F423016

General Info

Members Datasets Scaffolds Average Seq Length
363 231 726 189

Family's Representative Sequence

Representative Sequence 3300031730|Ga0307516_10001143|Ga0307516_100011435
Length 212
Sequence MLCRYREIACIFARNVHLPKTSNLEFQTDIENCLKVLHAGGLILYPTDTVWGIGCDATNPIAVKAVYGLKRRDESKSLIVLMADERDVLKYISAPDLRIFEFLHTVQKPTTVIYEGPVGLAENLTGSDGTIAIRLVDEPFCKHLIKRFRKPLVSTSANISGSPAPAFFGEVGATVREGVDYIVRYRQDDDLPKQPSAVVKWNKDASVMVLRS

Samples

Sample ID Description Type Environment
1 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
80 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
83 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
84 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
116 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
117 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
118 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
119 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
120 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
121 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
122 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
123 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
124 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
125 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
128 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
129 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
130 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
131 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
137 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
138 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
139 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
140 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
143 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
146 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
147 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
148 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
149 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
150 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
151 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
152 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
153 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
154 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
155 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
156 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
157 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
158 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
159 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
160 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
161 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
162 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
163 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
164 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
165 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
166 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
167 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
168 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
169 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
172 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
173 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
174 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
175 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
176 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
177 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
182 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
183 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
184 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
185 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
186 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
187 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
188 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
189 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
190 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
191 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
192 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
193 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
194 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
195 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
196 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
197 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
198 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
199 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
200 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
201 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
202 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
203 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
204 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
205 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
206 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
207 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
208 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
209 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
210 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
211 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
212 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
213 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
214 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
215 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
216 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
217 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
218 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
219 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
220 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
221 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
222 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
223 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
224 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
225 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
226 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
227 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
228 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
229 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
230 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
231 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.77
Metatranscriptomes 0.83
Isolates 4.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.23
Nodule 0
Rhizoplane 0.83
Rhizosphere 84.85
Stem 0
Stem Tuber 0
Unclassified 11.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307516_10001143 3300031730 Bacteria 37055
2 SwRhRL2b_contig_210851 2162886007 Bacteria 1088
3 SwRhRL2b_contig_3634020 2162886007 Bacteria 2028
4 JGI24737J22298_10060400 3300001990 Bacteria 1141
5 JGI25162J39368_1000107 3300002737 Bacteria 90782
6 JGI25162J39368_1001620 3300002737 Bacteria 11286
7 rootH2_10013110 3300003320 Bacteria 45132
8 rootH2_10019063 3300003320 Bacteria 8406
9 rootL2_10166616 3300003322 Bacteria 2709
10 rootH1_10162919 3300003323 Bacteria 5611
11 Ga0055531_10005359 3300003794 Bacteria 7520
12 Ga0058863_10827685 3300004799 Bacteria 2092
13 Ga0058861_11293557 3300004800 Bacteria 1546
14 Ga0058862_10780518 3300004803 Bacteria 794
15 Ga0065714_10096761 3300005288 Bacteria 1753
16 Ga0065712_10078098 3300005290 Bacteria 3378
17 Ga0070658_10532121 3300005327 Bacteria 1016
18 Ga0070683_100014276 3300005329 Bacteria 6944
19 Ga0070683_101021950 3300005329 Bacteria 794
20 Ga0070670_100033402 3300005331 Bacteria 4431
21 Ga0070670_100042195 3300005331 Bacteria 3921
22 Ga0070670_100403386 3300005331 Bacteria 1207
23 Ga0070670_100571901 3300005331 Bacteria 1009
24 Ga0068869_100100310 3300005334 Bacteria 2189
25 Ga0070680_100035828 3300005336 Bacteria 4007
26 Ga0070680_100233629 3300005336 Bacteria 1553
27 Ga0068868_101109250 3300005338 Bacteria 728
28 Ga0070689_100056938 3300005340 Bacteria 3033
29 Ga0070689_100235857 3300005340 Bacteria 1505
30 Ga0070691_10200247 3300005341 Bacteria 1049
31 Ga0070692_10523971 3300005345 Unclassified 772
32 Ga0070668_100079169 3300005347 Unclassified 2573
33 Ga0070668_100627577 3300005347 Bacteria 942
34 Ga0070671_100138763 3300005355 Bacteria 2051
35 Ga0070671_100767380 3300005355 Bacteria 838
36 Ga0070673_100303198 3300005364 Bacteria 1407
37 Ga0070688_100058278 3300005365 Bacteria 2431
38 Ga0070688_100421249 3300005365 Bacteria 992
39 Ga0070667_100019703 3300005367 Bacteria 5596
40 Ga0070667_100025692 3300005367 Bacteria 4897
41 Ga0070681_10008789 3300005458 Bacteria 9914
42 Ga0070681_10010876 3300005458 Bacteria 8995
43 Ga0070681_10099765 3300005458 Bacteria 2849
44 Ga0070685_10035569 3300005466 Bacteria 2810
45 Ga0070679_100029098 3300005530 Bacteria 5449
46 Ga0070679_100105604 3300005530 Bacteria 2803
47 Ga0070684_100002312 3300005535 Bacteria 14048
48 Ga0070672_100070016 3300005543 Bacteria 2786
49 Ga0070672_100836734 3300005543 Unclassified 811
50 Ga0070693_100104365 3300005547 Bacteria 1732
51 Ga0070665_100000074 3300005548 Bacteria 192944
52 Ga0068855_100039122 3300005563 Bacteria 5630
53 Ga0068855_100236029 3300005563 Bacteria 2045
54 Ga0068855_100389741 3300005563 Bacteria 1528
55 Ga0070664_100797326 3300005564 Bacteria 883
56 Ga0068857_100236927 3300005577 Bacteria 1670
57 Ga0068854_100571344 3300005578 Unclassified 962
58 Ga0068856_100077693 3300005614 Bacteria 3290
59 Ga0068856_100152936 3300005614 Unclassified 2316
60 Ga0068856_101032208 3300005614 Bacteria 840
61 Ga0068852_100010350 3300005616 Bacteria 6966
62 Ga0068852_100051596 3300005616 Bacteria 3531
63 Ga0068852_100319640 3300005616 Bacteria 1507
64 Ga0068852_100855619 3300005616 Bacteria 925
65 Ga0068859_100000037 3300005617 Bacteria 165480
66 Ga0068864_100448445 3300005618 Bacteria 1234
67 Ga0068851_10000199 3300005834 Bacteria 28976
68 Ga0068863_100002618 3300005841 Bacteria 17840
69 Ga0068863_100059275 3300005841 Bacteria 3622
70 Ga0068863_100128907 3300005841 Bacteria 2414
71 Ga0068858_100063431 3300005842 Bacteria 3419
72 Ga0068860_100013203 3300005843 Bacteria 8103
73 Ga0068860_100146917 3300005843 Unclassified 2269
74 Ga0075366_10004745 3300006195 Bacteria 7325
75 Ga0075366_10020037 3300006195 Bacteria 3878
76 Ga0097621_100001069 3300006237 Bacteria 19149
77 Ga0097621_100023617 3300006237 Bacteria 4789
78 Ga0097621_100357795 3300006237 Bacteria 1300
79 Ga0075370_10171272 3300006353 Bacteria 1276
80 Ga0068871_100018879 3300006358 Bacteria 5254
81 Ga0068871_100024861 3300006358 Bacteria 4651
82 Ga0068871_100391214 3300006358 Bacteria 1237
83 Ga0068871_100413561 3300006358 Unclassified 1203
84 Ga0075428_100032709 3300006844 Bacteria 5744
85 Ga0075431_100640424 3300006847 Bacteria 1044
86 Ga0068865_100110772 3300006881 Unclassified 2025
87 Ga0068865_100997603 3300006881 Bacteria 733
88 Ga0097620_100000037 3300006931 Bacteria 165480
89 Ga0097620_100149718 3300006931 Unclassified 2410
90 Ga0105240_10000008 3300009093 Bacteria 618862
91 Ga0105240_10000059 3300009093 Bacteria 219860
92 Ga0105240_10031339 3300009093 Bacteria 6897
93 Ga0105240_10045664 3300009093 Bacteria 5556
94 Ga0105240_10537814 3300009093 Bacteria 1294
95 Ga0105245_10138867 3300009098 Unclassified 2287
96 Ga0105243_10000009 3300009148 Bacteria 354419
97 Ga0105243_10035623 3300009148 Unclassified 3859
98 Ga0105241_10001055 3300009174 Bacteria 20990
99 Ga0105241_10040370 3300009174 Bacteria 3523
100 Ga0105241_11548588 3300009174 Bacteria 639
101 Ga0105242_10201205 3300009176 Bacteria 1769
102 Ga0105242_10324989 3300009176 Bacteria 1412
103 Ga0105242_11123533 3300009176 Bacteria 801
104 Ga0105248_10111698 3300009177 Bacteria 3082
105 Ga0105248_11993551 3300009177 Bacteria 659
106 Ga0105237_10001973 3300009545 Bacteria 26110
107 Ga0105237_10124822 3300009545 Unclassified 2569
108 Ga0105237_10353493 3300009545 Bacteria 1474
109 Ga0105238_10343678 3300009551 Bacteria 1481
110 Ga0105238_12086372 3300009551 Unclassified 601
111 Ga0105249_10001713 3300009553 Bacteria 19174
112 Ga0105249_10017145 3300009553 Bacteria 6429
113 Ga0105249_10162789 3300009553 Unclassified 2157
114 Ga0105239_10001797 3300010375 Bacteria 28154
115 Ga0105239_10009494 3300010375 Bacteria 10957
116 Ga0105239_10091532 3300010375 Bacteria 3356
117 Ga0105239_10105160 3300010375 Bacteria 3126
118 Ga0105239_10657727 3300010375 Bacteria 1197
119 Ga0105246_10039683 3300011119 Unclassified 3173
120 Ga0157373_10097437 3300013100 Bacteria 2070
121 Ga0157371_10065090 3300013102 Bacteria 2581
122 Ga0157371_10785763 3300013102 Bacteria 717
123 Ga0157370_10607989 3300013104 Unclassified 1001
124 Ga0157369_10117799 3300013105 Bacteria 2819
125 Ga0157369_10451285 3300013105 Bacteria 1331
126 Ga0157374_11446416 3300013296 Bacteria 710
127 Ga0157378_10004603 3300013297 Bacteria 12099
128 Ga0157378_10009754 3300013297 Bacteria 8368
129 Ga0157378_10097011 3300013297 Bacteria 2686
130 Ga0157378_10131732 3300013297 Bacteria 2315
131 Ga0157378_10132506 3300013297 Bacteria 2308
132 Ga0157378_10238883 3300013297 Bacteria 1735
133 Ga0157378_10516852 3300013297 Bacteria 1195
134 Ga0157378_11359926 3300013297 Bacteria 752
135 Ga0163162_10003204 3300013306 Bacteria 15653
136 Ga0163162_10003269 3300013306 Bacteria 15507
137 Ga0163162_10770041 3300013306 Bacteria 1081
138 Ga0157372_10188791 3300013307 Bacteria 2387
139 Ga0157372_10441733 3300013307 Bacteria 1516
140 Ga0157372_10562360 3300013307 Bacteria 1329
141 Ga0157372_10833344 3300013307 Bacteria 1071
142 Ga0157375_10000651 3300013308 Bacteria 30698
143 Ga0157375_10025535 3300013308 Bacteria 5491
144 Ga0157375_11164182 3300013308 Bacteria 904
145 Ga0163163_10259428 3300014325 Unclassified 1789
146 Ga0163163_10291118 3300014325 Bacteria 1685
147 Ga0157380_10036613 3300014326 Bacteria 3798
148 Ga0157379_10253315 3300014968 Unclassified 1598
149 Ga0157379_10358300 3300014968 Bacteria 1336
150 Ga0157376_10008723 3300014969 Bacteria 7326
151 Ga0157376_10012276 3300014969 Bacteria 6353
152 Ga0157376_10062153 3300014969 Unclassified 3142
153 Ga0157376_10274632 3300014969 Bacteria 1585
154 Ga0157376_10306189 3300014969 Bacteria 1506
155 Ga0182006_1005231 3300015261 Bacteria 6217
156 Ga0182005_1075241 3300015265 Bacteria 929
157 Ga0163161_10107243 3300017792 Bacteria 2085
158 Ga0163161_10198758 3300017792 Bacteria 1544
159 Ga0213876_10360355 3300021384 Bacteria 773
160 Ga0209026_1004405 3300025250 Bacteria 4184
161 Ga0209257_1000511 3300025304 Bacteria 67499
162 Ga0207680_10000619 3300025903 Bacteria 16749
163 Ga0207654_10043215 3300025911 Unclassified 2554
164 Ga0207707_10007687 3300025912 Bacteria 9388
165 Ga0207707_10065197 3300025912 Bacteria 3172
166 Ga0207695_10000021 3300025913 Bacteria 679399
167 Ga0207695_10000039 3300025913 Bacteria 454801
168 Ga0207695_10000073 3300025913 Bacteria 312565
169 Ga0207695_10069478 3300025913 Bacteria 3604
170 Ga0207671_10002513 3300025914 Bacteria 19573
171 Ga0207671_10086893 3300025914 Bacteria 2351
172 Ga0207660_10076271 3300025917 Bacteria 2451
173 Ga0207662_10256441 3300025918 Bacteria 1150
174 Ga0207652_10011055 3300025921 Bacteria 7275
175 Ga0207652_10056839 3300025921 Bacteria 3369
176 Ga0207652_10071284 3300025921 Bacteria 3019
177 Ga0207681_10100275 3300025923 Bacteria 2087
178 Ga0207694_10724861 3300025924 Bacteria 839
179 Ga0207650_10075515 3300025925 Bacteria 2544
180 Ga0207650_10164359 3300025925 Bacteria 1760
181 Ga0207650_10387886 3300025925 Bacteria 1154
182 Ga0207709_10000026 3300025935 Bacteria 354467
183 Ga0207670_10047418 3300025936 Bacteria 2861
184 Ga0207669_10225036 3300025937 Bacteria 1380
185 Ga0207704_10059755 3300025938 Unclassified 2355
186 Ga0207689_10004234 3300025942 Bacteria 13052
187 Ga0207661_10068907 3300025944 Unclassified 2882
188 Ga0207661_10929707 3300025944 Bacteria 801
189 Ga0207667_10004126 3300025949 Bacteria 17853
190 Ga0207667_10004578 3300025949 Bacteria 16953
191 Ga0207667_10014742 3300025949 Bacteria 8895
192 Ga0207667_10029581 3300025949 Bacteria 5938
193 Ga0207651_10828521 3300025960 Bacteria 821
194 Ga0207712_10036617 3300025961 Bacteria 3343
195 Ga0207712_10117236 3300025961 Bacteria 2008
196 Ga0207658_10049238 3300025986 Bacteria 3095
197 Ga0207658_10098083 3300025986 Unclassified 2289
198 Ga0207658_10398611 3300025986 Bacteria 1209
199 Ga0207677_10492663 3300026023 Bacteria 1058
200 Ga0207703_10037552 3300026035 Bacteria 3859
201 Ga0207639_10013384 3300026041 Bacteria 5742
202 Ga0207702_10211173 3300026078 Bacteria 1804
203 Ga0207641_10000226 3300026088 Bacteria 72539
204 Ga0207641_10022489 3300026088 Bacteria 5188
205 Ga0207641_10414230 3300026088 Unclassified 1296
206 Ga0207676_10368723 3300026095 Bacteria 1333
207 Ga0207676_10680045 3300026095 Bacteria 995
208 Ga0207676_10931421 3300026095 Bacteria 853
209 Ga0207698_10023281 3300026142 Bacteria 4324
210 Ga0207698_10059510 3300026142 Bacteria 2967
211 Ga0268266_10000010 3300028379 Bacteria 1030233
212 Ga0268264_10009695 3300028381 Bacteria 7975
213 Ga0268264_10125135 3300028381 Unclassified 2271
214 Ga0265318_10078372 3300028577 Bacteria 1221
215 Ga0307517_10001115 3300028786 Bacteria 45308
216 Ga0307515_10000469 3300028794 Bacteria 96345
217 Ga0307515_10216575 3300028794 Bacteria 1744
218 Ga0307515_10354443 3300028794 Bacteria 1112
219 Ga0265338_10000658 3300028800 Bacteria 59815
220 Ga0265338_10000703 3300028800 Bacteria 57346
221 Ga0316177_1006807 3300030731 Bacteria 14319
222 Ga0316176_1209624 3300030732 Bacteria 24194
223 Ga0316183_1095896 3300030742 Bacteria 133299
224 Ga0316181_1224191 3300030744 Bacteria 23228
225 Ga0265327_10059354 3300031251 Bacteria 1959
226 Ga0307513_10126199 3300031456 Unclassified 2514
227 Ga0307509_10116592 3300031507 Unclassified 2660
228 Ga0307509_10204227 3300031507 Bacteria 1808
229 Ga0307408_100145348 3300031548 Bacteria 1866
230 Ga0307508_10067215 3300031616 Bacteria 3153
231 Ga0316576_10003339 3300031727 Bacteria 9385
232 Ga0316578_10090842 3300031728 Bacteria 1823
233 Ga0316578_10121832 3300031728 Bacteria 1568
234 Ga0307413_10024227 3300031824 Bacteria 3306
235 Ga0307410_10139976 3300031852 Bacteria 1789
236 Ga0307412_10088565 3300031911 Bacteria 2160
237 Ga0307416_100022237 3300032002 Unclassified 4573
238 Ga0307414_11065306 3300032004 Bacteria 746
239 Ga0307415_100222592 3300032126 Bacteria 1514
240 Ga0316580_10088192 3300032139 Bacteria 949
241 Ga0307510_10058276 3300033180 Bacteria 4000
242 Ga0373937_1294353 3300036401 Unclassified 677
243 Ga0316584_0060092 3300036712 Bacteria 2846
244 Ga0316584_0108382 3300036712 Bacteria 2078
245 Ga0395899_0000002 3300037312 Bacteria 1324310
246 Ga0395905_0317514 3300037471 Bacteria 1447
247 Ga0400490_45660 3300038726 Bacteria 57177
248 Ga0400489_12410 3300039093 Bacteria 1906
249 Ga0436365_0966128 3300039437 Bacteria 792
250 Ga0451795_0714795 3300041456 Bacteria 957
251 Ga0451795_0962500 3300041456 Bacteria 963
252 Ga0451855_0851418 3300041511 Bacteria 1137
253 Ga0439449_0046986 3300042007 Bacteria 1599
254 Ga0451577_0012740 3300042876 Bacteria 7889
255 Ga0451577_0022051 3300042876 Bacteria 5819
256 Ga0451577_0111372 3300042876 Unclassified 2449
257 Ga0451577_0256001 3300042876 Unclassified 1585
258 Ga0451577_1047458 3300042876 Bacteria 731
259 Ga0466972_0000422 3300044658 Bacteria 21982
260 Ga0453683_0000022 3300044673 Bacteria 269593
261 Ga0453683_0131134 3300044673 Unclassified 1579
262 Ga0453684_0001188 3300044712 Bacteria 80449
263 Ga0453684_0026073 3300044712 Bacteria 8461
264 Ga0453684_0026833 3300044712 Bacteria 8299
265 Ga0453684_0029715 3300044712 Bacteria 7748
266 Ga0453684_0035266 3300044712 Bacteria 6919
267 Ga0453684_0058174 3300044712 Bacteria 4995
268 Ga0453684_0909603 3300044712 Bacteria 942
269 Ga0466971_0068267 3300044719 Unclassified 1612
270 Ga0466970_0001701 3300044765 Bacteria 10578
271 Ga0466970_0284138 3300044765 Bacteria 931
272 Ga0466957_0402126 3300044842 Bacteria 937
273 Ga0466959_0009892 3300045049 Bacteria 6797
274 Ga0451576_0031425 3300045051 Bacteria 5660
275 Ga0451576_0034626 3300045051 Bacteria 5363
276 Ga0451576_0099830 3300045051 Bacteria 3019
277 Ga0451576_0263371 3300045051 Unclassified 1802
278 Ga0495592_0207953 3300046454 Bacteria 1316
279 Ga0495638_0040748 3300046460 Bacteria 2942
280 Ga0495644_0005560 3300046523 Bacteria 4919
281 Ga0495640_0228662 3300046533 Bacteria 1171
282 Ga0495621_0037833 3300046539 Bacteria 1680
283 Ga0495633_0058909 3300046558 Bacteria 1802
284 Ga0495668_0000803 3300046616 Bacteria 36102
285 Ga0495611_0000135 3300046648 Bacteria 51495
286 Ga0495661_0000739 3300046665 Bacteria 31861
287 Ga0495661_0212085 3300046665 Bacteria 1008
288 Ga0495670_0303124 3300046691 Bacteria 856
289 Ga0495600_0327823 3300046809 Bacteria 962
290 Ga0495680_0208920 3300047322 Bacteria 1398
291 Ga0495686_0000046 3300047472 Bacteria 281963
292 Ga0495686_0000994 3300047472 Bacteria 34556
293 Ga0495686_0001722 3300047472 Bacteria 22525
294 Ga0496114_0465884 3300048917 Unclassified 1118
295 Ga0496116_0005201 3300048919 Bacteria 12190
296 Ga0496117_0001253 3300048920 Bacteria 37795
297 Ga0496122_0001580 3300048925 Bacteria 35795
298 Ga0496123_0020365 3300048926 Bacteria 5190
299 Ga0496126_0021576 3300048929 Bacteria 6288
300 Ga0501298_032926 3300049521 Unclassified 1025
301 Ga0501033_0163773 3300049570 Bacteria 1600
302 Ga0501034_0014527 3300049571 Bacteria 8108
303 Ga0501038_0190619 3300049574 Bacteria 1650
304 Ga0501038_0352107 3300049574 Bacteria 1147
305 Ga0501040_0098211 3300049576 Bacteria 2041
306 Ga0501069_0053413 3300049585 Bacteria 2250
307 Ga0501069_0233134 3300049585 Bacteria 1072
308 Ga0501070_0273291 3300049586 Bacteria 1379
309 Ga0501070_0465467 3300049586 Bacteria 1018
310 Ga0501072_0240910 3300049588 Bacteria 1441
311 Ga0501074_0223372 3300049590 Bacteria 1341
312 Ga0501202_008420 3300049652 Bacteria 1879
313 Ga0501217_233112 3300049661 Unclassified 586
314 Ga0501222_009114 3300049662 Unclassified 1314
315 Ga0501223_049822 3300049663 Unclassified 813
316 Ga0501233_018231 3300049668 Bacteria 1474
317 Ga0501235_030590 3300049669 Unclassified 1214
318 Ga0501240_063734 3300049673 Unclassified 655
319 Ga0501252_002700 3300049682 Bacteria 1783
320 Ga0501256_005979 3300049685 Bacteria 1088
321 Ga0501261_011823 3300049690 Bacteria 1168
322 Ga0501221_000389 3300049704 Bacteria 6729
323 Ga0501225_0072148 3300049705 Bacteria 982
324 Ga0501245_006461 3300049708 Bacteria 1639
325 Ga0501080_0327256 3300049742 Bacteria 1386
326 Ga0501241_002066 3300049758 Bacteria 3932
327 Ga0501269_002172 3300049766 Bacteria 2443
328 Ga0501279_045385 3300049775 Unclassified 684
329 Ga0501044_0021995 3300049823 Bacteria 6800
330 Ga0501044_0048562 3300049823 Bacteria 4383
331 Ga0501044_0642092 3300049823 Bacteria 951
332 Ga0501044_0665701 3300049823 Bacteria 929
333 nmdc:mga0k408_44809_c1 3300050493 Bacteria 2551
334 nmdc:mga09592_16706_c1 3300050508 Bacteria 6007
335 Ga0500583_0022964 3300053092 Bacteria 2623
336 Ga0500641_0109976 3300053096 Bacteria 1186
337 Ga0500562_000017 3300053108 Bacteria 130556
338 Ga0500642_0237921 3300053130 Bacteria 839
339 Ga0500616_0002130 3300053153 Bacteria 17161
340 Ga0500622_0000303 3300053156 Bacteria 50358
341 Ga0500622_0000960 3300053156 Bacteria 24468
342 Ga0500622_0005533 3300053156 Bacteria 7555
343 Ga0500627_0015389 3300053158 Bacteria 2956
344 Ga0500645_023886 3300053730 Bacteria 1872
345 Ga0501084_0027666 3300054114 Bacteria 4738
346 Ga0500661_019459 3300055283 Bacteria 1209
347 Ga0501082_0205274 3300060353 Bacteria 1714
348 2722726032 2721755487 Bacteria 6357185
349 2819574451 2818991442 Bacteria 8318214
350 2819678661 2818991460 Bacteria 7595395
351 2821137828 2821136567 Bacteria 8080116
352 2842905853 2842903701 Bacteria 6986368
353 2852625280 2852623160 Bacteria 4376875
354 2881957237 2881955468 Bacteria 3545609
355 2884934293 2884933994 Bacteria 4535041
356 2896319360 2896317667 Bacteria 4606601
357 2896344226 2896344016 Bacteria 3811746
358 2904467421 2904467357 Bacteria 8057758
359 2904782636 2904780799 Bacteria 5840761
360 2919180246 2919177583 Bacteria 5641607
361 2929157324 2929154850 Bacteria 6753285
362 2977233628 2977232053 Bacteria 5485925
363 3003233460 3003233435 Bacteria 4458031
364 Ga0307516_10001143
365 SwRhRL2b_contig_210851
366 SwRhRL2b_contig_3634020
367 JGI24737J22298_10060400
368 JGI25162J39368_1000107
369 JGI25162J39368_1001620
370 rootH2_10013110
371 rootH2_10019063
372 rootL2_10166616
373 rootH1_10162919
374 Ga0055531_10005359
375 Ga0058863_10827685
376 Ga0058861_11293557
377 Ga0058862_10780518
378 Ga0065714_10096761
379 Ga0065712_10078098
380 Ga0070658_10532121
381 Ga0070683_100014276
382 Ga0070683_101021950
383 Ga0070670_100033402
384 Ga0070670_100042195
385 Ga0070670_100403386
386 Ga0070670_100571901
387 Ga0068869_100100310
388 Ga0070680_100035828
389 Ga0070680_100233629
390 Ga0068868_101109250
391 Ga0070689_100056938
392 Ga0070689_100235857
393 Ga0070691_10200247
394 Ga0070692_10523971
395 Ga0070668_100079169
396 Ga0070668_100627577
397 Ga0070671_100138763
398 Ga0070671_100767380
399 Ga0070673_100303198
400 Ga0070688_100058278
401 Ga0070688_100421249
402 Ga0070667_100019703
403 Ga0070667_100025692
404 Ga0070681_10008789
405 Ga0070681_10010876
406 Ga0070681_10099765
407 Ga0070685_10035569
408 Ga0070679_100029098
409 Ga0070679_100105604
410 Ga0070684_100002312
411 Ga0070672_100070016
412 Ga0070672_100836734
413 Ga0070693_100104365
414 Ga0070665_100000074
415 Ga0068855_100039122
416 Ga0068855_100236029
417 Ga0068855_100389741
418 Ga0070664_100797326
419 Ga0068857_100236927
420 Ga0068854_100571344
421 Ga0068856_100077693
422 Ga0068856_100152936
423 Ga0068856_101032208
424 Ga0068852_100010350
425 Ga0068852_100051596
426 Ga0068852_100319640
427 Ga0068852_100855619
428 Ga0068859_100000037
429 Ga0068864_100448445
430 Ga0068851_10000199
431 Ga0068863_100002618
432 Ga0068863_100059275
433 Ga0068863_100128907
434 Ga0068858_100063431
435 Ga0068860_100013203
436 Ga0068860_100146917
437 Ga0075366_10004745
438 Ga0075366_10020037
439 Ga0097621_100001069
440 Ga0097621_100023617
441 Ga0097621_100357795
442 Ga0075370_10171272
443 Ga0068871_100018879
444 Ga0068871_100024861
445 Ga0068871_100391214
446 Ga0068871_100413561
447 Ga0075428_100032709
448 Ga0075431_100640424
449 Ga0068865_100110772
450 Ga0068865_100997603
451 Ga0097620_100000037
452 Ga0097620_100149718
453 Ga0105240_10000008
454 Ga0105240_10000059
455 Ga0105240_10031339
456 Ga0105240_10045664
457 Ga0105240_10537814
458 Ga0105245_10138867
459 Ga0105243_10000009
460 Ga0105243_10035623
461 Ga0105241_10001055
462 Ga0105241_10040370
463 Ga0105241_11548588
464 Ga0105242_10201205
465 Ga0105242_10324989
466 Ga0105242_11123533
467 Ga0105248_10111698
468 Ga0105248_11993551
469 Ga0105237_10001973
470 Ga0105237_10124822
471 Ga0105237_10353493
472 Ga0105238_10343678
473 Ga0105238_12086372
474 Ga0105249_10001713
475 Ga0105249_10017145
476 Ga0105249_10162789
477 Ga0105239_10001797
478 Ga0105239_10009494
479 Ga0105239_10091532
480 Ga0105239_10105160
481 Ga0105239_10657727
482 Ga0105246_10039683
483 Ga0157373_10097437
484 Ga0157371_10065090
485 Ga0157371_10785763
486 Ga0157370_10607989
487 Ga0157369_10117799
488 Ga0157369_10451285
489 Ga0157374_11446416
490 Ga0157378_10004603
491 Ga0157378_10009754
492 Ga0157378_10097011
493 Ga0157378_10131732
494 Ga0157378_10132506
495 Ga0157378_10238883
496 Ga0157378_10516852
497 Ga0157378_11359926
498 Ga0163162_10003204
499 Ga0163162_10003269
500 Ga0163162_10770041
501 Ga0157372_10188791
502 Ga0157372_10441733
503 Ga0157372_10562360
504 Ga0157372_10833344
505 Ga0157375_10000651
506 Ga0157375_10025535
507 Ga0157375_11164182
508 Ga0163163_10259428
509 Ga0163163_10291118
510 Ga0157380_10036613
511 Ga0157379_10253315
512 Ga0157379_10358300
513 Ga0157376_10008723
514 Ga0157376_10012276
515 Ga0157376_10062153
516 Ga0157376_10274632
517 Ga0157376_10306189
518 Ga0182006_1005231
519 Ga0182005_1075241
520 Ga0163161_10107243
521 Ga0163161_10198758
522 Ga0213876_10360355
523 Ga0209026_1004405
524 Ga0209257_1000511
525 Ga0207680_10000619
526 Ga0207654_10043215
527 Ga0207707_10007687
528 Ga0207707_10065197
529 Ga0207695_10000021
530 Ga0207695_10000039
531 Ga0207695_10000073
532 Ga0207695_10069478
533 Ga0207671_10002513
534 Ga0207671_10086893
535 Ga0207660_10076271
536 Ga0207662_10256441
537 Ga0207652_10011055
538 Ga0207652_10056839
539 Ga0207652_10071284
540 Ga0207681_10100275
541 Ga0207694_10724861
542 Ga0207650_10075515
543 Ga0207650_10164359
544 Ga0207650_10387886
545 Ga0207709_10000026
546 Ga0207670_10047418
547 Ga0207669_10225036
548 Ga0207704_10059755
549 Ga0207689_10004234
550 Ga0207661_10068907
551 Ga0207661_10929707
552 Ga0207667_10004126
553 Ga0207667_10004578
554 Ga0207667_10014742
555 Ga0207667_10029581
556 Ga0207651_10828521
557 Ga0207712_10036617
558 Ga0207712_10117236
559 Ga0207658_10049238
560 Ga0207658_10098083
561 Ga0207658_10398611
562 Ga0207677_10492663
563 Ga0207703_10037552
564 Ga0207639_10013384
565 Ga0207702_10211173
566 Ga0207641_10000226
567 Ga0207641_10022489
568 Ga0207641_10414230
569 Ga0207676_10368723
570 Ga0207676_10680045
571 Ga0207676_10931421
572 Ga0207698_10023281
573 Ga0207698_10059510
574 Ga0268266_10000010
575 Ga0268264_10009695
576 Ga0268264_10125135
577 Ga0265318_10078372
578 Ga0307517_10001115
579 Ga0307515_10000469
580 Ga0307515_10216575
581 Ga0307515_10354443
582 Ga0265338_10000658
583 Ga0265338_10000703
584 Ga0316177_1006807
585 Ga0316176_1209624
586 Ga0316183_1095896
587 Ga0316181_1224191
588 Ga0265327_10059354
589 Ga0307513_10126199
590 Ga0307509_10116592
591 Ga0307509_10204227
592 Ga0307408_100145348
593 Ga0307508_10067215
594 Ga0316576_10003339
595 Ga0316578_10090842
596 Ga0316578_10121832
597 Ga0307413_10024227
598 Ga0307410_10139976
599 Ga0307412_10088565
600 Ga0307416_100022237
601 Ga0307414_11065306
602 Ga0307415_100222592
603 Ga0316580_10088192
604 Ga0307510_10058276
605 Ga0373937_1294353
606 Ga0316584_0060092
607 Ga0316584_0108382
608 Ga0395899_0000002
609 Ga0395905_0317514
610 Ga0400490_45660
611 Ga0400489_12410
612 Ga0436365_0966128
613 Ga0451795_0714795
614 Ga0451795_0962500
615 Ga0451855_0851418
616 Ga0439449_0046986
617 Ga0451577_0012740
618 Ga0451577_0022051
619 Ga0451577_0111372
620 Ga0451577_0256001
621 Ga0451577_1047458
622 Ga0466972_0000422
623 Ga0453683_0000022
624 Ga0453683_0131134
625 Ga0453684_0001188
626 Ga0453684_0026073
627 Ga0453684_0026833
628 Ga0453684_0029715
629 Ga0453684_0035266
630 Ga0453684_0058174
631 Ga0453684_0909603
632 Ga0466971_0068267
633 Ga0466970_0001701
634 Ga0466970_0284138
635 Ga0466957_0402126
636 Ga0466959_0009892
637 Ga0451576_0031425
638 Ga0451576_0034626
639 Ga0451576_0099830
640 Ga0451576_0263371
641 Ga0495592_0207953
642 Ga0495638_0040748
643 Ga0495644_0005560
644 Ga0495640_0228662
645 Ga0495621_0037833
646 Ga0495633_0058909
647 Ga0495668_0000803
648 Ga0495611_0000135
649 Ga0495661_0000739
650 Ga0495661_0212085
651 Ga0495670_0303124
652 Ga0495600_0327823
653 Ga0495680_0208920
654 Ga0495686_0000046
655 Ga0495686_0000994
656 Ga0495686_0001722
657 Ga0496114_0465884
658 Ga0496116_0005201
659 Ga0496117_0001253
660 Ga0496122_0001580
661 Ga0496123_0020365
662 Ga0496126_0021576
663 Ga0501298_032926
664 Ga0501033_0163773
665 Ga0501034_0014527
666 Ga0501038_0190619
667 Ga0501038_0352107
668 Ga0501040_0098211
669 Ga0501069_0053413
670 Ga0501069_0233134
671 Ga0501070_0273291
672 Ga0501070_0465467
673 Ga0501072_0240910
674 Ga0501074_0223372
675 Ga0501202_008420
676 Ga0501217_233112
677 Ga0501222_009114
678 Ga0501223_049822
679 Ga0501233_018231
680 Ga0501235_030590
681 Ga0501240_063734
682 Ga0501252_002700
683 Ga0501256_005979
684 Ga0501261_011823
685 Ga0501221_000389
686 Ga0501225_0072148
687 Ga0501245_006461
688 Ga0501080_0327256
689 Ga0501241_002066
690 Ga0501269_002172
691 Ga0501279_045385
692 Ga0501044_0021995
693 Ga0501044_0048562
694 Ga0501044_0642092
695 Ga0501044_0665701
696 nmdc:mga0k408_44809_c1
697 nmdc:mga09592_16706_c1
698 Ga0500583_0022964
699 Ga0500641_0109976
700 Ga0500562_000017
701 Ga0500642_0237921
702 Ga0500616_0002130
703 Ga0500622_0000303
704 Ga0500622_0000960
705 Ga0500622_0005533
706 Ga0500627_0015389
707 Ga0500645_023886
708 Ga0501084_0027666
709 Ga0500661_019459
710 Ga0501082_0205274
711 2722726032
712 2819574451
713 2819678661
714 2821137828
715 2842905853
716 2852625280
717 2881957237
718 2884934293
719 2896319360
720 2896344226
721 2904467421
722 2904782636
723 2919180246
724 2929157324
725 2977233628
726 3003233460

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01300

Sua5_yciO_yrdC

Telomere recombination

35

212

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3aje-assembly1.cif.gz_A crystal structure of s. tokodaii sua5 complexed with l-threonine and amppnp 0.9034 3 180
6f89-assembly2.cif.gz_B structure of h234a/y235a p.abyssi sua5 0.9008 2 182
2eqa-assembly1.cif.gz_A crystal structure of the hypothetical sua5 protein from sulfolobus tokodaii 0.8973 4 191
6f87-assembly3.cif.gz_C crystal structure of p. abyssi sua5 complexed with l-threonine and ppi 0.8906 2 181
6f89-assembly1.cif.gz_A structure of h234a/y235a p.abyssi sua5 0.8825 1 182
ID Description Score Start End Superfamily
af_F1R994_49_249_3.90.870.10 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.9019 8 192 3.90.870.10
4e1bA01 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.899 4 191 3.90.870.10
af_A0A1D8PQL4_32_243_3.90.870.10 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.8861 4 180 3.90.870.10
1kk9A00 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.8798 4 192 3.90.870.10
af_P9WGC9_2_211_3.90.870.10 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.879 8 191 3.90.870.10
ID Description Score Start End GO Terms
AF-A0A4Q3UCM4-F1-model_v4 L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) 0.9936 8 163 GO:0000049
GO:0003725
GO:0005737
GO:0006450
GO:0008033
GO:0016779
AF-A0A4Q3E5B6-F1-model_v4 L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) 0.9934 7 141 GO:0000049
GO:0003725
GO:0005737
GO:0006450
GO:0008033
GO:0016779
AF-A0A4Q3F7R2-F1-model_v4 L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) 0.9923 7 168 GO:0000049
GO:0003725
GO:0005737
GO:0006450
GO:0008033
GO:0016779
AF-A0A077XMY6-F1-model_v4 L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) 0.9908 69 192 GO:0000049
GO:0003725
GO:0005737
GO:0006450
GO:0008033
GO:0016779
AF-A0A101HFF6-F1-model_v4 L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) 0.9892 6 192 GO:0000049
GO:0003725
GO:0005737
GO:0006450
GO:0008033
GO:0016779

Map