 3300005843 Bacteria 2768
100 Ga0068860_100260989 3300005843 Bacteria 1689
101 Ga0068860_100554794 3300005843 Bacteria 1151
102 Ga0068862_100003966 3300005844 Bacteria 12575
103 Ga0068862_100026268 3300005844 Bacteria 4894
104 Ga0068862_100134655 3300005844 Unclassified 2189
105 Ga0068862_100198667 3300005844 Unclassified 1807
106 Ga0068862_100347048 3300005844 Unclassified 1376
107 Ga0068862_100421659 3300005844 Bacteria 1252
108 Ga0068862_100523615 3300005844 Unclassified 1128
109 Ga0097621_100283047 3300006237 Bacteria 1460
110 Ga0097621_100551445 3300006237 Unclassified 1049
111 Ga0068871_100007484 3300006358 Bacteria 7811
112 Ga0068871_100076822 3300006358 Bacteria 2758
113 Ga0075428_100114387 3300006844 Bacteria 2940
114 Ga0075428_100478032 3300006844 Bacteria 1333
115 Ga0068865_100007392 3300006881 Bacteria 6760
116 Ga0068865_100420646 3300006881 Unclassified 1098
117 Ga0097620_100001069 3300006931 Bacteria 28045
118 Ga0097620_100027955 3300006931 Bacteria 5655
119 Ga0097620_100041431 3300006931 Bacteria 4625
120 Ga0097620_100057576 3300006931 Bacteria 3915
121 Ga0097620_100175492 3300006931 Bacteria 2225
122 Ga0097620_100243305 3300006931 Bacteria 1889
123 Ga0097620_100583439 3300006931 Bacteria 1211
124 Ga0111539_10021370 3300009094 Bacteria 7967
125 Ga0111539_10359661 3300009094 Bacteria 1694
126 Ga0111539_11224056 3300009094 Bacteria 872
127 Ga0105245_10002561 3300009098 Bacteria 16366
128 Ga0105245_10040666 3300009098 Bacteria 4143
129 Ga0105243_10029828 3300009148 Bacteria 4197
130 Ga0105243_10188750 3300009148 Bacteria 1798
131 Ga0105241_10073112 3300009174 Unclassified 2666
132 Ga0105242_10171652 3300009176 Bacteria 1906
133 Ga0105242_10371820 3300009176 Bacteria 1326
134 Ga0105242_10658402 3300009176 Bacteria 1019
135 Ga0105248_10005697 3300009177 Bacteria 13685
136 Ga0105248_10036110 3300009177 Bacteria 5527
137 Ga0105249_10011702 3300009553 Bacteria 7717
138 Ga0105249_10422426 3300009553 Bacteria 1367
139 Ga0105239_10045011 3300010375 Bacteria 4837
140 Ga0105246_10019359 3300011119 Bacteria 4348
141 Ga0157373_10030026 3300013100 Bacteria 3912
142 Ga0157371_10006813 3300013102 Bacteria 9338
143 Ga0157370_10027055 3300013104 Bacteria 5655
144 Ga0157378_10020341 3300013297 Bacteria 5838
145 Ga0163162_10135395 3300013306 Bacteria 2574
146 Ga0163162_10391674 3300013306 Bacteria 1522
147 Ga0157375_10039115 3300013308 Bacteria 4561
148 Ga0157375_10072756 3300013308 Bacteria 3455
149 Ga0157375_10197512 3300013308 Bacteria 2167
150 Ga0157375_10726629 3300013308 Unclassified 1145
151 Ga0163163_10186772 3300014325 Bacteria 2120
152 Ga0163163_10496597 3300014325 Bacteria 1282
153 Ga0157380_10005499 3300014326 Bacteria 8855
154 Ga0157380_10057517 3300014326 Bacteria 3097
155 Ga0157380_10416836 3300014326 Bacteria 1279
156 Ga0157380_10492709 3300014326 Bacteria 1188
157 Ga0157380_10816172 3300014326 Unclassified 951
158 Ga0157380_11219409 3300014326 Unclassified 797
159 Ga0157377_10020406 3300014745 Bacteria 3471
160 Ga0157377_10038683 3300014745 Bacteria 2635
161 Ga0157379_10243009 3300014968 Bacteria 1633
162 Ga0157376_10133822 3300014969 Bacteria 2216
163 Ga0207697_10000285 3300025315 Bacteria 28077
164 Ga0207642_10158151 3300025899 Unclassified 1214
165 Ga0207688_10005358 3300025901 Bacteria 6964
166 Ga0207688_10007761 3300025901 Bacteria 5842
167 Ga0207647_10000475 3300025904 Bacteria 32451
168 Ga0207645_10008285 3300025907 Bacteria 7264
169 Ga0207645_10011547 3300025907 Bacteria 6025
170 Ga0207645_10126761 3300025907 Bacteria 1659
171 Ga0207643_10013142 3300025908 Bacteria 4479
172 Ga0207643_10013980 3300025908 Bacteria 4354
173 Ga0207705_10012309 3300025909 Bacteria 6180
174 Ga0207705_10042274 3300025909 Unclassified 3272
175 Ga0207662_10063389 3300025918 Bacteria 2223
176 Ga0207657_10011550 3300025919 Bacteria 8767
177 Ga0207657_10027437 3300025919 Bacteria 5215
178 Ga0207646_10337292 3300025922 Bacteria 1362
179 Ga0207681_10002863 3300025923 Bacteria 10904
180 Ga0207650_10008344 3300025925 Bacteria 7073
181 Ga0207650_10234216 3300025925 Bacteria 1482
182 Ga0207659_10076189 3300025926 Unclassified 2464
183 Ga0207687_10054431 3300025927 Bacteria 2799
184 Ga0207644_10181142 3300025931 Unclassified 1651
185 Ga0207644_10334537 3300025931 Bacteria 1227
186 Ga0207690_10008460 3300025932 Bacteria 6110
187 Ga0207690_10342769 3300025932 Unclassified 1180
188 Ga0207706_10010466 3300025933 Bacteria 8475
189 Ga0207706_10168685 3300025933 Bacteria 1924
190 Ga0207706_10356533 3300025933 Bacteria 1271
191 Ga0207709_10025312 3300025935 Bacteria 3397
192 Ga0207709_10213595 3300025935 Bacteria 1386
193 Ga0207670_10061768 3300025936 Bacteria 2558
194 Ga0207669_10034142 3300025937 Bacteria 2879
195 Ga0207704_10091049 3300025938 Bacteria 2003
196 Ga0207691_10010451 3300025940 Bacteria 8904
197 Ga0207691_10025895 3300025940 Bacteria 5505
198 Ga0207691_10052804 3300025940 Bacteria 3711
199 Ga0207691_10671800 3300025940 Bacteria 874
200 Ga0207711_10009528 3300025941 Bacteria 8100
201 Ga0207711_10068690 3300025941 Bacteria 3070
202 Ga0207689_10008607 3300025942 Bacteria 8886
203 Ga0207689_10013340 3300025942 Bacteria 7011
204 Ga0207689_10110061 3300025942 Unclassified 2264
205 Ga0207689_10262575 3300025942 Bacteria 1429
206 Ga0207689_10351186 3300025942 Bacteria 1226
207 Ga0207679_10116399 3300025945 Unclassified 2119
208 Ga0207651_10012739 3300025960 Bacteria 4775
209 Ga0207651_10077911 3300025960 Bacteria 2375
210 Ga0207651_10213047 3300025960 Unclassified 1556
211 Ga0207712_10005300 3300025961 Bacteria 8143
212 Ga0207712_10185132 3300025961 Bacteria 1639
213 Ga0207668_10000129 3300025972 Bacteria 53619
214 Ga0207668_10100001 3300025972 Unclassified 2152
215 Ga0207640_10003726 3300025981 Bacteria 8223
216 Ga0207640_10098034 3300025981 Bacteria 2048
217 Ga0207640_10335894 3300025981 Unclassified 1208
218 Ga0207658_10011763 3300025986 Bacteria 5960
219 Ga0207658_10066160 3300025986 Bacteria 2717
220 Ga0207658_10069110 3300025986 Bacteria 2667
221 Ga0207677_10001108 3300026023 Bacteria 14712
222 Ga0207703_10014103 3300026035 Bacteria 6229
223 Ga0207639_10218623 3300026041 Unclassified 1644
224 Ga0207678_10030719 3300026067 Bacteria 4691
225 Ga0207678_10181644 3300026067 Unclassified 1796
226 Ga0207708_10115763 3300026075 Bacteria 2085
227 Ga0207641_10010041 3300026088 Bacteria 7786
228 Ga0207641_10013300 3300026088 Bacteria 6751
229 Ga0207641_10036841 3300026088 Bacteria 4083
230 Ga0207641_10039545 3300026088 Bacteria 3945
231 Ga0207641_10063028 3300026088 Bacteria 3166
232 Ga0207641_10472842 3300026088 Unclassified 1214
233 Ga0207648_10000838 3300026089 Bacteria 34648
234 Ga0207648_10000950 3300026089 Bacteria 32798
235 Ga0207648_10174476 3300026089 Bacteria 1901
236 Ga0207676_10003957 3300026095 Bacteria 10458
237 Ga0207676_10223320 3300026095 Bacteria 1679
238 Ga0207674_10013842 3300026116 Bacteria 8925
239 Ga0207674_10128588 3300026116 Bacteria 2497
240 Ga0207674_10396513 3300026116 Bacteria 1334
241 Ga0207683_10034323 3300026121 Bacteria 4408
242 Ga0207698_10001868 3300026142 Bacteria 12306
243 Ga0207698_10138833 3300026142 Bacteria 2090
244 Ga0268266_10357550 3300028379 Bacteria 1373
245 Ga0268266_10394235 3300028379 Bacteria 1308
246 Ga0268265_10002738 3300028380 Bacteria 13007
247 Ga0268265_10032151 3300028380 Bacteria 3798
248 Ga0268265_10117955 3300028380 Bacteria 2181
249 Ga0268265_10377385 3300028380 Bacteria 1303
250 Ga0268264_10011941 3300028381 Bacteria 7152
251 Ga0268264_10017410 3300028381 Bacteria 5885
252 Ga0268264_10149038 3300028381 Bacteria 2096
253 Ga0268264_10151196 3300028381 Unclassified 2081
254 Ga0268264_10473820 3300028381 Bacteria 1217
255 Ga0316182_1003818 3300030745 Unclassified 1824
256 Ga0307513_10319592 3300031456 Bacteria 1311
257 Ga0307408_100110327 3300031548 Bacteria 2112
258 Ga0307408_100123078 3300031548 Unclassified 2012
259 Ga0307405_10017776 3300031731 Bacteria 3909
260 Ga0307405_10047269 3300031731 Unclassified 2649
261 Ga0307405_10075069 3300031731 Bacteria 2189
262 Ga0307413_10000642 3300031824 Bacteria 11821
263 Ga0307413_10009187 3300031824 Bacteria 4718
264 Ga0307413_10034031 3300031824 Bacteria 2908
265 Ga0307413_10088360 3300031824 Unclassified 2010
266 Ga0307413_10491827 3300031824 Bacteria 983
267 Ga0307410_10003301 3300031852 Bacteria 8063
268 Ga0307410_10006482 3300031852 Bacteria 6320
269 Ga0307410_10042854 3300031852 Bacteria 2994
270 Ga0307410_10152087 3300031852 Bacteria 1724
271 Ga0307410_10171559 3300031852 Unclassified 1635
272 Ga0307406_10080490 3300031901 Viruses 2163
273 Ga0307407_10001792 3300031903 Bacteria 8028
274 Ga0307407_10026403 3300031903 Bacteria 3074
275 Ga0307407_10032243 3300031903 Bacteria 2846
276 Ga0307409_100008332 3300031995 Bacteria 6283
277 Ga0307409_100056095 3300031995 Bacteria 3045
278 Ga0307409_100148977 3300031995 Bacteria 2028
279 Ga0307409_100174371 3300031995 Bacteria 1896
280 Ga0307409_100298001 3300031995 Bacteria 1498
281 Ga0307409_100340469 3300031995 Bacteria 1411
282 Ga0307409_100697220 3300031995 Unclassified 1014
283 Ga0307416_100008231 3300032002 Bacteria 6708
284 Ga0307416_100093230 3300032002 Bacteria 2593
285 Ga0307416_100247579 3300032002 Bacteria 1732
286 Ga0307416_100630982 3300032002 Unclassified 1154
287 Ga0307414_10028886 3300032004 Bacteria 3602
288 Ga0307414_10327043 3300032004 Bacteria 1307
289 Ga0307414_10330423 3300032004 Unclassified 1301
290 Ga0307414_10445588 3300032004 Unclassified 1134
291 Ga0307411_10001578 3300032005 Bacteria 9448
292 Ga0307411_10015379 3300032005 Bacteria 4295
293 Ga0307411_10015728 3300032005 Bacteria 4260
294 Ga0307411_10056894 3300032005 Bacteria 2580
295 Ga0307411_10069337 3300032005 Bacteria 2381
296 Ga0307411_10316843 3300032005 Bacteria 1258
297 Ga0307415_100001788 3300032126 Bacteria 10525
298 Ga0307415_100002957 3300032126 Bacteria 8535
299 Ga0307415_100097123 3300032126 Unclassified 2149
300 Ga0316574_0338833 3300035398 Bacteria 953
301 Ga0395899_0162296 3300037312 Bacteria 1578
302 Ga0395898_0303933 3300037466 Unclassified 1522
303 Ga0395905_0440815 3300037471 Bacteria 1200
304 Ga0451800_0847870 3300041459 Bacteria 1737
305 Ga0451804_0473041 3300041463 Bacteria 1428
306 Ga0451853_1416695 3300041512 Bacteria 1315
307 Ga0439464_0000505 3300042439 Bacteria 7960
308 Ga0453684_0269983 3300044712 Bacteria 1944
309 Ga0495650_0048054 3300046471 Bacteria 1781
310 Ga0495598_0025119 3300046537 Bacteria 1622
311 Ga0495668_0010198 3300046616 Bacteria 5709
312 Ga0501292_033167 3300049515 Bacteria 874
313 Ga0501296_002374 3300049519 Unclassified 1964
314 Ga0501201_002078 3300049651 Bacteria 1843
315 Ga0501201_003017 3300049651 Bacteria 1545
316 Ga0501202_000334 3300049652 Bacteria 6563
317 Ga0501202_008600 3300049652 Bacteria 1862
318 Ga0501202_029515 3300049652 Bacteria 1137
319 Ga0501206_002743 3300049653 Unclassified 2219
320 Ga0501207_003263 3300049654 Unclassified 2153
321 Ga0501209_018926 3300049656 Bacteria 1600
322 Ga0501216_005314 3300049660 Bacteria 1936
323 Ga0501217_000531 3300049661 Bacteria 6336
324 Ga0501222_002733 3300049662 Unclassified 2442
325 Ga0501223_001442 3300049663 Bacteria 5493
326 Ga0501223_018294 3300049663 Bacteria 1379
327 Ga0501223_022462 3300049663 Bacteria 1232
328 Ga0501223_025743 3300049663 Bacteria 1145
329 Ga0501224_003093 3300049664 Unclassified 2304
330 Ga0501224_032771 3300049664 Bacteria 780
331 Ga0501233_009761 3300049668 Unclassified 1878
332 Ga0501235_005076 3300049669 Unclassified 2858
333 Ga0501240_000591 3300049673 Unclassified 3049
334 Ga0501242_013618 3300049674 Bacteria 1000
335 Ga0501243_000676 3300049675 Unclassified 4686
336 Ga0501250_001006 3300049680 Bacteria 2164
337 Ga0501251_003235 3300049681 Bacteria 1617
338 Ga0501252_001958 3300049682 Unclassified 1988
339 Ga0501252_008048 3300049682 Bacteria 1205
340 Ga0501259_001004 3300049688 Bacteria 4688
341 Ga0501259_048493 3300049688 Unclassified 856
342 Ga0501260_004612 3300049689 Bacteria 1278
343 Ga0501261_002439 3300049690 Unclassified 2282
344 Ga0501221_005886 3300049704 Unclassified 2060
345 Ga0501221_056955 3300049704 Bacteria 894
346 Ga0501225_0001142 3300049705 Bacteria 8296
347 Ga0501225_0035853 3300049705 Bacteria 1366
348 Ga0501234_002314 3300049707 Unclassified 3001
349 Ga0501245_001229 3300049708 Unclassified 3302
350 Ga0501266_000279 3300049763 Bacteria 6723
351 Ga0501266_017095 3300049763 Unclassified 968
352 Ga0501269_015159 3300049766 Unclassified 947
353 Ga0501273_009116 3300049770 Bacteria 1199
354 Ga0501278_005183 3300049774 Unclassified 953
355 Ga0501279_020254 3300049775 Unclassified 944
356 Ga0501212_003042 3300049851 Bacteria 2073
357 Ga0501212_015037 3300049851 Bacteria 1151
358 nmdc:mga08y16_61105_c1 3300050511 Bacteria 3934
359 nmdc:mga08y16_65745_c1 3300050511 Bacteria 3785
360 Ga0500658_0000107 3300053134 Bacteria 38715
361 Ga0500616_0076373 3300053153 Bacteria 1694
362 2739586452 2739367651 Bacteria 6359826
363 2884635615 2884634485 Bacteria 3928637
364 Ga0307408_100100745
365 JGI24741J21665_1027736
366 JGI24740J21852_10003511
367 JGI24739J22299_10001448
368 JGI24737J22298_10000410
369 JGI24738J21930_10001309
370 JGI24034J26672_10002635
371 JGI24751J29686_10000732
372 Ga0065714_10118312
373 Ga0065712_10284537
374 Ga0065712_10338364
375 Ga0065715_10103373
376 Ga0065715_10293209
377 Ga0070658_10001117
378 Ga0070658_10098318
379 Ga0070676_10000162
380 Ga0070676_10002241
381 Ga0070676_10027630
382 Ga0070670_100010999
383 Ga0070670_100215482
384 Ga0070670_100256497
385 Ga0070670_100425760
386 Ga0070677_10141328
387 Ga0070677_10301603
388 Ga0068869_100000198
389 Ga0068869_100075695
390 Ga0068869_100118686
391 Ga0068869_100170784
392 Ga0068869_100204952
393 Ga0070682_100289501
394 Ga0068868_100005453
395 Ga0068868_100396454
396 Ga0068868_100752178
397 Ga0070660_100007976
398 Ga0070660_100035692
399 Ga0070661_100225674
400 Ga0070692_10254987
401 Ga0070668_100003957
402 Ga0070668_100629430
403 Ga0070669_100005945
404 Ga0070675_100085037
405 Ga0070675_100377555
406 Ga0070671_100310692
407 Ga0070674_100074092
408 Ga0070674_100592365
409 Ga0070673_100003953
410 Ga0070673_100039657
411 Ga0070688_100017650
412 Ga0070659_100159430
413 Ga0070667_100108662
414 Ga0070667_100247665
415 Ga0070701_10098507
416 Ga0070663_100002083
417 Ga0070663_100132143
418 Ga0070678_100028880
419 Ga0070662_100136783
420 Ga0068867_100028807
421 Ga0068867_100046729
422 Ga0070685_10011933
423 Ga0070698_100119180
424 Ga0068853_100011123
425 Ga0068853_100215595
426 Ga0070672_100009126
427 Ga0070672_100133357
428 Ga0070686_100152260
429 Ga0070693_100076725
430 Ga0070665_100560837
431 Ga0070704_100067615
432 Ga0068855_100047224
433 Ga0068857_100013740
434 Ga0068854_100000599
435 Ga0070702_100029342
436 Ga0068852_100079115
437 Ga0068852_100382621
438 Ga0068859_100001069
439 Ga0068859_100027955
440 Ga0068859_100041431
441 Ga0068859_100057579
442 Ga0068859_100175498
443 Ga0068859_100243299
444 Ga0068859_100583462
445 Ga0068864_100007601
446 Ga0068864_100038363
447 Ga0068864_100251039
448 Ga0068866_10028343
449 Ga0068861_100177225
450 Ga0068851_10087516
451 Ga0068851_10155049
452 Ga0068851_10407926
453 Ga0068870_10180928
454 Ga0068863_100004142
455 Ga0068863_100021780
456 Ga0068863_100034558
457 Ga0068863_100043383
458 Ga0068863_100061185
459 Ga0068863_100639974
460 Ga0068858_100004047
461 Ga0068860_100084177
462 Ga0068860_100099851
463 Ga0068860_100260989
464 Ga0068860_100554794
465 Ga0068862_100003966
466 Ga0068862_100026268
467 Ga0068862_100134655
468 Ga0068862_100198667
469 Ga0068862_100347048
470 Ga0068862_100421659
471 Ga0068862_100523615
472 Ga0097621_100283047
473 Ga0097621_100551445
474 Ga0068871_100007484
475 Ga0068871_100076822
476 Ga0075428_100114387
477 Ga0075428_100478032
478 Ga0068865_100007392
479 Ga0068865_100420646
480 Ga0097620_100001069
481 Ga0097620_100027955
482 Ga0097620_100041431
483 Ga0097620_100057576
484 Ga0097620_100175492
485 Ga0097620_100243305
486 Ga0097620_100583439
487 Ga0111539_10021370
488 Ga0111539_10359661
489 Ga0111539_11224056
490 Ga0105245_10002561
491 Ga0105245_10040666
492 Ga0105243_10029828
493 Ga0105243_10188750
494 Ga0105241_10073112
495 Ga0105242_10171652
496 Ga0105242_10371820
497 Ga0105242_10658402
498 Ga0105248_10005697
499 Ga0105248_10036110
500 Ga0105249_10011702
501 Ga0105249_10422426
502 Ga0105239_10045011
503 Ga0105246_10019359
504 Ga0157373_10030026
505 Ga0157371_10006813
506 Ga0157370_10027055
507 Ga0157378_10020341
508 Ga0163162_10135395
509 Ga0163162_10391674
510 Ga0157375_10039115
511 Ga0157375_10072756
512 Ga0157375_10197512
513 Ga0157375_10726629
514 Ga0163163_10186772
515 Ga0163163_10496597
516 Ga0157380_10005499
517 Ga0157380_10057517
518 Ga0157380_10416836
519 Ga0157380_10492709
520 Ga0157380_10816172
521 Ga0157380_11219409
522 Ga0157377_10020406
523 Ga0157377_10038683
524 Ga0157379_10243009
525 Ga0157376_10133822
526 Ga0207697_10000285
527 Ga0207642_10158151
528 Ga0207688_10005358
529 Ga0207688_10007761
530 Ga0207647_10000475
531 Ga0207645_10008285
532 Ga0207645_10011547
533 Ga0207645_10126761
534 Ga0207643_10013142
535 Ga0207643_10013980
536 Ga0207705_10012309
537 Ga0207705_10042274
538 Ga0207662_10063389
539 Ga0207657_10011550
540 Ga0207657_10027437
541 Ga0207646_10337292
542 Ga0207681_10002863
543 Ga0207650_10008344
544 Ga0207650_10234216
545 Ga0207659_10076189
546 Ga0207687_10054431
547 Ga0207644_10181142
548 Ga0207644_10334537
549 Ga0207690_10008460
550 Ga0207690_10342769
551 Ga0207706_10010466
552 Ga0207706_10168685
553 Ga0207706_10356533
554 Ga0207709_10025312
555 Ga0207709_10213595
556 Ga0207670_10061768
557 Ga0207669_10034142
558 Ga0207704_10091049
559 Ga0207691_10010451
560 Ga0207691_10025895
561 Ga0207691_10052804
562 Ga0207691_10671800
563 Ga0207711_10009528
564 Ga0207711_10068690
565 Ga0207689_10008607
566 Ga0207689_10013340
567 Ga0207689_10110061
568 Ga0207689_10262575
569 Ga0207689_10351186
570 Ga0207679_10116399
571 Ga0207651_10012739
572 Ga0207651_10077911
573 Ga0207651_10213047
574 Ga0207712_10005300
575 Ga0207712_10185132
576 Ga0207668_10000129
577 Ga0207668_10100001
578 Ga0207640_10003726
579 Ga0207640_10098034
580 Ga0207640_10335894
581 Ga0207658_10011763
582 Ga0207658_10066160
583 Ga0207658_10069110
584 Ga0207677_10001108
585 Ga0207703_10014103
586 Ga0207639_10218623
587 Ga0207678_10030719
588 Ga0207678_10181644
589 Ga0207708_10115763
590 Ga0207641_10010041
591 Ga0207641_10013300
592 Ga0207641_10036841
593 Ga0207641_10039545
594 Ga0207641_10063028
595 Ga0207641_10472842
596 Ga0207648_10000838
597 Ga0207648_10000950
598 Ga0207648_10174476
599 Ga0207676_10003957
600 Ga0207676_10223320
601 Ga0207674_10013842
602 Ga0207674_10128588
603 Ga0207674_10396513
604 Ga0207683_10034323
605 Ga0207698_10001868
606 Ga0207698_10138833
607 Ga0268266_10357550
608 Ga0268266_10394235
609 Ga0268265_10002738
610 Ga0268265_10032151
611 Ga0268265_10117955
612 Ga0268265_10377385
613 Ga0268264_10011941
614 Ga0268264_10017410
615 Ga0268264_10149038
616 Ga0268264_10151196
617 Ga0268264_10473820
618 Ga0316182_1003818
619 Ga0307513_10319592
620 Ga0307408_100110327
621 Ga0307408_100123078
622 Ga0307405_10017776
623 Ga0307405_10047269
624 Ga0307405_10075069
625 Ga0307413_10000642
626 Ga0307413_10009187
627 Ga0307413_10034031
628 Ga0307413_10088360
629 Ga0307413_10491827
630 Ga0307410_10003301
631 Ga0307410_10006482
632 Ga0307410_10042854
633 Ga0307410_10152087
634 Ga0307410_10171559
635 Ga0307406_10080490
636 Ga0307407_10001792
637 Ga0307407_10026403
638 Ga0307407_10032243
639 Ga0307409_100008332
640 Ga0307409_100056095
641 Ga0307409_100148977
642 Ga0307409_100174371
643 Ga0307409_100298001
644 Ga0307409_100340469
645 Ga0307409_100697220
646 Ga0307416_100008231
647 Ga0307416_100093230
648 Ga0307416_100247579
649 Ga0307416_100630982
650 Ga0307414_10028886
651 Ga0307414_10327043
652 Ga0307414_10330423
653 Ga0307414_10445588
654 Ga0307411_10001578
655 Ga0307411_10015379
656 Ga0307411_10015728
657 Ga0307411_10056894
658 Ga0307411_10069337
659 Ga0307411_10316843
660 Ga0307415_100001788
661 Ga0307415_100002957
662 Ga0307415_100097123
663 Ga0316574_0338833
664 Ga0395899_0162296
665 Ga0395898_0303933
666 Ga0395905_0440815
667 Ga0451800_0847870
668 Ga0451804_0473041
669 Ga0451853_1416695
670 Ga0439464_0000505
671 Ga0453684_0269983
672 Ga0495650_0048054
673 Ga0495598_0025119
674 Ga0495668_0010198
675 Ga0501292_033167
676 Ga0501296_002374
677 Ga0501201_002078
678 Ga0501201_003017
679 Ga0501202_000334
680 Ga0501202_008600
681 Ga0501202_029515
682 Ga0501206_002743
683 Ga0501207_003263
684 Ga0501209_018926
685 Ga0501216_005314
686 Ga0501217_000531
687 Ga0501222_002733
688 Ga0501223_001442
689 Ga0501223_018294
690 Ga0501223_022462
691 Ga0501223_025743
692 Ga0501224_003093
693 Ga0501224_032771
694 Ga0501233_009761
695 Ga0501235_005076
696 Ga0501240_000591
697 Ga0501242_013618
698 Ga0501243_000676
699 Ga0501250_001006
700 Ga0501251_003235
701 Ga0501252_001958
702 Ga0501252_008048
703 Ga0501259_001004
704 Ga0501259_048493
705 Ga0501260_004612
706 Ga0501261_002439
707 Ga0501221_005886
708 Ga0501221_056955
709 Ga0501225_0001142
710 Ga0501225_0035853
711 Ga0501234_002314
712 Ga0501245_001229
713 Ga0501266_000279
714 Ga0501266_017095
715 Ga0501269_015159
716 Ga0501273_009116
717 Ga0501278_005183
718 Ga0501279_020254
719 Ga0501212_003042
720 Ga0501212_015037
721 nmdc:mga08y16_61105_c1
722 nmdc:mga08y16_65745_c1
723 Ga0500658_0000107
724 Ga0500616_0076373
725 2739586452
726 2884635615

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7mjq-assembly1.cif.gz_G vascular katp channel: kir6.1 sur2b quatrefoil-like conformation 2 0.4616 121 246
6e9z-assembly1.cif.gz_B dhf119 filament 0.4465 1 236
8e0m-assembly4.cif.gz_L homotrimeric variant of tctrp9, bgl15 0.4185 88 237
6e9z-assembly1.cif.gz_B dhf119 filament 0.4003 1 236
6fel-assembly2.cif.gz_C structure of 14-3-3 gamma in complex with camkk2 14-3-3 binding motif ser511 0.4001 44 229
ID Description Score Start End Superfamily
af_Q8GXA1_46_203_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.5673 118 235 1.20.140.40
af_K7K831_27_178_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.5628 118 236 1.20.140.40
af_Q7F0H7_42_198_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.5534 118 247 1.20.140.40
af_Q0DJG7_36_181_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.5345 103 235 1.20.140.40
af_Q65XN3_57_205_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.5312 119 234 1.20.140.40
ID Description Score Start End GO Terms
AF-A0A4Q8QHK5-F1-model_v4 Uncharacterized protein 0.9069 10 250 GO:0016020
AF-A0A4Q8QHK5-F1-model_v4 Uncharacterized protein 0.8965 10 250 GO:0016020
AF-M7N2B1-F1-model_v4 Uncharacterized protein 0.8951 7 250 GO:0016020
AF-A0A6B3WCU3-F1-model_v4 Uncharacterized protein 0.8757 8 250 GO:0016020
AF-A0A516HFP2-F1-model_v4 Uncharacterized protein 0.8731 10 249 GO:0016020

Map