F423016
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 363 | 231 | 726 | 189 |
Family's Representative Sequence
| Representative Sequence | 3300031730|Ga0307516_10001143|Ga0307516_100011435 |
| Length | 212 |
| Sequence | MLCRYREIACIFARNVHLPKTSNLEFQTDIENCLKVLHAGGLILYPTDTVWGIGCDATNPIAVKAVYGLKRRDESKSLIVLMADERDVLKYISAPDLRIFEFLHTVQKPTTVIYEGPVGLAENLTGSDGTIAIRLVDEPFCKHLIKRFRKPLVSTSANISGSPAPAFFGEVGATVREGVDYIVRYRQDDDLPKQPSAVVKWNKDASVMVLRS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 10 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 11 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 12 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 36 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 38 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 42 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 43 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 44 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 45 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 46 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 47 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 48 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 50 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 51 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 52 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 53 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 54 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 80 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 81 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 83 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 84 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 116 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 117 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 118 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 119 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 120 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 121 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 122 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 123 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 124 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 125 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 126 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 127 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 128 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 129 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 130 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 131 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 132 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 133 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 134 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 135 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 136 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 137 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 138 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 139 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 140 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 141 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 142 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 143 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 144 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 145 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 146 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 147 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 148 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 149 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 150 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 151 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 152 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 153 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 154 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 155 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 156 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 157 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 171 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 172 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 173 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 174 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 175 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 176 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 177 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 182 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 183 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 186 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 187 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 188 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 189 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 190 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 191 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 192 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 193 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 194 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 195 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 196 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 197 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 198 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 200 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 201 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 202 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 204 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 205 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 206 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 207 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 208 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 209 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 210 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 211 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 212 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 213 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 214 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 215 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 216 | 2721755487 | Sphingobacterium sp. B29 | Isolate | Rhizosphere |
| 217 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 218 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 219 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 220 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 221 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 222 | 2881955468 | Edaphocola flava HME-24 | Isolate | Rhizosphere |
| 223 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 224 | 2896317667 | Sphingobacterium sp. SGR-19 | Isolate | Rhizosphere |
| 225 | 2896344016 | Sphingobacterium sp. SGL-16 | Isolate | Rhizosphere |
| 226 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 227 | 2904780799 | Sphingobacterium sp. 1304 | Isolate | Rhizosphere |
| 228 | 2919177583 | Sphingobacterium sp. 2149 | Isolate | Rhizosphere |
| 229 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 230 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 231 | 3003233435 | Sphingobacterium shayense CrR18 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.77 |
| Metatranscriptomes | 0.83 |
| Isolates | 4.41 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.23 |
| Nodule | 0 |
| Rhizoplane | 0.83 |
| Rhizosphere | 84.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0307516_10001143 | 3300031730 | Bacteria | 37055 |
| 2 | SwRhRL2b_contig_210851 | 2162886007 | Bacteria | 1088 |
| 3 | SwRhRL2b_contig_3634020 | 2162886007 | Bacteria | 2028 |
| 4 | JGI24737J22298_10060400 | 3300001990 | Bacteria | 1141 |
| 5 | JGI25162J39368_1000107 | 3300002737 | Bacteria | 90782 |
| 6 | JGI25162J39368_1001620 | 3300002737 | Bacteria | 11286 |
| 7 | rootH2_10013110 | 3300003320 | Bacteria | 45132 |
| 8 | rootH2_10019063 | 3300003320 | Bacteria | 8406 |
| 9 | rootL2_10166616 | 3300003322 | Bacteria | 2709 |
| 10 | rootH1_10162919 | 3300003323 | Bacteria | 5611 |
| 11 | Ga0055531_10005359 | 3300003794 | Bacteria | 7520 |
| 12 | Ga0058863_10827685 | 3300004799 | Bacteria | 2092 |
| 13 | Ga0058861_11293557 | 3300004800 | Bacteria | 1546 |
| 14 | Ga0058862_10780518 | 3300004803 | Bacteria | 794 |
| 15 | Ga0065714_10096761 | 3300005288 | Bacteria | 1753 |
| 16 | Ga0065712_10078098 | 3300005290 | Bacteria | 3378 |
| 17 | Ga0070658_10532121 | 3300005327 | Bacteria | 1016 |
| 18 | Ga0070683_100014276 | 3300005329 | Bacteria | 6944 |
| 19 | Ga0070683_101021950 | 3300005329 | Bacteria | 794 |
| 20 | Ga0070670_100033402 | 3300005331 | Bacteria | 4431 |
| 21 | Ga0070670_100042195 | 3300005331 | Bacteria | 3921 |
| 22 | Ga0070670_100403386 | 3300005331 | Bacteria | 1207 |
| 23 | Ga0070670_100571901 | 3300005331 | Bacteria | 1009 |
| 24 | Ga0068869_100100310 | 3300005334 | Bacteria | 2189 |
| 25 | Ga0070680_100035828 | 3300005336 | Bacteria | 4007 |
| 26 | Ga0070680_100233629 | 3300005336 | Bacteria | 1553 |
| 27 | Ga0068868_101109250 | 3300005338 | Bacteria | 728 |
| 28 | Ga0070689_100056938 | 3300005340 | Bacteria | 3033 |
| 29 | Ga0070689_100235857 | 3300005340 | Bacteria | 1505 |
| 30 | Ga0070691_10200247 | 3300005341 | Bacteria | 1049 |
| 31 | Ga0070692_10523971 | 3300005345 | Unclassified | 772 |
| 32 | Ga0070668_100079169 | 3300005347 | Unclassified | 2573 |
| 33 | Ga0070668_100627577 | 3300005347 | Bacteria | 942 |
| 34 | Ga0070671_100138763 | 3300005355 | Bacteria | 2051 |
| 35 | Ga0070671_100767380 | 3300005355 | Bacteria | 838 |
| 36 | Ga0070673_100303198 | 3300005364 | Bacteria | 1407 |
| 37 | Ga0070688_100058278 | 3300005365 | Bacteria | 2431 |
| 38 | Ga0070688_100421249 | 3300005365 | Bacteria | 992 |
| 39 | Ga0070667_100019703 | 3300005367 | Bacteria | 5596 |
| 40 | Ga0070667_100025692 | 3300005367 | Bacteria | 4897 |
| 41 | Ga0070681_10008789 | 3300005458 | Bacteria | 9914 |
| 42 | Ga0070681_10010876 | 3300005458 | Bacteria | 8995 |
| 43 | Ga0070681_10099765 | 3300005458 | Bacteria | 2849 |
| 44 | Ga0070685_10035569 | 3300005466 | Bacteria | 2810 |
| 45 | Ga0070679_100029098 | 3300005530 | Bacteria | 5449 |
| 46 | Ga0070679_100105604 | 3300005530 | Bacteria | 2803 |
| 47 | Ga0070684_100002312 | 3300005535 | Bacteria | 14048 |
| 48 | Ga0070672_100070016 | 3300005543 | Bacteria | 2786 |
| 49 | Ga0070672_100836734 | 3300005543 | Unclassified | 811 |
| 50 | Ga0070693_100104365 | 3300005547 | Bacteria | 1732 |
| 51 | Ga0070665_100000074 | 3300005548 | Bacteria | 192944 |
| 52 | Ga0068855_100039122 | 3300005563 | Bacteria | 5630 |
| 53 | Ga0068855_100236029 | 3300005563 | Bacteria | 2045 |
| 54 | Ga0068855_100389741 | 3300005563 | Bacteria | 1528 |
| 55 | Ga0070664_100797326 | 3300005564 | Bacteria | 883 |
| 56 | Ga0068857_100236927 | 3300005577 | Bacteria | 1670 |
| 57 | Ga0068854_100571344 | 3300005578 | Unclassified | 962 |
| 58 | Ga0068856_100077693 | 3300005614 | Bacteria | 3290 |
| 59 | Ga0068856_100152936 | 3300005614 | Unclassified | 2316 |
| 60 | Ga0068856_101032208 | 3300005614 | Bacteria | 840 |
| 61 | Ga0068852_100010350 | 3300005616 | Bacteria | 6966 |
| 62 | Ga0068852_100051596 | 3300005616 | Bacteria | 3531 |
| 63 | Ga0068852_100319640 | 3300005616 | Bacteria | 1507 |
| 64 | Ga0068852_100855619 | 3300005616 | Bacteria | 925 |
| 65 | Ga0068859_100000037 | 3300005617 | Bacteria | 165480 |
| 66 | Ga0068864_100448445 | 3300005618 | Bacteria | 1234 |
| 67 | Ga0068851_10000199 | 3300005834 | Bacteria | 28976 |
| 68 | Ga0068863_100002618 | 3300005841 | Bacteria | 17840 |
| 69 | Ga0068863_100059275 | 3300005841 | Bacteria | 3622 |
| 70 | Ga0068863_100128907 | 3300005841 | Bacteria | 2414 |
| 71 | Ga0068858_100063431 | 3300005842 | Bacteria | 3419 |
| 72 | Ga0068860_100013203 | 3300005843 | Bacteria | 8103 |
| 73 | Ga0068860_100146917 | 3300005843 | Unclassified | 2269 |
| 74 | Ga0075366_10004745 | 3300006195 | Bacteria | 7325 |
| 75 | Ga0075366_10020037 | 3300006195 | Bacteria | 3878 |
| 76 | Ga0097621_100001069 | 3300006237 | Bacteria | 19149 |
| 77 | Ga0097621_100023617 | 3300006237 | Bacteria | 4789 |
| 78 | Ga0097621_100357795 | 3300006237 | Bacteria | 1300 |
| 79 | Ga0075370_10171272 | 3300006353 | Bacteria | 1276 |
| 80 | Ga0068871_100018879 | 3300006358 | Bacteria | 5254 |
| 81 | Ga0068871_100024861 | 3300006358 | Bacteria | 4651 |
| 82 | Ga0068871_100391214 | 3300006358 | Bacteria | 1237 |
| 83 | Ga0068871_100413561 | 3300006358 | Unclassified | 1203 |
| 84 | Ga0075428_100032709 | 3300006844 | Bacteria | 5744 |
| 85 | Ga0075431_100640424 | 3300006847 | Bacteria | 1044 |
| 86 | Ga0068865_100110772 | 3300006881 | Unclassified | 2025 |
| 87 | Ga0068865_100997603 | 3300006881 | Bacteria | 733 |
| 88 | Ga0097620_100000037 | 3300006931 | Bacteria | 165480 |
| 89 | Ga0097620_100149718 | 3300006931 | Unclassified | 2410 |
| 90 | Ga0105240_10000008 | 3300009093 | Bacteria | 618862 |
| 91 | Ga0105240_10000059 | 3300009093 | Bacteria | 219860 |
| 92 | Ga0105240_10031339 | 3300009093 | Bacteria | 6897 |
| 93 | Ga0105240_10045664 | 3300009093 | Bacteria | 5556 |
| 94 | Ga0105240_10537814 | 3300009093 | Bacteria | 1294 |
| 95 | Ga0105245_10138867 | 3300009098 | Unclassified | 2287 |
| 96 | Ga0105243_10000009 | 3300009148 | Bacteria | 354419 |
| 97 | Ga0105243_10035623 | 3300009148 | Unclassified | 3859 |
| 98 | Ga0105241_10001055 | 3300009174 | Bacteria | 20990 |
| 99 | Ga0105241_10040370 | 3300009174 | Bacteria | 3523 |
| 100 | Ga0105241_11548588 | 3300009174 | Bacteria | 639 |
| 101 | Ga0105242_10201205 | 3300009176 | Bacteria | 1769 |
| 102 | Ga0105242_10324989 | 3300009176 | Bacteria | 1412 |
| 103 | Ga0105242_11123533 | 3300009176 | Bacteria | 801 |
| 104 | Ga0105248_10111698 | 3300009177 | Bacteria | 3082 |
| 105 | Ga0105248_11993551 | 3300009177 | Bacteria | 659 |
| 106 | Ga0105237_10001973 | 3300009545 | Bacteria | 26110 |
| 107 | Ga0105237_10124822 | 3300009545 | Unclassified | 2569 |
| 108 | Ga0105237_10353493 | 3300009545 | Bacteria | 1474 |
| 109 | Ga0105238_10343678 | 3300009551 | Bacteria | 1481 |
| 110 | Ga0105238_12086372 | 3300009551 | Unclassified | 601 |
| 111 | Ga0105249_10001713 | 3300009553 | Bacteria | 19174 |
| 112 | Ga0105249_10017145 | 3300009553 | Bacteria | 6429 |
| 113 | Ga0105249_10162789 | 3300009553 | Unclassified | 2157 |
| 114 | Ga0105239_10001797 | 3300010375 | Bacteria | 28154 |
| 115 | Ga0105239_10009494 | 3300010375 | Bacteria | 10957 |
| 116 | Ga0105239_10091532 | 3300010375 | Bacteria | 3356 |
| 117 | Ga0105239_10105160 | 3300010375 | Bacteria | 3126 |
| 118 | Ga0105239_10657727 | 3300010375 | Bacteria | 1197 |
| 119 | Ga0105246_10039683 | 3300011119 | Unclassified | 3173 |
| 120 | Ga0157373_10097437 | 3300013100 | Bacteria | 2070 |
| 121 | Ga0157371_10065090 | 3300013102 | Bacteria | 2581 |
| 122 | Ga0157371_10785763 | 3300013102 | Bacteria | 717 |
| 123 | Ga0157370_10607989 | 3300013104 | Unclassified | 1001 |
| 124 | Ga0157369_10117799 | 3300013105 | Bacteria | 2819 |
| 125 | Ga0157369_10451285 | 3300013105 | Bacteria | 1331 |
| 126 | Ga0157374_11446416 | 3300013296 | Bacteria | 710 |
| 127 | Ga0157378_10004603 | 3300013297 | Bacteria | 12099 |
| 128 | Ga0157378_10009754 | 3300013297 | Bacteria | 8368 |
| 129 | Ga0157378_10097011 | 3300013297 | Bacteria | 2686 |
| 130 | Ga0157378_10131732 | 3300013297 | Bacteria | 2315 |
| 131 | Ga0157378_10132506 | 3300013297 | Bacteria | 2308 |
| 132 | Ga0157378_10238883 | 3300013297 | Bacteria | 1735 |
| 133 | Ga0157378_10516852 | 3300013297 | Bacteria | 1195 |
| 134 | Ga0157378_11359926 | 3300013297 | Bacteria | 752 |
| 135 | Ga0163162_10003204 | 3300013306 | Bacteria | 15653 |
| 136 | Ga0163162_10003269 | 3300013306 | Bacteria | 15507 |
| 137 | Ga0163162_10770041 | 3300013306 | Bacteria | 1081 |
| 138 | Ga0157372_10188791 | 3300013307 | Bacteria | 2387 |
| 139 | Ga0157372_10441733 | 3300013307 | Bacteria | 1516 |
| 140 | Ga0157372_10562360 | 3300013307 | Bacteria | 1329 |
| 141 | Ga0157372_10833344 | 3300013307 | Bacteria | 1071 |
| 142 | Ga0157375_10000651 | 3300013308 | Bacteria | 30698 |
| 143 | Ga0157375_10025535 | 3300013308 | Bacteria | 5491 |
| 144 | Ga0157375_11164182 | 3300013308 | Bacteria | 904 |
| 145 | Ga0163163_10259428 | 3300014325 | Unclassified | 1789 |
| 146 | Ga0163163_10291118 | 3300014325 | Bacteria | 1685 |
| 147 | Ga0157380_10036613 | 3300014326 | Bacteria | 3798 |
| 148 | Ga0157379_10253315 | 3300014968 | Unclassified | 1598 |
| 149 | Ga0157379_10358300 | 3300014968 | Bacteria | 1336 |
| 150 | Ga0157376_10008723 | 3300014969 | Bacteria | 7326 |
| 151 | Ga0157376_10012276 | 3300014969 | Bacteria | 6353 |
| 152 | Ga0157376_10062153 | 3300014969 | Unclassified | 3142 |
| 153 | Ga0157376_10274632 | 3300014969 | Bacteria | 1585 |
| 154 | Ga0157376_10306189 | 3300014969 | Bacteria | 1506 |
| 155 | Ga0182006_1005231 | 3300015261 | Bacteria | 6217 |
| 156 | Ga0182005_1075241 | 3300015265 | Bacteria | 929 |
| 157 | Ga0163161_10107243 | 3300017792 | Bacteria | 2085 |
| 158 | Ga0163161_10198758 | 3300017792 | Bacteria | 1544 |
| 159 | Ga0213876_10360355 | 3300021384 | Bacteria | 773 |
| 160 | Ga0209026_1004405 | 3300025250 | Bacteria | 4184 |
| 161 | Ga0209257_1000511 | 3300025304 | Bacteria | 67499 |
| 162 | Ga0207680_10000619 | 3300025903 | Bacteria | 16749 |
| 163 | Ga0207654_10043215 | 3300025911 | Unclassified | 2554 |
| 164 | Ga0207707_10007687 | 3300025912 | Bacteria | 9388 |
| 165 | Ga0207707_10065197 | 3300025912 | Bacteria | 3172 |
| 166 | Ga0207695_10000021 | 3300025913 | Bacteria | 679399 |
| 167 | Ga0207695_10000039 | 3300025913 | Bacteria | 454801 |
| 168 | Ga0207695_10000073 | 3300025913 | Bacteria | 312565 |
| 169 | Ga0207695_10069478 | 3300025913 | Bacteria | 3604 |
| 170 | Ga0207671_10002513 | 3300025914 | Bacteria | 19573 |
| 171 | Ga0207671_10086893 | 3300025914 | Bacteria | 2351 |
| 172 | Ga0207660_10076271 | 3300025917 | Bacteria | 2451 |
| 173 | Ga0207662_10256441 | 3300025918 | Bacteria | 1150 |
| 174 | Ga0207652_10011055 | 3300025921 | Bacteria | 7275 |
| 175 | Ga0207652_10056839 | 3300025921 | Bacteria | 3369 |
| 176 | Ga0207652_10071284 | 3300025921 | Bacteria | 3019 |
| 177 | Ga0207681_10100275 | 3300025923 | Bacteria | 2087 |
| 178 | Ga0207694_10724861 | 3300025924 | Bacteria | 839 |
| 179 | Ga0207650_10075515 | 3300025925 | Bacteria | 2544 |
| 180 | Ga0207650_10164359 | 3300025925 | Bacteria | 1760 |
| 181 | Ga0207650_10387886 | 3300025925 | Bacteria | 1154 |
| 182 | Ga0207709_10000026 | 3300025935 | Bacteria | 354467 |
| 183 | Ga0207670_10047418 | 3300025936 | Bacteria | 2861 |
| 184 | Ga0207669_10225036 | 3300025937 | Bacteria | 1380 |
| 185 | Ga0207704_10059755 | 3300025938 | Unclassified | 2355 |
| 186 | Ga0207689_10004234 | 3300025942 | Bacteria | 13052 |
| 187 | Ga0207661_10068907 | 3300025944 | Unclassified | 2882 |
| 188 | Ga0207661_10929707 | 3300025944 | Bacteria | 801 |
| 189 | Ga0207667_10004126 | 3300025949 | Bacteria | 17853 |
| 190 | Ga0207667_10004578 | 3300025949 | Bacteria | 16953 |
| 191 | Ga0207667_10014742 | 3300025949 | Bacteria | 8895 |
| 192 | Ga0207667_10029581 | 3300025949 | Bacteria | 5938 |
| 193 | Ga0207651_10828521 | 3300025960 | Bacteria | 821 |
| 194 | Ga0207712_10036617 | 3300025961 | Bacteria | 3343 |
| 195 | Ga0207712_10117236 | 3300025961 | Bacteria | 2008 |
| 196 | Ga0207658_10049238 | 3300025986 | Bacteria | 3095 |
| 197 | Ga0207658_10098083 | 3300025986 | Unclassified | 2289 |
| 198 | Ga0207658_10398611 | 3300025986 | Bacteria | 1209 |
| 199 | Ga0207677_10492663 | 3300026023 | Bacteria | 1058 |
| 200 | Ga0207703_10037552 | 3300026035 | Bacteria | 3859 |
| 201 | Ga0207639_10013384 | 3300026041 | Bacteria | 5742 |
| 202 | Ga0207702_10211173 | 3300026078 | Bacteria | 1804 |
| 203 | Ga0207641_10000226 | 3300026088 | Bacteria | 72539 |
| 204 | Ga0207641_10022489 | 3300026088 | Bacteria | 5188 |
| 205 | Ga0207641_10414230 | 3300026088 | Unclassified | 1296 |
| 206 | Ga0207676_10368723 | 3300026095 | Bacteria | 1333 |
| 207 | Ga0207676_10680045 | 3300026095 | Bacteria | 995 |
| 208 | Ga0207676_10931421 | 3300026095 | Bacteria | 853 |
| 209 | Ga0207698_10023281 | 3300026142 | Bacteria | 4324 |
| 210 | Ga0207698_10059510 | 3300026142 | Bacteria | 2967 |
| 211 | Ga0268266_10000010 | 3300028379 | Bacteria | 1030233 |
| 212 | Ga0268264_10009695 | 3300028381 | Bacteria | 7975 |
| 213 | Ga0268264_10125135 | 3300028381 | Unclassified | 2271 |
| 214 | Ga0265318_10078372 | 3300028577 | Bacteria | 1221 |
| 215 | Ga0307517_10001115 | 3300028786 | Bacteria | 45308 |
| 216 | Ga0307515_10000469 | 3300028794 | Bacteria | 96345 |
| 217 | Ga0307515_10216575 | 3300028794 | Bacteria | 1744 |
| 218 | Ga0307515_10354443 | 3300028794 | Bacteria | 1112 |
| 219 | Ga0265338_10000658 | 3300028800 | Bacteria | 59815 |
| 220 | Ga0265338_10000703 | 3300028800 | Bacteria | 57346 |
| 221 | Ga0316177_1006807 | 3300030731 | Bacteria | 14319 |
| 222 | Ga0316176_1209624 | 3300030732 | Bacteria | 24194 |
| 223 | Ga0316183_1095896 | 3300030742 | Bacteria | 133299 |
| 224 | Ga0316181_1224191 | 3300030744 | Bacteria | 23228 |
| 225 | Ga0265327_10059354 | 3300031251 | Bacteria | 1959 |
| 226 | Ga0307513_10126199 | 3300031456 | Unclassified | 2514 |
| 227 | Ga0307509_10116592 | 3300031507 | Unclassified | 2660 |
| 228 | Ga0307509_10204227 | 3300031507 | Bacteria | 1808 |
| 229 | Ga0307408_100145348 | 3300031548 | Bacteria | 1866 |
| 230 | Ga0307508_10067215 | 3300031616 | Bacteria | 3153 |
| 231 | Ga0316576_10003339 | 3300031727 | Bacteria | 9385 |
| 232 | Ga0316578_10090842 | 3300031728 | Bacteria | 1823 |
| 233 | Ga0316578_10121832 | 3300031728 | Bacteria | 1568 |
| 234 | Ga0307413_10024227 | 3300031824 | Bacteria | 3306 |
| 235 | Ga0307410_10139976 | 3300031852 | Bacteria | 1789 |
| 236 | Ga0307412_10088565 | 3300031911 | Bacteria | 2160 |
| 237 | Ga0307416_100022237 | 3300032002 | Unclassified | 4573 |
| 238 | Ga0307414_11065306 | 3300032004 | Bacteria | 746 |
| 239 | Ga0307415_100222592 | 3300032126 | Bacteria | 1514 |
| 240 | Ga0316580_10088192 | 3300032139 | Bacteria | 949 |
| 241 | Ga0307510_10058276 | 3300033180 | Bacteria | 4000 |
| 242 | Ga0373937_1294353 | 3300036401 | Unclassified | 677 |
| 243 | Ga0316584_0060092 | 3300036712 | Bacteria | 2846 |
| 244 | Ga0316584_0108382 | 3300036712 | Bacteria | 2078 |
| 245 | Ga0395899_0000002 | 3300037312 | Bacteria | 1324310 |
| 246 | Ga0395905_0317514 | 3300037471 | Bacteria | 1447 |
| 247 | Ga0400490_45660 | 3300038726 | Bacteria | 57177 |
| 248 | Ga0400489_12410 | 3300039093 | Bacteria | 1906 |
| 249 | Ga0436365_0966128 | 3300039437 | Bacteria | 792 |
| 250 | Ga0451795_0714795 | 3300041456 | Bacteria | 957 |
| 251 | Ga0451795_0962500 | 3300041456 | Bacteria | 963 |
| 252 | Ga0451855_0851418 | 3300041511 | Bacteria | 1137 |
| 253 | Ga0439449_0046986 | 3300042007 | Bacteria | 1599 |
| 254 | Ga0451577_0012740 | 3300042876 | Bacteria | 7889 |
| 255 | Ga0451577_0022051 | 3300042876 | Bacteria | 5819 |
| 256 | Ga0451577_0111372 | 3300042876 | Unclassified | 2449 |
| 257 | Ga0451577_0256001 | 3300042876 | Unclassified | 1585 |
| 258 | Ga0451577_1047458 | 3300042876 | Bacteria | 731 |
| 259 | Ga0466972_0000422 | 3300044658 | Bacteria | 21982 |
| 260 | Ga0453683_0000022 | 3300044673 | Bacteria | 269593 |
| 261 | Ga0453683_0131134 | 3300044673 | Unclassified | 1579 |
| 262 | Ga0453684_0001188 | 3300044712 | Bacteria | 80449 |
| 263 | Ga0453684_0026073 | 3300044712 | Bacteria | 8461 |
| 264 | Ga0453684_0026833 | 3300044712 | Bacteria | 8299 |
| 265 | Ga0453684_0029715 | 3300044712 | Bacteria | 7748 |
| 266 | Ga0453684_0035266 | 3300044712 | Bacteria | 6919 |
| 267 | Ga0453684_0058174 | 3300044712 | Bacteria | 4995 |
| 268 | Ga0453684_0909603 | 3300044712 | Bacteria | 942 |
| 269 | Ga0466971_0068267 | 3300044719 | Unclassified | 1612 |
| 270 | Ga0466970_0001701 | 3300044765 | Bacteria | 10578 |
| 271 | Ga0466970_0284138 | 3300044765 | Bacteria | 931 |
| 272 | Ga0466957_0402126 | 3300044842 | Bacteria | 937 |
| 273 | Ga0466959_0009892 | 3300045049 | Bacteria | 6797 |
| 274 | Ga0451576_0031425 | 3300045051 | Bacteria | 5660 |
| 275 | Ga0451576_0034626 | 3300045051 | Bacteria | 5363 |
| 276 | Ga0451576_0099830 | 3300045051 | Bacteria | 3019 |
| 277 | Ga0451576_0263371 | 3300045051 | Unclassified | 1802 |
| 278 | Ga0495592_0207953 | 3300046454 | Bacteria | 1316 |
| 279 | Ga0495638_0040748 | 3300046460 | Bacteria | 2942 |
| 280 | Ga0495644_0005560 | 3300046523 | Bacteria | 4919 |
| 281 | Ga0495640_0228662 | 3300046533 | Bacteria | 1171 |
| 282 | Ga0495621_0037833 | 3300046539 | Bacteria | 1680 |
| 283 | Ga0495633_0058909 | 3300046558 | Bacteria | 1802 |
| 284 | Ga0495668_0000803 | 3300046616 | Bacteria | 36102 |
| 285 | Ga0495611_0000135 | 3300046648 | Bacteria | 51495 |
| 286 | Ga0495661_0000739 | 3300046665 | Bacteria | 31861 |
| 287 | Ga0495661_0212085 | 3300046665 | Bacteria | 1008 |
| 288 | Ga0495670_0303124 | 3300046691 | Bacteria | 856 |
| 289 | Ga0495600_0327823 | 3300046809 | Bacteria | 962 |
| 290 | Ga0495680_0208920 | 3300047322 | Bacteria | 1398 |
| 291 | Ga0495686_0000046 | 3300047472 | Bacteria | 281963 |
| 292 | Ga0495686_0000994 | 3300047472 | Bacteria | 34556 |
| 293 | Ga0495686_0001722 | 3300047472 | Bacteria | 22525 |
| 294 | Ga0496114_0465884 | 3300048917 | Unclassified | 1118 |
| 295 | Ga0496116_0005201 | 3300048919 | Bacteria | 12190 |
| 296 | Ga0496117_0001253 | 3300048920 | Bacteria | 37795 |
| 297 | Ga0496122_0001580 | 3300048925 | Bacteria | 35795 |
| 298 | Ga0496123_0020365 | 3300048926 | Bacteria | 5190 |
| 299 | Ga0496126_0021576 | 3300048929 | Bacteria | 6288 |
| 300 | Ga0501298_032926 | 3300049521 | Unclassified | 1025 |
| 301 | Ga0501033_0163773 | 3300049570 | Bacteria | 1600 |
| 302 | Ga0501034_0014527 | 3300049571 | Bacteria | 8108 |
| 303 | Ga0501038_0190619 | 3300049574 | Bacteria | 1650 |
| 304 | Ga0501038_0352107 | 3300049574 | Bacteria | 1147 |
| 305 | Ga0501040_0098211 | 3300049576 | Bacteria | 2041 |
| 306 | Ga0501069_0053413 | 3300049585 | Bacteria | 2250 |
| 307 | Ga0501069_0233134 | 3300049585 | Bacteria | 1072 |
| 308 | Ga0501070_0273291 | 3300049586 | Bacteria | 1379 |
| 309 | Ga0501070_0465467 | 3300049586 | Bacteria | 1018 |
| 310 | Ga0501072_0240910 | 3300049588 | Bacteria | 1441 |
| 311 | Ga0501074_0223372 | 3300049590 | Bacteria | 1341 |
| 312 | Ga0501202_008420 | 3300049652 | Bacteria | 1879 |
| 313 | Ga0501217_233112 | 3300049661 | Unclassified | 586 |
| 314 | Ga0501222_009114 | 3300049662 | Unclassified | 1314 |
| 315 | Ga0501223_049822 | 3300049663 | Unclassified | 813 |
| 316 | Ga0501233_018231 | 3300049668 | Bacteria | 1474 |
| 317 | Ga0501235_030590 | 3300049669 | Unclassified | 1214 |
| 318 | Ga0501240_063734 | 3300049673 | Unclassified | 655 |
| 319 | Ga0501252_002700 | 3300049682 | Bacteria | 1783 |
| 320 | Ga0501256_005979 | 3300049685 | Bacteria | 1088 |
| 321 | Ga0501261_011823 | 3300049690 | Bacteria | 1168 |
| 322 | Ga0501221_000389 | 3300049704 | Bacteria | 6729 |
| 323 | Ga0501225_0072148 | 3300049705 | Bacteria | 982 |
| 324 | Ga0501245_006461 | 3300049708 | Bacteria | 1639 |
| 325 | Ga0501080_0327256 | 3300049742 | Bacteria | 1386 |
| 326 | Ga0501241_002066 | 3300049758 | Bacteria | 3932 |
| 327 | Ga0501269_002172 | 3300049766 | Bacteria | 2443 |
| 328 | Ga0501279_045385 | 3300049775 | Unclassified | 684 |
| 329 | Ga0501044_0021995 | 3300049823 | Bacteria | 6800 |
| 330 | Ga0501044_0048562 | 3300049823 | Bacteria | 4383 |
| 331 | Ga0501044_0642092 | 3300049823 | Bacteria | 951 |
| 332 | Ga0501044_0665701 | 3300049823 | Bacteria | 929 |
| 333 | nmdc:mga0k408_44809_c1 | 3300050493 | Bacteria | 2551 |
| 334 | nmdc:mga09592_16706_c1 | 3300050508 | Bacteria | 6007 |
| 335 | Ga0500583_0022964 | 3300053092 | Bacteria | 2623 |
| 336 | Ga0500641_0109976 | 3300053096 | Bacteria | 1186 |
| 337 | Ga0500562_000017 | 3300053108 | Bacteria | 130556 |
| 338 | Ga0500642_0237921 | 3300053130 | Bacteria | 839 |
| 339 | Ga0500616_0002130 | 3300053153 | Bacteria | 17161 |
| 340 | Ga0500622_0000303 | 3300053156 | Bacteria | 50358 |
| 341 | Ga0500622_0000960 | 3300053156 | Bacteria | 24468 |
| 342 | Ga0500622_0005533 | 3300053156 | Bacteria | 7555 |
| 343 | Ga0500627_0015389 | 3300053158 | Bacteria | 2956 |
| 344 | Ga0500645_023886 | 3300053730 | Bacteria | 1872 |
| 345 | Ga0501084_0027666 | 3300054114 | Bacteria | 4738 |
| 346 | Ga0500661_019459 | 3300055283 | Bacteria | 1209 |
| 347 | Ga0501082_0205274 | 3300060353 | Bacteria | 1714 |
| 348 | 2722726032 | 2721755487 | Bacteria | 6357185 |
| 349 | 2819574451 | 2818991442 | Bacteria | 8318214 |
| 350 | 2819678661 | 2818991460 | Bacteria | 7595395 |
| 351 | 2821137828 | 2821136567 | Bacteria | 8080116 |
| 352 | 2842905853 | 2842903701 | Bacteria | 6986368 |
| 353 | 2852625280 | 2852623160 | Bacteria | 4376875 |
| 354 | 2881957237 | 2881955468 | Bacteria | 3545609 |
| 355 | 2884934293 | 2884933994 | Bacteria | 4535041 |
| 356 | 2896319360 | 2896317667 | Bacteria | 4606601 |
| 357 | 2896344226 | 2896344016 | Bacteria | 3811746 |
| 358 | 2904467421 | 2904467357 | Bacteria | 8057758 |
| 359 | 2904782636 | 2904780799 | Bacteria | 5840761 |
| 360 | 2919180246 | 2919177583 | Bacteria | 5641607 |
| 361 | 2929157324 | 2929154850 | Bacteria | 6753285 |
| 362 | 2977233628 | 2977232053 | Bacteria | 5485925 |
| 363 | 3003233460 | 3003233435 | Bacteria | 4458031 |
| 364 | Ga0307516_10001143 | |||
| 365 | SwRhRL2b_contig_210851 | |||
| 366 | SwRhRL2b_contig_3634020 | |||
| 367 | JGI24737J22298_10060400 | |||
| 368 | JGI25162J39368_1000107 | |||
| 369 | JGI25162J39368_1001620 | |||
| 370 | rootH2_10013110 | |||
| 371 | rootH2_10019063 | |||
| 372 | rootL2_10166616 | |||
| 373 | rootH1_10162919 | |||
| 374 | Ga0055531_10005359 | |||
| 375 | Ga0058863_10827685 | |||
| 376 | Ga0058861_11293557 | |||
| 377 | Ga0058862_10780518 | |||
| 378 | Ga0065714_10096761 | |||
| 379 | Ga0065712_10078098 | |||
| 380 | Ga0070658_10532121 | |||
| 381 | Ga0070683_100014276 | |||
| 382 | Ga0070683_101021950 | |||
| 383 | Ga0070670_100033402 | |||
| 384 | Ga0070670_100042195 | |||
| 385 | Ga0070670_100403386 | |||
| 386 | Ga0070670_100571901 | |||
| 387 | Ga0068869_100100310 | |||
| 388 | Ga0070680_100035828 | |||
| 389 | Ga0070680_100233629 | |||
| 390 | Ga0068868_101109250 | |||
| 391 | Ga0070689_100056938 | |||
| 392 | Ga0070689_100235857 | |||
| 393 | Ga0070691_10200247 | |||
| 394 | Ga0070692_10523971 | |||
| 395 | Ga0070668_100079169 | |||
| 396 | Ga0070668_100627577 | |||
| 397 | Ga0070671_100138763 | |||
| 398 | Ga0070671_100767380 | |||
| 399 | Ga0070673_100303198 | |||
| 400 | Ga0070688_100058278 | |||
| 401 | Ga0070688_100421249 | |||
| 402 | Ga0070667_100019703 | |||
| 403 | Ga0070667_100025692 | |||
| 404 | Ga0070681_10008789 | |||
| 405 | Ga0070681_10010876 | |||
| 406 | Ga0070681_10099765 | |||
| 407 | Ga0070685_10035569 | |||
| 408 | Ga0070679_100029098 | |||
| 409 | Ga0070679_100105604 | |||
| 410 | Ga0070684_100002312 | |||
| 411 | Ga0070672_100070016 | |||
| 412 | Ga0070672_100836734 | |||
| 413 | Ga0070693_100104365 | |||
| 414 | Ga0070665_100000074 | |||
| 415 | Ga0068855_100039122 | |||
| 416 | Ga0068855_100236029 | |||
| 417 | Ga0068855_100389741 | |||
| 418 | Ga0070664_100797326 | |||
| 419 | Ga0068857_100236927 | |||
| 420 | Ga0068854_100571344 | |||
| 421 | Ga0068856_100077693 | |||
| 422 | Ga0068856_100152936 | |||
| 423 | Ga0068856_101032208 | |||
| 424 | Ga0068852_100010350 | |||
| 425 | Ga0068852_100051596 | |||
| 426 | Ga0068852_100319640 | |||
| 427 | Ga0068852_100855619 | |||
| 428 | Ga0068859_100000037 | |||
| 429 | Ga0068864_100448445 | |||
| 430 | Ga0068851_10000199 | |||
| 431 | Ga0068863_100002618 | |||
| 432 | Ga0068863_100059275 | |||
| 433 | Ga0068863_100128907 | |||
| 434 | Ga0068858_100063431 | |||
| 435 | Ga0068860_100013203 | |||
| 436 | Ga0068860_100146917 | |||
| 437 | Ga0075366_10004745 | |||
| 438 | Ga0075366_10020037 | |||
| 439 | Ga0097621_100001069 | |||
| 440 | Ga0097621_100023617 | |||
| 441 | Ga0097621_100357795 | |||
| 442 | Ga0075370_10171272 | |||
| 443 | Ga0068871_100018879 | |||
| 444 | Ga0068871_100024861 | |||
| 445 | Ga0068871_100391214 | |||
| 446 | Ga0068871_100413561 | |||
| 447 | Ga0075428_100032709 | |||
| 448 | Ga0075431_100640424 | |||
| 449 | Ga0068865_100110772 | |||
| 450 | Ga0068865_100997603 | |||
| 451 | Ga0097620_100000037 | |||
| 452 | Ga0097620_100149718 | |||
| 453 | Ga0105240_10000008 | |||
| 454 | Ga0105240_10000059 | |||
| 455 | Ga0105240_10031339 | |||
| 456 | Ga0105240_10045664 | |||
| 457 | Ga0105240_10537814 | |||
| 458 | Ga0105245_10138867 | |||
| 459 | Ga0105243_10000009 | |||
| 460 | Ga0105243_10035623 | |||
| 461 | Ga0105241_10001055 | |||
| 462 | Ga0105241_10040370 | |||
| 463 | Ga0105241_11548588 | |||
| 464 | Ga0105242_10201205 | |||
| 465 | Ga0105242_10324989 | |||
| 466 | Ga0105242_11123533 | |||
| 467 | Ga0105248_10111698 | |||
| 468 | Ga0105248_11993551 | |||
| 469 | Ga0105237_10001973 | |||
| 470 | Ga0105237_10124822 | |||
| 471 | Ga0105237_10353493 | |||
| 472 | Ga0105238_10343678 | |||
| 473 | Ga0105238_12086372 | |||
| 474 | Ga0105249_10001713 | |||
| 475 | Ga0105249_10017145 | |||
| 476 | Ga0105249_10162789 | |||
| 477 | Ga0105239_10001797 | |||
| 478 | Ga0105239_10009494 | |||
| 479 | Ga0105239_10091532 | |||
| 480 | Ga0105239_10105160 | |||
| 481 | Ga0105239_10657727 | |||
| 482 | Ga0105246_10039683 | |||
| 483 | Ga0157373_10097437 | |||
| 484 | Ga0157371_10065090 | |||
| 485 | Ga0157371_10785763 | |||
| 486 | Ga0157370_10607989 | |||
| 487 | Ga0157369_10117799 | |||
| 488 | Ga0157369_10451285 | |||
| 489 | Ga0157374_11446416 | |||
| 490 | Ga0157378_10004603 | |||
| 491 | Ga0157378_10009754 | |||
| 492 | Ga0157378_10097011 | |||
| 493 | Ga0157378_10131732 | |||
| 494 | Ga0157378_10132506 | |||
| 495 | Ga0157378_10238883 | |||
| 496 | Ga0157378_10516852 | |||
| 497 | Ga0157378_11359926 | |||
| 498 | Ga0163162_10003204 | |||
| 499 | Ga0163162_10003269 | |||
| 500 | Ga0163162_10770041 | |||
| 501 | Ga0157372_10188791 | |||
| 502 | Ga0157372_10441733 | |||
| 503 | Ga0157372_10562360 | |||
| 504 | Ga0157372_10833344 | |||
| 505 | Ga0157375_10000651 | |||
| 506 | Ga0157375_10025535 | |||
| 507 | Ga0157375_11164182 | |||
| 508 | Ga0163163_10259428 | |||
| 509 | Ga0163163_10291118 | |||
| 510 | Ga0157380_10036613 | |||
| 511 | Ga0157379_10253315 | |||
| 512 | Ga0157379_10358300 | |||
| 513 | Ga0157376_10008723 | |||
| 514 | Ga0157376_10012276 | |||
| 515 | Ga0157376_10062153 | |||
| 516 | Ga0157376_10274632 | |||
| 517 | Ga0157376_10306189 | |||
| 518 | Ga0182006_1005231 | |||
| 519 | Ga0182005_1075241 | |||
| 520 | Ga0163161_10107243 | |||
| 521 | Ga0163161_10198758 | |||
| 522 | Ga0213876_10360355 | |||
| 523 | Ga0209026_1004405 | |||
| 524 | Ga0209257_1000511 | |||
| 525 | Ga0207680_10000619 | |||
| 526 | Ga0207654_10043215 | |||
| 527 | Ga0207707_10007687 | |||
| 528 | Ga0207707_10065197 | |||
| 529 | Ga0207695_10000021 | |||
| 530 | Ga0207695_10000039 | |||
| 531 | Ga0207695_10000073 | |||
| 532 | Ga0207695_10069478 | |||
| 533 | Ga0207671_10002513 | |||
| 534 | Ga0207671_10086893 | |||
| 535 | Ga0207660_10076271 | |||
| 536 | Ga0207662_10256441 | |||
| 537 | Ga0207652_10011055 | |||
| 538 | Ga0207652_10056839 | |||
| 539 | Ga0207652_10071284 | |||
| 540 | Ga0207681_10100275 | |||
| 541 | Ga0207694_10724861 | |||
| 542 | Ga0207650_10075515 | |||
| 543 | Ga0207650_10164359 | |||
| 544 | Ga0207650_10387886 | |||
| 545 | Ga0207709_10000026 | |||
| 546 | Ga0207670_10047418 | |||
| 547 | Ga0207669_10225036 | |||
| 548 | Ga0207704_10059755 | |||
| 549 | Ga0207689_10004234 | |||
| 550 | Ga0207661_10068907 | |||
| 551 | Ga0207661_10929707 | |||
| 552 | Ga0207667_10004126 | |||
| 553 | Ga0207667_10004578 | |||
| 554 | Ga0207667_10014742 | |||
| 555 | Ga0207667_10029581 | |||
| 556 | Ga0207651_10828521 | |||
| 557 | Ga0207712_10036617 | |||
| 558 | Ga0207712_10117236 | |||
| 559 | Ga0207658_10049238 | |||
| 560 | Ga0207658_10098083 | |||
| 561 | Ga0207658_10398611 | |||
| 562 | Ga0207677_10492663 | |||
| 563 | Ga0207703_10037552 | |||
| 564 | Ga0207639_10013384 | |||
| 565 | Ga0207702_10211173 | |||
| 566 | Ga0207641_10000226 | |||
| 567 | Ga0207641_10022489 | |||
| 568 | Ga0207641_10414230 | |||
| 569 | Ga0207676_10368723 | |||
| 570 | Ga0207676_10680045 | |||
| 571 | Ga0207676_10931421 | |||
| 572 | Ga0207698_10023281 | |||
| 573 | Ga0207698_10059510 | |||
| 574 | Ga0268266_10000010 | |||
| 575 | Ga0268264_10009695 | |||
| 576 | Ga0268264_10125135 | |||
| 577 | Ga0265318_10078372 | |||
| 578 | Ga0307517_10001115 | |||
| 579 | Ga0307515_10000469 | |||
| 580 | Ga0307515_10216575 | |||
| 581 | Ga0307515_10354443 | |||
| 582 | Ga0265338_10000658 | |||
| 583 | Ga0265338_10000703 | |||
| 584 | Ga0316177_1006807 | |||
| 585 | Ga0316176_1209624 | |||
| 586 | Ga0316183_1095896 | |||
| 587 | Ga0316181_1224191 | |||
| 588 | Ga0265327_10059354 | |||
| 589 | Ga0307513_10126199 | |||
| 590 | Ga0307509_10116592 | |||
| 591 | Ga0307509_10204227 | |||
| 592 | Ga0307408_100145348 | |||
| 593 | Ga0307508_10067215 | |||
| 594 | Ga0316576_10003339 | |||
| 595 | Ga0316578_10090842 | |||
| 596 | Ga0316578_10121832 | |||
| 597 | Ga0307413_10024227 | |||
| 598 | Ga0307410_10139976 | |||
| 599 | Ga0307412_10088565 | |||
| 600 | Ga0307416_100022237 | |||
| 601 | Ga0307414_11065306 | |||
| 602 | Ga0307415_100222592 | |||
| 603 | Ga0316580_10088192 | |||
| 604 | Ga0307510_10058276 | |||
| 605 | Ga0373937_1294353 | |||
| 606 | Ga0316584_0060092 | |||
| 607 | Ga0316584_0108382 | |||
| 608 | Ga0395899_0000002 | |||
| 609 | Ga0395905_0317514 | |||
| 610 | Ga0400490_45660 | |||
| 611 | Ga0400489_12410 | |||
| 612 | Ga0436365_0966128 | |||
| 613 | Ga0451795_0714795 | |||
| 614 | Ga0451795_0962500 | |||
| 615 | Ga0451855_0851418 | |||
| 616 | Ga0439449_0046986 | |||
| 617 | Ga0451577_0012740 | |||
| 618 | Ga0451577_0022051 | |||
| 619 | Ga0451577_0111372 | |||
| 620 | Ga0451577_0256001 | |||
| 621 | Ga0451577_1047458 | |||
| 622 | Ga0466972_0000422 | |||
| 623 | Ga0453683_0000022 | |||
| 624 | Ga0453683_0131134 | |||
| 625 | Ga0453684_0001188 | |||
| 626 | Ga0453684_0026073 | |||
| 627 | Ga0453684_0026833 | |||
| 628 | Ga0453684_0029715 | |||
| 629 | Ga0453684_0035266 | |||
| 630 | Ga0453684_0058174 | |||
| 631 | Ga0453684_0909603 | |||
| 632 | Ga0466971_0068267 | |||
| 633 | Ga0466970_0001701 | |||
| 634 | Ga0466970_0284138 | |||
| 635 | Ga0466957_0402126 | |||
| 636 | Ga0466959_0009892 | |||
| 637 | Ga0451576_0031425 | |||
| 638 | Ga0451576_0034626 | |||
| 639 | Ga0451576_0099830 | |||
| 640 | Ga0451576_0263371 | |||
| 641 | Ga0495592_0207953 | |||
| 642 | Ga0495638_0040748 | |||
| 643 | Ga0495644_0005560 | |||
| 644 | Ga0495640_0228662 | |||
| 645 | Ga0495621_0037833 | |||
| 646 | Ga0495633_0058909 | |||
| 647 | Ga0495668_0000803 | |||
| 648 | Ga0495611_0000135 | |||
| 649 | Ga0495661_0000739 | |||
| 650 | Ga0495661_0212085 | |||
| 651 | Ga0495670_0303124 | |||
| 652 | Ga0495600_0327823 | |||
| 653 | Ga0495680_0208920 | |||
| 654 | Ga0495686_0000046 | |||
| 655 | Ga0495686_0000994 | |||
| 656 | Ga0495686_0001722 | |||
| 657 | Ga0496114_0465884 | |||
| 658 | Ga0496116_0005201 | |||
| 659 | Ga0496117_0001253 | |||
| 660 | Ga0496122_0001580 | |||
| 661 | Ga0496123_0020365 | |||
| 662 | Ga0496126_0021576 | |||
| 663 | Ga0501298_032926 | |||
| 664 | Ga0501033_0163773 | |||
| 665 | Ga0501034_0014527 | |||
| 666 | Ga0501038_0190619 | |||
| 667 | Ga0501038_0352107 | |||
| 668 | Ga0501040_0098211 | |||
| 669 | Ga0501069_0053413 | |||
| 670 | Ga0501069_0233134 | |||
| 671 | Ga0501070_0273291 | |||
| 672 | Ga0501070_0465467 | |||
| 673 | Ga0501072_0240910 | |||
| 674 | Ga0501074_0223372 | |||
| 675 | Ga0501202_008420 | |||
| 676 | Ga0501217_233112 | |||
| 677 | Ga0501222_009114 | |||
| 678 | Ga0501223_049822 | |||
| 679 | Ga0501233_018231 | |||
| 680 | Ga0501235_030590 | |||
| 681 | Ga0501240_063734 | |||
| 682 | Ga0501252_002700 | |||
| 683 | Ga0501256_005979 | |||
| 684 | Ga0501261_011823 | |||
| 685 | Ga0501221_000389 | |||
| 686 | Ga0501225_0072148 | |||
| 687 | Ga0501245_006461 | |||
| 688 | Ga0501080_0327256 | |||
| 689 | Ga0501241_002066 | |||
| 690 | Ga0501269_002172 | |||
| 691 | Ga0501279_045385 | |||
| 692 | Ga0501044_0021995 | |||
| 693 | Ga0501044_0048562 | |||
| 694 | Ga0501044_0642092 | |||
| 695 | Ga0501044_0665701 | |||
| 696 | nmdc:mga0k408_44809_c1 | |||
| 697 | nmdc:mga09592_16706_c1 | |||
| 698 | Ga0500583_0022964 | |||
| 699 | Ga0500641_0109976 | |||
| 700 | Ga0500562_000017 | |||
| 701 | Ga0500642_0237921 | |||
| 702 | Ga0500616_0002130 | |||
| 703 | Ga0500622_0000303 | |||
| 704 | Ga0500622_0000960 | |||
| 705 | Ga0500622_0005533 | |||
| 706 | Ga0500627_0015389 | |||
| 707 | Ga0500645_023886 | |||
| 708 | Ga0501084_0027666 | |||
| 709 | Ga0500661_019459 | |||
| 710 | Ga0501082_0205274 | |||
| 711 | 2722726032 | |||
| 712 | 2819574451 | |||
| 713 | 2819678661 | |||
| 714 | 2821137828 | |||
| 715 | 2842905853 | |||
| 716 | 2852625280 | |||
| 717 | 2881957237 | |||
| 718 | 2884934293 | |||
| 719 | 2896319360 | |||
| 720 | 2896344226 | |||
| 721 | 2904467421 | |||
| 722 | 2904782636 | |||
| 723 | 2919180246 | |||
| 724 | 2929157324 | |||
| 725 | 2977233628 | |||
| 726 | 3003233460 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3aje-assembly1.cif.gz_A | crystal structure of s. tokodaii sua5 complexed with l-threonine and amppnp | 0.9034 | 3 | 180 |
| 6f89-assembly2.cif.gz_B | structure of h234a/y235a p.abyssi sua5 | 0.9008 | 2 | 182 |
| 2eqa-assembly1.cif.gz_A | crystal structure of the hypothetical sua5 protein from sulfolobus tokodaii | 0.8973 | 4 | 191 |
| 6f87-assembly3.cif.gz_C | crystal structure of p. abyssi sua5 complexed with l-threonine and ppi | 0.8906 | 2 | 181 |
| 6f89-assembly1.cif.gz_A | structure of h234a/y235a p.abyssi sua5 | 0.8825 | 1 | 182 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_F1R994_49_249_3.90.870.10 | Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase | 0.9019 | 8 | 192 | 3.90.870.10 |
| 4e1bA01 | Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase | 0.899 | 4 | 191 | 3.90.870.10 |
| af_A0A1D8PQL4_32_243_3.90.870.10 | Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase | 0.8861 | 4 | 180 | 3.90.870.10 |
| 1kk9A00 | Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase | 0.8798 | 4 | 192 | 3.90.870.10 |
| af_P9WGC9_2_211_3.90.870.10 | Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase | 0.879 | 8 | 191 | 3.90.870.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3UCM4-F1-model_v4 | L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) | 0.9936 | 8 | 163 |
GO:0000049
GO:0003725 GO:0005737 GO:0006450 GO:0008033 GO:0016779 |
| AF-A0A4Q3E5B6-F1-model_v4 | L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) | 0.9934 | 7 | 141 |
GO:0000049
GO:0003725 GO:0005737 GO:0006450 GO:0008033 GO:0016779 |
| AF-A0A4Q3F7R2-F1-model_v4 | L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) | 0.9923 | 7 | 168 |
GO:0000049
GO:0003725 GO:0005737 GO:0006450 GO:0008033 GO:0016779 |
| AF-A0A077XMY6-F1-model_v4 | L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) | 0.9908 | 69 | 192 |
GO:0000049
GO:0003725 GO:0005737 GO:0006450 GO:0008033 GO:0016779 |
| AF-A0A101HFF6-F1-model_v4 | L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) | 0.9892 | 6 | 192 |
GO:0000049
GO:0003725 GO:0005737 GO:0006450 GO:0008033 GO:0016779 |