F423017

General Info

Members Datasets Scaffolds Average Seq Length
363 240 726 208

Family's Representative Sequence

Representative Sequence 3300031824|Ga0307413_10473778|Ga0307413_104737781
Length 252
Sequence MAGVHAWHAAAGFSAAPVVATRAGRRSCGVEFPGRARVRCYTMAKLYFYYSAMNAGKTTTLLQSAHNYRERGMRVAILTPRLDHRDGSGTVASRIGLRADGTAFARDDDLERMVRASIDNNGPLHCVLVDEAQFLSRAQVWQLSEVVDALAVPVLCYGLRTDFRGELFEGSQALLAWADELVEIKTICHSGHKATMTVRVDDRGRAVQAGPQVEIGGNERYLSVSRAEFKKVMRGEGGIDVLQPPLALPDAK

Samples

Sample ID Description Type Environment
1 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
51 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
63 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
64 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
65 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
68 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
71 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
73 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
112 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
113 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
116 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
117 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
118 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
119 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
120 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
121 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
122 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
123 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
124 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
125 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
130 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
131 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
132 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
133 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
134 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
135 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
136 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
137 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
138 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
139 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
140 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
141 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
142 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
143 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
144 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
145 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
146 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
147 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
148 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
149 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
154 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
155 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
156 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
157 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
158 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
159 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
160 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
161 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
162 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
163 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
164 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
165 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
177 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
178 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
179 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
180 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
181 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
182 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
183 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
184 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
185 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
186 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
187 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
188 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
191 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
192 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
193 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
194 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
197 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
198 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
199 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
200 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
201 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
202 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
203 2643221559 Lysobacter sp. Root559 Isolate Unclassified
204 2643221573 Lysobacter sp. Root604 Isolate Unclassified
205 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
206 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
207 2643221586 Lysobacter sp. Root667 Isolate Unclassified
208 2643221593 Lysobacter sp. Root690 Isolate Unclassified
209 2643221612 Lysobacter sp. Root76 Isolate Unclassified
210 2643221695 Lysobacter sp. Root494 Isolate Unclassified
211 2643221720 Lysobacter sp. Root916 Isolate Unclassified
212 2643221727 Lysobacter sp. Root96 Isolate Unclassified
213 2643221728 Lysobacter sp. Root983 Isolate Unclassified
214 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
215 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
216 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
217 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
218 2818991457 Xanthomonas translucens 569 Isolate Unclassified
219 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
220 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
221 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
222 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
223 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
224 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
225 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
226 2919513703 Luteimonas sp. 3794 Isolate Unclassified
227 2919675420 Luteimonas terrae 4099 Isolate Unclassified
228 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
229 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
230 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
231 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
232 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
233 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
234 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
235 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
236 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
237 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
238 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
239 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
240 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.71
Metatranscriptomes 0
Isolates 11.29

Biome Distribution

Category Percentage (%)
Aerial Root 0.28
Bulb 0
Endosphere 12.67
Nodule 0
Rhizoplane 3.58
Rhizosphere 70.25
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307413_10473778 3300031824 Bacteria 999
2 JGI25151J46595_10000127 3300003187 Bacteria 102790
3 JGI25153J46596_10071882 3300003215 Bacteria 892
4 JGI26145J50221_1002193 3300003371 Bacteria 1535
5 Ga0055526_1000012 3300003771 Bacteria 234368
6 Ga0055537_1000234 3300003773 Bacteria 40581
7 Ga0055524_1000037 3300003775 Bacteria 167140
8 Ga0055536_1005695 3300003781 Bacteria 6014
9 Ga0055536_1040492 3300003781 Bacteria 1108
10 Ga0055534_1000006 3300003784 Bacteria 234368
11 Ga0055528_1000006 3300003790 Bacteria 234368
12 Ga0055530_10002380 3300003791 Bacteria 12186
13 Ga0055531_10007082 3300003794 Bacteria 6198
14 Ga0055531_10012533 3300003794 Bacteria 3979
15 Ga0058692_1000225 3300003856 Bacteria 32877
16 Ga0065704_10070571 3300005289 Bacteria 20118
17 Ga0065704_10075961 3300005289 Bacteria 5331
18 Ga0065715_10019621 3300005293 Bacteria 1727
19 Ga0065715_10107168 3300005293 Bacteria 2786
20 Ga0065715_10379663 3300005293 Bacteria 909
21 Ga0070683_100556982 3300005329 Bacteria 1096
22 Ga0070670_100003773 3300005331 Bacteria 12616
23 Ga0068869_100042982 3300005334 Bacteria 3243
24 Ga0070666_10006916 3300005335 Bacteria 6990
25 Ga0070666_10054027 3300005335 Bacteria 2710
26 Ga0070666_10382040 3300005335 Bacteria 1011
27 Ga0070660_100041092 3300005339 Bacteria 3523
28 Ga0070661_100015596 3300005344 Bacteria 5362
29 Ga0070669_100084704 3300005353 Bacteria 2366
30 Ga0070659_100166526 3300005366 Bacteria 1804
31 Ga0070667_100365751 3300005367 Bacteria 1308
32 Ga0070667_100692389 3300005367 Bacteria 943
33 Ga0070713_101132334 3300005436 Bacteria 757
34 Ga0070662_100048654 3300005457 Bacteria 3055
35 Ga0070681_10040246 3300005458 Bacteria 4684
36 Ga0070679_100058872 3300005530 Bacteria 3828
37 Ga0070679_100483345 3300005530 Bacteria 1183
38 Ga0068853_100009077 3300005539 Bacteria 8007
39 Ga0068853_100121620 3300005539 Bacteria 2329
40 Ga0070696_100044022 3300005546 Bacteria 3090
41 Ga0068855_100023342 3300005563 Bacteria 7407
42 Ga0068855_100358717 3300005563 Bacteria 1604
43 Ga0068857_100570200 3300005577 Bacteria 1068
44 Ga0068856_100013133 3300005614 Bacteria 8024
45 Ga0068856_100201934 3300005614 Bacteria 2002
46 Ga0068852_100135568 3300005616 Bacteria 2273
47 Ga0068852_100175465 3300005616 Bacteria 2012
48 Ga0068852_100868618 3300005616 Bacteria 918
49 Ga0068859_100014861 3300005617 Bacteria 7818
50 Ga0068859_100098690 3300005617 Bacteria 2975
51 Ga0068863_100006621 3300005841 Bacteria 11370
52 Ga0068863_100062440 3300005841 Bacteria 3523
53 Ga0068858_100155447 3300005842 Bacteria 2152
54 Ga0068860_100019321 3300005843 Bacteria 6612
55 Ga0075364_10000926 3300006051 Bacteria 15505
56 Ga0075364_10055666 3300006051 Bacteria 2588
57 Ga0097620_100014861 3300006931 Bacteria 7818
58 Ga0097620_100098691 3300006931 Bacteria 2975
59 Ga0105251_10000328 3300009011 Bacteria 47681
60 Ga0105245_10148110 3300009098 Bacteria 2217
61 Ga0105245_10387288 3300009098 Bacteria 1394
62 Ga0105243_10000662 3300009148 Bacteria 34075
63 Ga0105243_10369254 3300009148 Bacteria 1323
64 Ga0105241_10091970 3300009174 Bacteria 2395
65 Ga0105241_10276971 3300009174 Bacteria 1431
66 Ga0105242_10223916 3300009176 Bacteria 1683
67 Ga0105248_10576576 3300009177 Bacteria 1269
68 Ga0105237_10031136 3300009545 Bacteria 5411
69 Ga0105237_10150301 3300009545 Bacteria 2325
70 Ga0105237_10653370 3300009545 Bacteria 1058
71 Ga0105238_10044472 3300009551 Bacteria 4488
72 Ga0105238_10063549 3300009551 Bacteria 3692
73 Ga0105249_10436719 3300009553 Bacteria 1346
74 Ga0105148_100853 3300009978 Bacteria 2239
75 Ga0105035_111439 3300009988 Bacteria 786
76 Ga0105239_10001780 3300010375 Bacteria 28338
77 Ga0105239_10021187 3300010375 Bacteria 7167
78 Ga0105239_10023581 3300010375 Bacteria 6777
79 Ga0105239_10192065 3300010375 Bacteria 2285
80 Ga0105239_10669569 3300010375 Bacteria 1186
81 Ga0105239_11791759 3300010375 Bacteria 711
82 Ga0157370_10008733 3300013104 Bacteria 10899
83 Ga0157370_10201433 3300013104 Bacteria 1846
84 Ga0157369_10025322 3300013105 Bacteria 6587
85 Ga0157374_10018657 3300013296 Bacteria 6126
86 Ga0157374_10047656 3300013296 Bacteria 3974
87 Ga0157378_10000052 3300013297 Bacteria 100769
88 Ga0157372_10008531 3300013307 Bacteria 10880
89 Ga0157375_10645108 3300013308 Bacteria 1215
90 Ga0163163_10000182 3300014325 Bacteria 64629
91 Ga0163163_10036733 3300014325 Bacteria 4760
92 Ga0157379_10038491 3300014968 Bacteria 4267
93 Ga0157376_10106855 3300014969 Bacteria 2456
94 Ga0182006_1009120 3300015261 Bacteria 4459
95 Ga0182005_1002640 3300015265 Bacteria 6314
96 Ga0183360_10002 3300015689 Bacteria 953821
97 Ga0209565_1000002 3300025263 Bacteria 1423083
98 Ga0209565_1009811 3300025263 Bacteria 2402
99 Ga0209673_1000002 3300025273 Bacteria 1423083
100 Ga0209673_1003316 3300025273 Bacteria 9640
101 Ga0209130_1003913 3300025284 Bacteria 5966
102 Ga0209675_1000002 3300025291 Bacteria 1423083
103 Ga0209675_1019225 3300025291 Bacteria 1886
104 Ga0209676_1000063 3300025292 Bacteria 322025
105 Ga0209676_1002572 3300025292 Bacteria 12532
106 Ga0209676_1006065 3300025292 Bacteria 6085
107 Ga0209025_1000021 3300025294 Bacteria 593083
108 Ga0209025_1000454 3300025294 Bacteria 80042
109 Ga0209025_1003265 3300025294 Bacteria 15621
110 Ga0209025_1025152 3300025294 Bacteria 3041
111 Ga0209564_1000004 3300025295 Bacteria 1424639
112 Ga0209564_1009860 3300025295 Bacteria 4479
113 Ga0209758_1006271 3300025297 Bacteria 8649
114 Ga0209758_1009745 3300025297 Bacteria 5898
115 Ga0209050_1005120 3300025298 Bacteria 8424
116 Ga0209050_1007058 3300025298 Bacteria 6441
117 Ga0209256_1000004 3300025299 Bacteria 1424643
118 Ga0209256_1000910 3300025299 Bacteria 36259
119 Ga0209256_1001541 3300025299 Bacteria 23031
120 Ga0209256_1002720 3300025299 Bacteria 13721
121 Ga0209051_1041153 3300025303 Bacteria 1647
122 Ga0209257_1000136 3300025304 Bacteria 204863
123 Ga0209257_1000154 3300025304 Bacteria 185887
124 Ga0209257_1000674 3300025304 Bacteria 53464
125 Ga0209257_1001204 3300025304 Bacteria 32505
126 Ga0209257_1001235 3300025304 Bacteria 31746
127 Ga0209257_1002087 3300025304 Bacteria 21019
128 Ga0207713_1000100 3300025735 Bacteria 140917
129 Ga0207680_10000169 3300025903 Bacteria 31665
130 Ga0207680_10413062 3300025903 Bacteria 955
131 Ga0207654_10001933 3300025911 Bacteria 10735
132 Ga0207707_10086680 3300025912 Bacteria 2736
133 Ga0207695_10000271 3300025913 Bacteria 129900
134 Ga0207671_10012557 3300025914 Bacteria 6802
135 Ga0207657_10015315 3300025919 Bacteria 7434
136 Ga0207649_10006636 3300025920 Bacteria 6288
137 Ga0207652_10036606 3300025921 Bacteria 4149
138 Ga0207681_10001810 3300025923 Bacteria 13723
139 Ga0207694_10061722 3300025924 Bacteria 2917
140 Ga0207650_10000996 3300025925 Bacteria 21293
141 Ga0207687_10131640 3300025927 Bacteria 1886
142 Ga0207644_10007366 3300025931 Bacteria 7166
143 Ga0207709_10006801 3300025935 Bacteria 6397
144 Ga0207711_10446742 3300025941 Bacteria 1203
145 Ga0207711_10574212 3300025941 Bacteria 1052
146 Ga0207689_10055879 3300025942 Bacteria 3248
147 Ga0207667_10252735 3300025949 Bacteria 1803
148 Ga0207658_11131826 3300025986 Bacteria 715
149 Ga0207639_10005192 3300026041 Bacteria 8786
150 Ga0207639_10058631 3300026041 Bacteria 2962
151 Ga0207639_10214163 3300026041 Bacteria 1660
152 Ga0207702_10002211 3300026078 Bacteria 18639
153 Ga0207702_10090265 3300026078 Bacteria 2681
154 Ga0207641_10080884 3300026088 Bacteria 2820
155 Ga0207641_10338780 3300026088 Bacteria 1430
156 Ga0207676_10090936 3300026095 Bacteria 2506
157 Ga0207698_10062471 3300026142 Bacteria 2909
158 Ga0209371_1000578 3300027312 Bacteria 32929
159 Ga0209969_1003953 3300027360 Bacteria 2065
160 Ga0209967_1006103 3300027364 Bacteria 1630
161 Ga0209995_1002584 3300027471 Bacteria 2865
162 Ga0209999_1001858 3300027543 Bacteria 3676
163 Ga0209970_1011673 3300027614 Bacteria 1448
164 Ga0209983_1001604 3300027665 Bacteria 5003
165 Ga0209971_1002383 3300027682 Bacteria 4539
166 Ga0209974_10031473 3300027876 Bacteria 1757
167 Ga0268264_10074678 3300028381 Bacteria 2881
168 Ga0268256_1000459 3300030500 Bacteria 35738
169 Ga0314311_1091987 3300030733 Bacteria 3061
170 Ga0307509_10064154 3300031507 Bacteria 3865
171 Ga0307408_100776784 3300031548 Bacteria 867
172 Ga0307516_10054583 3300031730 Bacteria 3903
173 Ga0307405_10372247 3300031731 Bacteria 1109
174 Ga0307413_10567284 3300031824 Bacteria 923
175 Ga0307410_10146723 3300031852 Bacteria 1752
176 Ga0307406_10004030 3300031901 Bacteria 7993
177 Ga0307406_10117691 3300031901 Bacteria 1841
178 Ga0307406_10950440 3300031901 Bacteria 734
179 Ga0307412_10053171 3300031911 Bacteria 2684
180 Ga0307412_10364665 3300031911 Bacteria 1164
181 Ga0307409_101183539 3300031995 Bacteria 787
182 Ga0307414_10022727 3300032004 Bacteria 3962
183 Ga0307414_10054482 3300032004 Bacteria 2795
184 Ga0307414_10059040 3300032004 Bacteria 2706
185 Ga0307414_10100967 3300032004 Bacteria 2171
186 Ga0307414_10156944 3300032004 Bacteria 1802
187 Ga0307414_10376873 3300032004 Bacteria 1226
188 Ga0307411_10029652 3300032005 Bacteria 3344
189 Ga0307411_10099791 3300032005 Bacteria 2050
190 Ga0307411_10388786 3300032005 Bacteria 1149
191 Ga0307411_10575853 3300032005 Bacteria 964
192 Ga0307415_100333442 3300032126 Bacteria 1270
193 Ga0373951_0033012 3300035091 Bacteria 1226
194 Ga0395899_0072750 3300037312 Bacteria 2515
195 Ga0395900_0129663 3300037418 Bacteria 2585
196 Ga0395905_0001151 3300037471 Bacteria 33114
197 Ga0395905_0442315 3300037471 Bacteria 1197
198 Ga0395905_0643196 3300037471 Bacteria 962
199 Ga0395901_0016828 3300038443 Bacteria 7452
200 Ga0439436_0018641 3300041404 Bacteria 2075
201 Ga0439436_0029542 3300041404 Bacteria 1597
202 Ga0439465_0000995 3300041413 Bacteria 9026
203 Ga0439465_0077238 3300041413 Bacteria 1124
204 Ga0451793_0192922 3300041452 Bacteria 2361
205 Ga0451804_0245266 3300041463 Bacteria 2267
206 Ga0451807_1075730 3300041486 Bacteria 6106
207 Ga0451849_1390420 3300041505 Bacteria 921
208 Ga0451853_1516929 3300041512 Bacteria 990
209 Ga0439445_0000837 3300042004 Bacteria 6498
210 Ga0439432_007262 3300042006 Bacteria 3933
211 Ga0439432_033525 3300042006 Bacteria 1651
212 Ga0439449_0000037 3300042007 Bacteria 39465
213 Ga0439449_0006109 3300042007 Bacteria 4603
214 Ga0439449_0009096 3300042007 Bacteria 3767
215 Ga0439449_0035025 3300042007 Bacteria 1869
216 Ga0439449_0046181 3300042007 Bacteria 1613
217 Ga0439452_046838 3300042010 Bacteria 1002
218 Ga0439457_029773 3300042014 Bacteria 1210
219 Ga0439462_0078426 3300042015 Bacteria 901
220 Ga0451577_0011406 3300042876 Bacteria 8408
221 Ga0495621_0006770 3300046539 Bacteria 3364
222 Ga0495636_0000147 3300047318 Bacteria 28119
223 Ga0495636_0004300 3300047318 Bacteria 5590
224 Ga0495685_008461 3300047447 Bacteria 3419
225 Ga0496100_0475804 3300048903 Bacteria 960
226 Ga0496101_0031968 3300048904 Bacteria 3702
227 Ga0496101_0640010 3300048904 Bacteria 840
228 Ga0496102_0884764 3300048905 Bacteria 815
229 Ga0496103_0034267 3300048906 Bacteria 3104
230 Ga0496108_0169253 3300048911 Bacteria 1890
231 Ga0496109_0051075 3300048912 Bacteria 3766
232 Ga0496112_0292899 3300048915 Bacteria 1573
233 Ga0496114_0006688 3300048917 Bacteria 9080
234 Ga0496115_0000002 3300048918 Bacteria 365286
235 Ga0496116_0095247 3300048919 Bacteria 1797
236 Ga0496118_0065964 3300048921 Bacteria 2645
237 Ga0496119_0001111 3300048922 Bacteria 33910
238 Ga0496120_0000816 3300048923 Bacteria 44591
239 Ga0496122_0001105 3300048925 Bacteria 46645
240 Ga0496122_0005767 3300048925 Bacteria 14572
241 Ga0496122_0050772 3300048925 Bacteria 3159
242 Ga0496123_0000527 3300048926 Bacteria 65909
243 Ga0496123_0002622 3300048926 Bacteria 21794
244 Ga0496123_0013024 3300048926 Bacteria 7021
245 Ga0496123_0093885 3300048926 Bacteria 1770
246 Ga0496124_0000856 3300048927 Bacteria 49665
247 Ga0496125_0025488 3300048928 Bacteria 5414
248 Ga0496125_0058581 3300048928 Bacteria 3111
249 Ga0496125_0134764 3300048928 Bacteria 1730
250 Ga0496126_0000052 3300048929 Bacteria 312383
251 Ga0496126_0046472 3300048929 Bacteria 3981
252 Ga0496126_0077076 3300048929 Bacteria 2956
253 Ga0501290_000640 3300049513 Bacteria 5238
254 Ga0501031_0023555 3300049568 Bacteria 4013
255 Ga0501031_0138551 3300049568 Bacteria 1590
256 Ga0501032_0085526 3300049569 Bacteria 2096
257 Ga0501033_0001300 3300049570 Bacteria 22212
258 Ga0501033_0139700 3300049570 Bacteria 1751
259 Ga0501033_0156519 3300049570 Bacteria 1642
260 Ga0501033_0432139 3300049570 Bacteria 916
261 Ga0501034_0001209 3300049571 Bacteria 35434
262 Ga0501034_0005422 3300049571 Bacteria 13943
263 Ga0501034_0017158 3300049571 Bacteria 7429
264 Ga0501034_0019335 3300049571 Bacteria 6967
265 Ga0501034_0150175 3300049571 Bacteria 2306
266 Ga0501036_0002318 3300049572 Bacteria 14880
267 Ga0501036_0093741 3300049572 Bacteria 2537
268 Ga0501037_0005290 3300049573 Bacteria 9391
269 Ga0501038_0002683 3300049574 Bacteria 16602
270 Ga0501038_0003581 3300049574 Bacteria 14451
271 Ga0501038_0011070 3300049574 Bacteria 8239
272 Ga0501039_0183351 3300049575 Bacteria 1646
273 Ga0501043_0009030 3300049579 Bacteria 7843
274 Ga0501043_0011368 3300049579 Bacteria 6968
275 Ga0501043_0025036 3300049579 Bacteria 4682
276 Ga0501043_0093393 3300049579 Bacteria 2365
277 Ga0501046_0116535 3300049580 Bacteria 2036
278 Ga0501047_0001628 3300049581 Bacteria 21899
279 Ga0501047_0005436 3300049581 Bacteria 11984
280 Ga0501047_0009523 3300049581 Bacteria 9181
281 Ga0501047_0021921 3300049581 Bacteria 6134
282 Ga0501047_0166993 3300049581 Bacteria 2071
283 Ga0501067_0000786 3300049583 Bacteria 17094
284 Ga0501068_0006105 3300049584 Bacteria 6624
285 Ga0501070_0007341 3300049586 Bacteria 9360
286 Ga0501070_0011338 3300049586 Bacteria 7532
287 Ga0501070_0018762 3300049586 Bacteria 5802
288 Ga0501070_0032607 3300049586 Bacteria 4360
289 Ga0501070_0065418 3300049586 Bacteria 3010
290 Ga0501070_0094082 3300049586 Bacteria 2479
291 Ga0501071_0006257 3300049587 Bacteria 7724
292 Ga0501072_0026256 3300049588 Bacteria 4540
293 Ga0501073_0003377 3300049589 Bacteria 11999
294 Ga0501073_0077839 3300049589 Bacteria 2307
295 Ga0501074_0002549 3300049590 Bacteria 12713
296 Ga0501074_0028199 3300049590 Bacteria 4068
297 Ga0501198_038709 3300049649 Bacteria 820
298 Ga0501235_020685 3300049669 Bacteria 1461
299 Ga0501252_009671 3300049682 Bacteria 1128
300 Ga0501225_0003607 3300049705 Bacteria 4666
301 Ga0501245_007946 3300049708 Bacteria 1506
302 Ga0501079_0010656 3300049741 Bacteria 6998
303 Ga0501079_0136943 3300049741 Bacteria 1907
304 Ga0501080_0001127 3300049742 Bacteria 21983
305 Ga0501080_0002525 3300049742 Bacteria 16037
306 Ga0501080_0019850 3300049742 Bacteria 6223
307 Ga0501080_0193490 3300049742 Bacteria 1868
308 Ga0501083_0009033 3300049744 Bacteria 7035
309 Ga0501268_003422 3300049765 Bacteria 2170
310 Ga0501275_000114 3300049772 Bacteria 8530
311 Ga0501278_004625 3300049774 Bacteria 997
312 Ga0501035_0001682 3300049822 Bacteria 22366
313 Ga0501035_0267898 3300049822 Bacteria 1446
314 Ga0501044_0013117 3300049823 Bacteria 8970
315 Ga0501044_0024295 3300049823 Bacteria 6437
316 Ga0501044_0047859 3300049823 Bacteria 4421
317 Ga0501044_0207980 3300049823 Bacteria 1912
318 Ga0501045_0393584 3300049824 Bacteria 1031
319 nmdc:mga00v17_671_c1 3300050491 Bacteria 18843
320 Ga0501084_0195022 3300054114 Bacteria 1709
321 Ga0501084_0493182 3300054114 Bacteria 1035
322 Ga0501082_0429075 3300060353 Bacteria 1154
323 2547502329 2547132130 Bacteria 4660562
324 2572255491 2571042365 Bacteria 3289345
325 2578460281 2576861471 Bacteria 4648976
326 2643817934 2643221559 Bacteria 4424915
327 2643880096 2643221573 Bacteria 4784121
328 2643909102 2643221579 Bacteria 4443405
329 2643914453 2643221581 Bacteria 3893603
330 2643937592 2643221586 Bacteria 4446529
331 2643975176 2643221593 Bacteria 6296053
332 2644078506 2643221612 Bacteria 4361984
333 2644527919 2643221695 Bacteria 3441323
334 2644662352 2643221720 Bacteria 4694283
335 2644693283 2643221727 Bacteria 4415595
336 2644698755 2643221728 Bacteria 4797149
337 2747950527 2747842428 Bacteria 4689383
338 2748019936 2747842501 Bacteria 5293829
339 2765577015 2765235840 Bacteria 4663337
340 2816519640 2816332141 Bacteria 4436036
341 2819661930 2818991457 Bacteria 5323295
342 2852652788 2852649853 Bacteria 4036942
343 2852688606 2852684882 Bacteria 5463342
344 2874224075 2874220319 Bacteria 4594709
345 2894417718 2894414249 Bacteria 4405451
346 2919089990 2919089067 Bacteria 4560942
347 2919134418 2919130084 Bacteria 5301837
348 2919138265 2919134579 Bacteria 4480386
349 2919517006 2919513703 Bacteria 3844312
350 2919678868 2919675420 Bacteria 3969095
351 2923516868 2923516293 Bacteria 3716336
352 2928500001 2928496128 Bacteria 4631123
353 2929199945 2929195423 Bacteria 5325372
354 2931382690 2931380184 Bacteria 4455911
355 2939592771 2939589442 Bacteria 4214238
356 2941479216 2941475908 Bacteria 4145589
357 2941492136 2941489479 Bacteria 6313767
358 2974310717 2974307012 Bacteria 4172388
359 2977251460 2977247770 Bacteria 4160543
360 2984517907 2984514374 Bacteria 4172479
361 2987605421 2987605356 Bacteria 4187822
362 2995953965 2995948881 Bacteria 6358104
363 8003017059 8003014200 Bacteria 4059994
364 Ga0307413_10473778
365 JGI25151J46595_10000127
366 JGI25153J46596_10071882
367 JGI26145J50221_1002193
368 Ga0055526_1000012
369 Ga0055537_1000234
370 Ga0055524_1000037
371 Ga0055536_1005695
372 Ga0055536_1040492
373 Ga0055534_1000006
374 Ga0055528_1000006
375 Ga0055530_10002380
376 Ga0055531_10007082
377 Ga0055531_10012533
378 Ga0058692_1000225
379 Ga0065704_10070571
380 Ga0065704_10075961
381 Ga0065715_10019621
382 Ga0065715_10107168
383 Ga0065715_10379663
384 Ga0070683_100556982
385 Ga0070670_100003773
386 Ga0068869_100042982
387 Ga0070666_10006916
388 Ga0070666_10054027
389 Ga0070666_10382040
390 Ga0070660_100041092
391 Ga0070661_100015596
392 Ga0070669_100084704
393 Ga0070659_100166526
394 Ga0070667_100365751
395 Ga0070667_100692389
396 Ga0070713_101132334
397 Ga0070662_100048654
398 Ga0070681_10040246
399 Ga0070679_100058872
400 Ga0070679_100483345
401 Ga0068853_100009077
402 Ga0068853_100121620
403 Ga0070696_100044022
404 Ga0068855_100023342
405 Ga0068855_100358717
406 Ga0068857_100570200
407 Ga0068856_100013133
408 Ga0068856_100201934
409 Ga0068852_100135568
410 Ga0068852_100175465
411 Ga0068852_100868618
412 Ga0068859_100014861
413 Ga0068859_100098690
414 Ga0068863_100006621
415 Ga0068863_100062440
416 Ga0068858_100155447
417 Ga0068860_100019321
418 Ga0075364_10000926
419 Ga0075364_10055666
420 Ga0097620_100014861
421 Ga0097620_100098691
422 Ga0105251_10000328
423 Ga0105245_10148110
424 Ga0105245_10387288
425 Ga0105243_10000662
426 Ga0105243_10369254
427 Ga0105241_10091970
428 Ga0105241_10276971
429 Ga0105242_10223916
430 Ga0105248_10576576
431 Ga0105237_10031136
432 Ga0105237_10150301
433 Ga0105237_10653370
434 Ga0105238_10044472
435 Ga0105238_10063549
436 Ga0105249_10436719
437 Ga0105148_100853
438 Ga0105035_111439
439 Ga0105239_10001780
440 Ga0105239_10021187
441 Ga0105239_10023581
442 Ga0105239_10192065
443 Ga0105239_10669569
444 Ga0105239_11791759
445 Ga0157370_10008733
446 Ga0157370_10201433
447 Ga0157369_10025322
448 Ga0157374_10018657
449 Ga0157374_10047656
450 Ga0157378_10000052
451 Ga0157372_10008531
452 Ga0157375_10645108
453 Ga0163163_10000182
454 Ga0163163_10036733
455 Ga0157379_10038491
456 Ga0157376_10106855
457 Ga0182006_1009120
458 Ga0182005_1002640
459 Ga0183360_10002
460 Ga0209565_1000002
461 Ga0209565_1009811
462 Ga0209673_1000002
463 Ga0209673_1003316
464 Ga0209130_1003913
465 Ga0209675_1000002
466 Ga0209675_1019225
467 Ga0209676_1000063
468 Ga0209676_1002572
469 Ga0209676_1006065
470 Ga0209025_1000021
471 Ga0209025_1000454
472 Ga0209025_1003265
473 Ga0209025_1025152
474 Ga0209564_1000004
475 Ga0209564_1009860
476 Ga0209758_1006271
477 Ga0209758_1009745
478 Ga0209050_1005120
479 Ga0209050_1007058
480 Ga0209256_1000004
481 Ga0209256_1000910
482 Ga0209256_1001541
483 Ga0209256_1002720
484 Ga0209051_1041153
485 Ga0209257_1000136
486 Ga0209257_1000154
487 Ga0209257_1000674
488 Ga0209257_1001204
489 Ga0209257_1001235
490 Ga0209257_1002087
491 Ga0207713_1000100
492 Ga0207680_10000169
493 Ga0207680_10413062
494 Ga0207654_10001933
495 Ga0207707_10086680
496 Ga0207695_10000271
497 Ga0207671_10012557
498 Ga0207657_10015315
499 Ga0207649_10006636
500 Ga0207652_10036606
501 Ga0207681_10001810
502 Ga0207694_10061722
503 Ga0207650_10000996
504 Ga0207687_10131640
505 Ga0207644_10007366
506 Ga0207709_10006801
507 Ga0207711_10446742
508 Ga0207711_10574212
509 Ga0207689_10055879
510 Ga0207667_10252735
511 Ga0207658_11131826
512 Ga0207639_10005192
513 Ga0207639_10058631
514 Ga0207639_10214163
515 Ga0207702_10002211
516 Ga0207702_10090265
517 Ga0207641_10080884
518 Ga0207641_10338780
519 Ga0207676_10090936
520 Ga0207698_10062471
521 Ga0209371_1000578
522 Ga0209969_1003953
523 Ga0209967_1006103
524 Ga0209995_1002584
525 Ga0209999_1001858
526 Ga0209970_1011673
527 Ga0209983_1001604
528 Ga0209971_1002383
529 Ga0209974_10031473
530 Ga0268264_10074678
531 Ga0268256_1000459
532 Ga0314311_1091987
533 Ga0307509_10064154
534 Ga0307408_100776784
535 Ga0307516_10054583
536 Ga0307405_10372247
537 Ga0307413_10567284
538 Ga0307410_10146723
539 Ga0307406_10004030
540 Ga0307406_10117691
541 Ga0307406_10950440
542 Ga0307412_10053171
543 Ga0307412_10364665
544 Ga0307409_101183539
545 Ga0307414_10022727
546 Ga0307414_10054482
547 Ga0307414_10059040
548 Ga0307414_10100967
549 Ga0307414_10156944
550 Ga0307414_10376873
551 Ga0307411_10029652
552 Ga0307411_10099791
553 Ga0307411_10388786
554 Ga0307411_10575853
555 Ga0307415_100333442
556 Ga0373951_0033012
557 Ga0395899_0072750
558 Ga0395900_0129663
559 Ga0395905_0001151
560 Ga0395905_0442315
561 Ga0395905_0643196
562 Ga0395901_0016828
563 Ga0439436_0018641
564 Ga0439436_0029542
565 Ga0439465_0000995
566 Ga0439465_0077238
567 Ga0451793_0192922
568 Ga0451804_0245266
569 Ga0451807_1075730
570 Ga0451849_1390420
571 Ga0451853_1516929
572 Ga0439445_0000837
573 Ga0439432_007262
574 Ga0439432_033525
575 Ga0439449_0000037
576 Ga0439449_0006109
577 Ga0439449_0009096
578 Ga0439449_0035025
579 Ga0439449_0046181
580 Ga0439452_046838
581 Ga0439457_029773
582 Ga0439462_0078426
583 Ga0451577_0011406
584 Ga0495621_0006770
585 Ga0495636_0000147
586 Ga0495636_0004300
587 Ga0495685_008461
588 Ga0496100_0475804
589 Ga0496101_0031968
590 Ga0496101_0640010
591 Ga0496102_0884764
592 Ga0496103_0034267
593 Ga0496108_0169253
594 Ga0496109_0051075
595 Ga0496112_0292899
596 Ga0496114_0006688
597 Ga0496115_0000002
598 Ga0496116_0095247
599 Ga0496118_0065964
600 Ga0496119_0001111
601 Ga0496120_0000816
602 Ga0496122_0001105
603 Ga0496122_0005767
604 Ga0496122_0050772
605 Ga0496123_0000527
606 Ga0496123_0002622
607 Ga0496123_0013024
608 Ga0496123_0093885
609 Ga0496124_0000856
610 Ga0496125_0025488
611 Ga0496125_0058581
612 Ga0496125_0134764
613 Ga0496126_0000052
614 Ga0496126_0046472
615 Ga0496126_0077076
616 Ga0501290_000640
617 Ga0501031_0023555
618 Ga0501031_0138551
619 Ga0501032_0085526
620 Ga0501033_0001300
621 Ga0501033_0139700
622 Ga0501033_0156519
623 Ga0501033_0432139
624 Ga0501034_0001209
625 Ga0501034_0005422
626 Ga0501034_0017158
627 Ga0501034_0019335
628 Ga0501034_0150175
629 Ga0501036_0002318
630 Ga0501036_0093741
631 Ga0501037_0005290
632 Ga0501038_0002683
633 Ga0501038_0003581
634 Ga0501038_0011070
635 Ga0501039_0183351
636 Ga0501043_0009030
637 Ga0501043_0011368
638 Ga0501043_0025036
639 Ga0501043_0093393
640 Ga0501046_0116535
641 Ga0501047_0001628
642 Ga0501047_0005436
643 Ga0501047_0009523
644 Ga0501047_0021921
645 Ga0501047_0166993
646 Ga0501067_0000786
647 Ga0501068_0006105
648 Ga0501070_0007341
649 Ga0501070_0011338
650 Ga0501070_0018762
651 Ga0501070_0032607
652 Ga0501070_0065418
653 Ga0501070_0094082
654 Ga0501071_0006257
655 Ga0501072_0026256
656 Ga0501073_0003377
657 Ga0501073_0077839
658 Ga0501074_0002549
659 Ga0501074_0028199
660 Ga0501198_038709
661 Ga0501235_020685
662 Ga0501252_009671
663 Ga0501225_0003607
664 Ga0501245_007946
665 Ga0501079_0010656
666 Ga0501079_0136943
667 Ga0501080_0001127
668 Ga0501080_0002525
669 Ga0501080_0019850
670 Ga0501080_0193490
671 Ga0501083_0009033
672 Ga0501268_003422
673 Ga0501275_000114
674 Ga0501278_004625
675 Ga0501035_0001682
676 Ga0501035_0267898
677 Ga0501044_0013117
678 Ga0501044_0024295
679 Ga0501044_0047859
680 Ga0501044_0207980
681 Ga0501045_0393584
682 nmdc:mga00v17_671_c1
683 Ga0501084_0195022
684 Ga0501084_0493182
685 Ga0501082_0429075
686 2547502329
687 2572255491
688 2578460281
689 2643817934
690 2643880096
691 2643909102
692 2643914453
693 2643937592
694 2643975176
695 2644078506
696 2644527919
697 2644662352
698 2644693283
699 2644698755
700 2747950527
701 2748019936
702 2765577015
703 2816519640
704 2819661930
705 2852652788
706 2852688606
707 2874224075
708 2894417718
709 2919089990
710 2919134418
711 2919138265
712 2919517006
713 2919678868
714 2923516868
715 2928500001
716 2929199945
717 2931382690
718 2939592771
719 2941479216
720 2941492136
721 2974310717
722 2977251460
723 2984517907
724 2987605421
725 2995953965
726 8003017059

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00265

TK

Thymidine kinase

44

229

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qpo-assembly1.cif.gz_D thermotoga maritima thymidine kinase in the apo form 0.8175 1 189
2orw-assembly1.cif.gz_B-2 thermotoga maritima thymidine kinase 1 like enzyme in complex with tp4a 0.8156 1 191
2qqe-assembly1.cif.gz_B-2 thymidine kinase from thermotoga maritima in complex with thymidine 0.813 1 189
2ja1-assembly1.cif.gz_A thymidine kinase from b. cereus with ttp bound as phosphate donor. 0.81 2 185
2orw-assembly1.cif.gz_B-2 thermotoga maritima thymidine kinase 1 like enzyme in complex with tp4a 0.8071 1 191
ID Description Score Start End Superfamily
af_P23331_1_141_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9515 1 142 3.40.50.300
af_P23331_1_141_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.945 1 142 3.40.50.300
af_Q2FWD9_1_141_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8717 2 142 3.40.50.300
af_F4KBF5_71_215_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8476 2 142 3.40.50.300
2qpoC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8399 1 142 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7C2PFW0-F1-model_v4 Thymidine kinase (EC 2.7.1.21) 0.9701 1 121 GO:0004797
GO:0005524
GO:0005829
GO:0046104
GO:0071897
AF-A0A2X1P3J0-F1-model_v4 thymidine kinase (EC 2.7.1.21) 0.9646 81 150 GO:0004797
GO:0005524
GO:0071897
AF-A0A7C2PFW0-F1-model_v4 Thymidine kinase (EC 2.7.1.21) 0.9623 1 121 GO:0004797
GO:0005524
GO:0005829
GO:0046104
GO:0071897
AF-A0A3B8SZH4-F1-model_v4 Thymidine kinase (EC 2.7.1.21) 0.9605 1 124 GO:0004797
GO:0005524
GO:0005829
GO:0046104
GO:0071897
AF-A0A7Y0S162-F1-model_v4 thymidine kinase (EC 2.7.1.21) 0.9584 45 132 GO:0004797
GO:0005524
GO:0071897

Map