F423017
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 363 | 240 | 726 | 208 |
Family's Representative Sequence
| Representative Sequence | 3300031824|Ga0307413_10473778|Ga0307413_104737781 |
| Length | 252 |
| Sequence | MAGVHAWHAAAGFSAAPVVATRAGRRSCGVEFPGRARVRCYTMAKLYFYYSAMNAGKTTTLLQSAHNYRERGMRVAILTPRLDHRDGSGTVASRIGLRADGTAFARDDDLERMVRASIDNNGPLHCVLVDEAQFLSRAQVWQLSEVVDALAVPVLCYGLRTDFRGELFEGSQALLAWADELVEIKTICHSGHKATMTVRVDDRGRAVQAGPQVEIGGNERYLSVSRAEFKKVMRGEGGIDVLQPPLALPDAK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 2 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 3 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 4 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 5 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 6 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 7 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 8 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 12 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 14 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 32 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 35 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 36 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 37 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 38 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 39 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 40 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 51 | 3300009988 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG | Metagenome | Rhizosphere |
| 52 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 63 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 64 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 65 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 66 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 67 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 69 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 72 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 75 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 112 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 113 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 114 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 115 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 116 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 117 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 118 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 119 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 120 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 121 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 122 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 123 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 124 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 125 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 126 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 127 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 128 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 129 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 130 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 131 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 132 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 133 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 134 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 135 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 136 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 137 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 138 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 139 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 140 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 141 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 142 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 143 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 147 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 148 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 149 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 150 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 151 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 152 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 153 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 154 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 155 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 156 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 157 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 158 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 159 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 160 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 161 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 162 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 163 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 164 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 165 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 166 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 168 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 184 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 185 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 186 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 187 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 188 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 192 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 193 | 3300049774 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought | Metagenome | Rhizosphere |
| 194 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 198 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 200 | 2547132130 | Stenotrophomonas maltophilia RR-10 | Isolate | Unclassified |
| 201 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 202 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 203 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 204 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 205 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 206 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 207 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 208 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 209 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 210 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 211 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 212 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 213 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 214 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 215 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 216 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 217 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 218 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 219 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 220 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 221 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 222 | 2894414249 | Luteimonas sp. LNNU 24178 | Isolate | Rhizosphere |
| 223 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 224 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 225 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 226 | 2919513703 | Luteimonas sp. 3794 | Isolate | Unclassified |
| 227 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 228 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 229 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 230 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 231 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 232 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 233 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 234 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 235 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 236 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 237 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 238 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 239 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 240 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.71 |
| Metatranscriptomes | 0 |
| Isolates | 11.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.28 |
| Bulb | 0 |
| Endosphere | 12.67 |
| Nodule | 0 |
| Rhizoplane | 3.58 |
| Rhizosphere | 70.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0307413_10473778 | 3300031824 | Bacteria | 999 |
| 2 | JGI25151J46595_10000127 | 3300003187 | Bacteria | 102790 |
| 3 | JGI25153J46596_10071882 | 3300003215 | Bacteria | 892 |
| 4 | JGI26145J50221_1002193 | 3300003371 | Bacteria | 1535 |
| 5 | Ga0055526_1000012 | 3300003771 | Bacteria | 234368 |
| 6 | Ga0055537_1000234 | 3300003773 | Bacteria | 40581 |
| 7 | Ga0055524_1000037 | 3300003775 | Bacteria | 167140 |
| 8 | Ga0055536_1005695 | 3300003781 | Bacteria | 6014 |
| 9 | Ga0055536_1040492 | 3300003781 | Bacteria | 1108 |
| 10 | Ga0055534_1000006 | 3300003784 | Bacteria | 234368 |
| 11 | Ga0055528_1000006 | 3300003790 | Bacteria | 234368 |
| 12 | Ga0055530_10002380 | 3300003791 | Bacteria | 12186 |
| 13 | Ga0055531_10007082 | 3300003794 | Bacteria | 6198 |
| 14 | Ga0055531_10012533 | 3300003794 | Bacteria | 3979 |
| 15 | Ga0058692_1000225 | 3300003856 | Bacteria | 32877 |
| 16 | Ga0065704_10070571 | 3300005289 | Bacteria | 20118 |
| 17 | Ga0065704_10075961 | 3300005289 | Bacteria | 5331 |
| 18 | Ga0065715_10019621 | 3300005293 | Bacteria | 1727 |
| 19 | Ga0065715_10107168 | 3300005293 | Bacteria | 2786 |
| 20 | Ga0065715_10379663 | 3300005293 | Bacteria | 909 |
| 21 | Ga0070683_100556982 | 3300005329 | Bacteria | 1096 |
| 22 | Ga0070670_100003773 | 3300005331 | Bacteria | 12616 |
| 23 | Ga0068869_100042982 | 3300005334 | Bacteria | 3243 |
| 24 | Ga0070666_10006916 | 3300005335 | Bacteria | 6990 |
| 25 | Ga0070666_10054027 | 3300005335 | Bacteria | 2710 |
| 26 | Ga0070666_10382040 | 3300005335 | Bacteria | 1011 |
| 27 | Ga0070660_100041092 | 3300005339 | Bacteria | 3523 |
| 28 | Ga0070661_100015596 | 3300005344 | Bacteria | 5362 |
| 29 | Ga0070669_100084704 | 3300005353 | Bacteria | 2366 |
| 30 | Ga0070659_100166526 | 3300005366 | Bacteria | 1804 |
| 31 | Ga0070667_100365751 | 3300005367 | Bacteria | 1308 |
| 32 | Ga0070667_100692389 | 3300005367 | Bacteria | 943 |
| 33 | Ga0070713_101132334 | 3300005436 | Bacteria | 757 |
| 34 | Ga0070662_100048654 | 3300005457 | Bacteria | 3055 |
| 35 | Ga0070681_10040246 | 3300005458 | Bacteria | 4684 |
| 36 | Ga0070679_100058872 | 3300005530 | Bacteria | 3828 |
| 37 | Ga0070679_100483345 | 3300005530 | Bacteria | 1183 |
| 38 | Ga0068853_100009077 | 3300005539 | Bacteria | 8007 |
| 39 | Ga0068853_100121620 | 3300005539 | Bacteria | 2329 |
| 40 | Ga0070696_100044022 | 3300005546 | Bacteria | 3090 |
| 41 | Ga0068855_100023342 | 3300005563 | Bacteria | 7407 |
| 42 | Ga0068855_100358717 | 3300005563 | Bacteria | 1604 |
| 43 | Ga0068857_100570200 | 3300005577 | Bacteria | 1068 |
| 44 | Ga0068856_100013133 | 3300005614 | Bacteria | 8024 |
| 45 | Ga0068856_100201934 | 3300005614 | Bacteria | 2002 |
| 46 | Ga0068852_100135568 | 3300005616 | Bacteria | 2273 |
| 47 | Ga0068852_100175465 | 3300005616 | Bacteria | 2012 |
| 48 | Ga0068852_100868618 | 3300005616 | Bacteria | 918 |
| 49 | Ga0068859_100014861 | 3300005617 | Bacteria | 7818 |
| 50 | Ga0068859_100098690 | 3300005617 | Bacteria | 2975 |
| 51 | Ga0068863_100006621 | 3300005841 | Bacteria | 11370 |
| 52 | Ga0068863_100062440 | 3300005841 | Bacteria | 3523 |
| 53 | Ga0068858_100155447 | 3300005842 | Bacteria | 2152 |
| 54 | Ga0068860_100019321 | 3300005843 | Bacteria | 6612 |
| 55 | Ga0075364_10000926 | 3300006051 | Bacteria | 15505 |
| 56 | Ga0075364_10055666 | 3300006051 | Bacteria | 2588 |
| 57 | Ga0097620_100014861 | 3300006931 | Bacteria | 7818 |
| 58 | Ga0097620_100098691 | 3300006931 | Bacteria | 2975 |
| 59 | Ga0105251_10000328 | 3300009011 | Bacteria | 47681 |
| 60 | Ga0105245_10148110 | 3300009098 | Bacteria | 2217 |
| 61 | Ga0105245_10387288 | 3300009098 | Bacteria | 1394 |
| 62 | Ga0105243_10000662 | 3300009148 | Bacteria | 34075 |
| 63 | Ga0105243_10369254 | 3300009148 | Bacteria | 1323 |
| 64 | Ga0105241_10091970 | 3300009174 | Bacteria | 2395 |
| 65 | Ga0105241_10276971 | 3300009174 | Bacteria | 1431 |
| 66 | Ga0105242_10223916 | 3300009176 | Bacteria | 1683 |
| 67 | Ga0105248_10576576 | 3300009177 | Bacteria | 1269 |
| 68 | Ga0105237_10031136 | 3300009545 | Bacteria | 5411 |
| 69 | Ga0105237_10150301 | 3300009545 | Bacteria | 2325 |
| 70 | Ga0105237_10653370 | 3300009545 | Bacteria | 1058 |
| 71 | Ga0105238_10044472 | 3300009551 | Bacteria | 4488 |
| 72 | Ga0105238_10063549 | 3300009551 | Bacteria | 3692 |
| 73 | Ga0105249_10436719 | 3300009553 | Bacteria | 1346 |
| 74 | Ga0105148_100853 | 3300009978 | Bacteria | 2239 |
| 75 | Ga0105035_111439 | 3300009988 | Bacteria | 786 |
| 76 | Ga0105239_10001780 | 3300010375 | Bacteria | 28338 |
| 77 | Ga0105239_10021187 | 3300010375 | Bacteria | 7167 |
| 78 | Ga0105239_10023581 | 3300010375 | Bacteria | 6777 |
| 79 | Ga0105239_10192065 | 3300010375 | Bacteria | 2285 |
| 80 | Ga0105239_10669569 | 3300010375 | Bacteria | 1186 |
| 81 | Ga0105239_11791759 | 3300010375 | Bacteria | 711 |
| 82 | Ga0157370_10008733 | 3300013104 | Bacteria | 10899 |
| 83 | Ga0157370_10201433 | 3300013104 | Bacteria | 1846 |
| 84 | Ga0157369_10025322 | 3300013105 | Bacteria | 6587 |
| 85 | Ga0157374_10018657 | 3300013296 | Bacteria | 6126 |
| 86 | Ga0157374_10047656 | 3300013296 | Bacteria | 3974 |
| 87 | Ga0157378_10000052 | 3300013297 | Bacteria | 100769 |
| 88 | Ga0157372_10008531 | 3300013307 | Bacteria | 10880 |
| 89 | Ga0157375_10645108 | 3300013308 | Bacteria | 1215 |
| 90 | Ga0163163_10000182 | 3300014325 | Bacteria | 64629 |
| 91 | Ga0163163_10036733 | 3300014325 | Bacteria | 4760 |
| 92 | Ga0157379_10038491 | 3300014968 | Bacteria | 4267 |
| 93 | Ga0157376_10106855 | 3300014969 | Bacteria | 2456 |
| 94 | Ga0182006_1009120 | 3300015261 | Bacteria | 4459 |
| 95 | Ga0182005_1002640 | 3300015265 | Bacteria | 6314 |
| 96 | Ga0183360_10002 | 3300015689 | Bacteria | 953821 |
| 97 | Ga0209565_1000002 | 3300025263 | Bacteria | 1423083 |
| 98 | Ga0209565_1009811 | 3300025263 | Bacteria | 2402 |
| 99 | Ga0209673_1000002 | 3300025273 | Bacteria | 1423083 |
| 100 | Ga0209673_1003316 | 3300025273 | Bacteria | 9640 |
| 101 | Ga0209130_1003913 | 3300025284 | Bacteria | 5966 |
| 102 | Ga0209675_1000002 | 3300025291 | Bacteria | 1423083 |
| 103 | Ga0209675_1019225 | 3300025291 | Bacteria | 1886 |
| 104 | Ga0209676_1000063 | 3300025292 | Bacteria | 322025 |
| 105 | Ga0209676_1002572 | 3300025292 | Bacteria | 12532 |
| 106 | Ga0209676_1006065 | 3300025292 | Bacteria | 6085 |
| 107 | Ga0209025_1000021 | 3300025294 | Bacteria | 593083 |
| 108 | Ga0209025_1000454 | 3300025294 | Bacteria | 80042 |
| 109 | Ga0209025_1003265 | 3300025294 | Bacteria | 15621 |
| 110 | Ga0209025_1025152 | 3300025294 | Bacteria | 3041 |
| 111 | Ga0209564_1000004 | 3300025295 | Bacteria | 1424639 |
| 112 | Ga0209564_1009860 | 3300025295 | Bacteria | 4479 |
| 113 | Ga0209758_1006271 | 3300025297 | Bacteria | 8649 |
| 114 | Ga0209758_1009745 | 3300025297 | Bacteria | 5898 |
| 115 | Ga0209050_1005120 | 3300025298 | Bacteria | 8424 |
| 116 | Ga0209050_1007058 | 3300025298 | Bacteria | 6441 |
| 117 | Ga0209256_1000004 | 3300025299 | Bacteria | 1424643 |
| 118 | Ga0209256_1000910 | 3300025299 | Bacteria | 36259 |
| 119 | Ga0209256_1001541 | 3300025299 | Bacteria | 23031 |
| 120 | Ga0209256_1002720 | 3300025299 | Bacteria | 13721 |
| 121 | Ga0209051_1041153 | 3300025303 | Bacteria | 1647 |
| 122 | Ga0209257_1000136 | 3300025304 | Bacteria | 204863 |
| 123 | Ga0209257_1000154 | 3300025304 | Bacteria | 185887 |
| 124 | Ga0209257_1000674 | 3300025304 | Bacteria | 53464 |
| 125 | Ga0209257_1001204 | 3300025304 | Bacteria | 32505 |
| 126 | Ga0209257_1001235 | 3300025304 | Bacteria | 31746 |
| 127 | Ga0209257_1002087 | 3300025304 | Bacteria | 21019 |
| 128 | Ga0207713_1000100 | 3300025735 | Bacteria | 140917 |
| 129 | Ga0207680_10000169 | 3300025903 | Bacteria | 31665 |
| 130 | Ga0207680_10413062 | 3300025903 | Bacteria | 955 |
| 131 | Ga0207654_10001933 | 3300025911 | Bacteria | 10735 |
| 132 | Ga0207707_10086680 | 3300025912 | Bacteria | 2736 |
| 133 | Ga0207695_10000271 | 3300025913 | Bacteria | 129900 |
| 134 | Ga0207671_10012557 | 3300025914 | Bacteria | 6802 |
| 135 | Ga0207657_10015315 | 3300025919 | Bacteria | 7434 |
| 136 | Ga0207649_10006636 | 3300025920 | Bacteria | 6288 |
| 137 | Ga0207652_10036606 | 3300025921 | Bacteria | 4149 |
| 138 | Ga0207681_10001810 | 3300025923 | Bacteria | 13723 |
| 139 | Ga0207694_10061722 | 3300025924 | Bacteria | 2917 |
| 140 | Ga0207650_10000996 | 3300025925 | Bacteria | 21293 |
| 141 | Ga0207687_10131640 | 3300025927 | Bacteria | 1886 |
| 142 | Ga0207644_10007366 | 3300025931 | Bacteria | 7166 |
| 143 | Ga0207709_10006801 | 3300025935 | Bacteria | 6397 |
| 144 | Ga0207711_10446742 | 3300025941 | Bacteria | 1203 |
| 145 | Ga0207711_10574212 | 3300025941 | Bacteria | 1052 |
| 146 | Ga0207689_10055879 | 3300025942 | Bacteria | 3248 |
| 147 | Ga0207667_10252735 | 3300025949 | Bacteria | 1803 |
| 148 | Ga0207658_11131826 | 3300025986 | Bacteria | 715 |
| 149 | Ga0207639_10005192 | 3300026041 | Bacteria | 8786 |
| 150 | Ga0207639_10058631 | 3300026041 | Bacteria | 2962 |
| 151 | Ga0207639_10214163 | 3300026041 | Bacteria | 1660 |
| 152 | Ga0207702_10002211 | 3300026078 | Bacteria | 18639 |
| 153 | Ga0207702_10090265 | 3300026078 | Bacteria | 2681 |
| 154 | Ga0207641_10080884 | 3300026088 | Bacteria | 2820 |
| 155 | Ga0207641_10338780 | 3300026088 | Bacteria | 1430 |
| 156 | Ga0207676_10090936 | 3300026095 | Bacteria | 2506 |
| 157 | Ga0207698_10062471 | 3300026142 | Bacteria | 2909 |
| 158 | Ga0209371_1000578 | 3300027312 | Bacteria | 32929 |
| 159 | Ga0209969_1003953 | 3300027360 | Bacteria | 2065 |
| 160 | Ga0209967_1006103 | 3300027364 | Bacteria | 1630 |
| 161 | Ga0209995_1002584 | 3300027471 | Bacteria | 2865 |
| 162 | Ga0209999_1001858 | 3300027543 | Bacteria | 3676 |
| 163 | Ga0209970_1011673 | 3300027614 | Bacteria | 1448 |
| 164 | Ga0209983_1001604 | 3300027665 | Bacteria | 5003 |
| 165 | Ga0209971_1002383 | 3300027682 | Bacteria | 4539 |
| 166 | Ga0209974_10031473 | 3300027876 | Bacteria | 1757 |
| 167 | Ga0268264_10074678 | 3300028381 | Bacteria | 2881 |
| 168 | Ga0268256_1000459 | 3300030500 | Bacteria | 35738 |
| 169 | Ga0314311_1091987 | 3300030733 | Bacteria | 3061 |
| 170 | Ga0307509_10064154 | 3300031507 | Bacteria | 3865 |
| 171 | Ga0307408_100776784 | 3300031548 | Bacteria | 867 |
| 172 | Ga0307516_10054583 | 3300031730 | Bacteria | 3903 |
| 173 | Ga0307405_10372247 | 3300031731 | Bacteria | 1109 |
| 174 | Ga0307413_10567284 | 3300031824 | Bacteria | 923 |
| 175 | Ga0307410_10146723 | 3300031852 | Bacteria | 1752 |
| 176 | Ga0307406_10004030 | 3300031901 | Bacteria | 7993 |
| 177 | Ga0307406_10117691 | 3300031901 | Bacteria | 1841 |
| 178 | Ga0307406_10950440 | 3300031901 | Bacteria | 734 |
| 179 | Ga0307412_10053171 | 3300031911 | Bacteria | 2684 |
| 180 | Ga0307412_10364665 | 3300031911 | Bacteria | 1164 |
| 181 | Ga0307409_101183539 | 3300031995 | Bacteria | 787 |
| 182 | Ga0307414_10022727 | 3300032004 | Bacteria | 3962 |
| 183 | Ga0307414_10054482 | 3300032004 | Bacteria | 2795 |
| 184 | Ga0307414_10059040 | 3300032004 | Bacteria | 2706 |
| 185 | Ga0307414_10100967 | 3300032004 | Bacteria | 2171 |
| 186 | Ga0307414_10156944 | 3300032004 | Bacteria | 1802 |
| 187 | Ga0307414_10376873 | 3300032004 | Bacteria | 1226 |
| 188 | Ga0307411_10029652 | 3300032005 | Bacteria | 3344 |
| 189 | Ga0307411_10099791 | 3300032005 | Bacteria | 2050 |
| 190 | Ga0307411_10388786 | 3300032005 | Bacteria | 1149 |
| 191 | Ga0307411_10575853 | 3300032005 | Bacteria | 964 |
| 192 | Ga0307415_100333442 | 3300032126 | Bacteria | 1270 |
| 193 | Ga0373951_0033012 | 3300035091 | Bacteria | 1226 |
| 194 | Ga0395899_0072750 | 3300037312 | Bacteria | 2515 |
| 195 | Ga0395900_0129663 | 3300037418 | Bacteria | 2585 |
| 196 | Ga0395905_0001151 | 3300037471 | Bacteria | 33114 |
| 197 | Ga0395905_0442315 | 3300037471 | Bacteria | 1197 |
| 198 | Ga0395905_0643196 | 3300037471 | Bacteria | 962 |
| 199 | Ga0395901_0016828 | 3300038443 | Bacteria | 7452 |
| 200 | Ga0439436_0018641 | 3300041404 | Bacteria | 2075 |
| 201 | Ga0439436_0029542 | 3300041404 | Bacteria | 1597 |
| 202 | Ga0439465_0000995 | 3300041413 | Bacteria | 9026 |
| 203 | Ga0439465_0077238 | 3300041413 | Bacteria | 1124 |
| 204 | Ga0451793_0192922 | 3300041452 | Bacteria | 2361 |
| 205 | Ga0451804_0245266 | 3300041463 | Bacteria | 2267 |
| 206 | Ga0451807_1075730 | 3300041486 | Bacteria | 6106 |
| 207 | Ga0451849_1390420 | 3300041505 | Bacteria | 921 |
| 208 | Ga0451853_1516929 | 3300041512 | Bacteria | 990 |
| 209 | Ga0439445_0000837 | 3300042004 | Bacteria | 6498 |
| 210 | Ga0439432_007262 | 3300042006 | Bacteria | 3933 |
| 211 | Ga0439432_033525 | 3300042006 | Bacteria | 1651 |
| 212 | Ga0439449_0000037 | 3300042007 | Bacteria | 39465 |
| 213 | Ga0439449_0006109 | 3300042007 | Bacteria | 4603 |
| 214 | Ga0439449_0009096 | 3300042007 | Bacteria | 3767 |
| 215 | Ga0439449_0035025 | 3300042007 | Bacteria | 1869 |
| 216 | Ga0439449_0046181 | 3300042007 | Bacteria | 1613 |
| 217 | Ga0439452_046838 | 3300042010 | Bacteria | 1002 |
| 218 | Ga0439457_029773 | 3300042014 | Bacteria | 1210 |
| 219 | Ga0439462_0078426 | 3300042015 | Bacteria | 901 |
| 220 | Ga0451577_0011406 | 3300042876 | Bacteria | 8408 |
| 221 | Ga0495621_0006770 | 3300046539 | Bacteria | 3364 |
| 222 | Ga0495636_0000147 | 3300047318 | Bacteria | 28119 |
| 223 | Ga0495636_0004300 | 3300047318 | Bacteria | 5590 |
| 224 | Ga0495685_008461 | 3300047447 | Bacteria | 3419 |
| 225 | Ga0496100_0475804 | 3300048903 | Bacteria | 960 |
| 226 | Ga0496101_0031968 | 3300048904 | Bacteria | 3702 |
| 227 | Ga0496101_0640010 | 3300048904 | Bacteria | 840 |
| 228 | Ga0496102_0884764 | 3300048905 | Bacteria | 815 |
| 229 | Ga0496103_0034267 | 3300048906 | Bacteria | 3104 |
| 230 | Ga0496108_0169253 | 3300048911 | Bacteria | 1890 |
| 231 | Ga0496109_0051075 | 3300048912 | Bacteria | 3766 |
| 232 | Ga0496112_0292899 | 3300048915 | Bacteria | 1573 |
| 233 | Ga0496114_0006688 | 3300048917 | Bacteria | 9080 |
| 234 | Ga0496115_0000002 | 3300048918 | Bacteria | 365286 |
| 235 | Ga0496116_0095247 | 3300048919 | Bacteria | 1797 |
| 236 | Ga0496118_0065964 | 3300048921 | Bacteria | 2645 |
| 237 | Ga0496119_0001111 | 3300048922 | Bacteria | 33910 |
| 238 | Ga0496120_0000816 | 3300048923 | Bacteria | 44591 |
| 239 | Ga0496122_0001105 | 3300048925 | Bacteria | 46645 |
| 240 | Ga0496122_0005767 | 3300048925 | Bacteria | 14572 |
| 241 | Ga0496122_0050772 | 3300048925 | Bacteria | 3159 |
| 242 | Ga0496123_0000527 | 3300048926 | Bacteria | 65909 |
| 243 | Ga0496123_0002622 | 3300048926 | Bacteria | 21794 |
| 244 | Ga0496123_0013024 | 3300048926 | Bacteria | 7021 |
| 245 | Ga0496123_0093885 | 3300048926 | Bacteria | 1770 |
| 246 | Ga0496124_0000856 | 3300048927 | Bacteria | 49665 |
| 247 | Ga0496125_0025488 | 3300048928 | Bacteria | 5414 |
| 248 | Ga0496125_0058581 | 3300048928 | Bacteria | 3111 |
| 249 | Ga0496125_0134764 | 3300048928 | Bacteria | 1730 |
| 250 | Ga0496126_0000052 | 3300048929 | Bacteria | 312383 |
| 251 | Ga0496126_0046472 | 3300048929 | Bacteria | 3981 |
| 252 | Ga0496126_0077076 | 3300048929 | Bacteria | 2956 |
| 253 | Ga0501290_000640 | 3300049513 | Bacteria | 5238 |
| 254 | Ga0501031_0023555 | 3300049568 | Bacteria | 4013 |
| 255 | Ga0501031_0138551 | 3300049568 | Bacteria | 1590 |
| 256 | Ga0501032_0085526 | 3300049569 | Bacteria | 2096 |
| 257 | Ga0501033_0001300 | 3300049570 | Bacteria | 22212 |
| 258 | Ga0501033_0139700 | 3300049570 | Bacteria | 1751 |
| 259 | Ga0501033_0156519 | 3300049570 | Bacteria | 1642 |
| 260 | Ga0501033_0432139 | 3300049570 | Bacteria | 916 |
| 261 | Ga0501034_0001209 | 3300049571 | Bacteria | 35434 |
| 262 | Ga0501034_0005422 | 3300049571 | Bacteria | 13943 |
| 263 | Ga0501034_0017158 | 3300049571 | Bacteria | 7429 |
| 264 | Ga0501034_0019335 | 3300049571 | Bacteria | 6967 |
| 265 | Ga0501034_0150175 | 3300049571 | Bacteria | 2306 |
| 266 | Ga0501036_0002318 | 3300049572 | Bacteria | 14880 |
| 267 | Ga0501036_0093741 | 3300049572 | Bacteria | 2537 |
| 268 | Ga0501037_0005290 | 3300049573 | Bacteria | 9391 |
| 269 | Ga0501038_0002683 | 3300049574 | Bacteria | 16602 |
| 270 | Ga0501038_0003581 | 3300049574 | Bacteria | 14451 |
| 271 | Ga0501038_0011070 | 3300049574 | Bacteria | 8239 |
| 272 | Ga0501039_0183351 | 3300049575 | Bacteria | 1646 |
| 273 | Ga0501043_0009030 | 3300049579 | Bacteria | 7843 |
| 274 | Ga0501043_0011368 | 3300049579 | Bacteria | 6968 |
| 275 | Ga0501043_0025036 | 3300049579 | Bacteria | 4682 |
| 276 | Ga0501043_0093393 | 3300049579 | Bacteria | 2365 |
| 277 | Ga0501046_0116535 | 3300049580 | Bacteria | 2036 |
| 278 | Ga0501047_0001628 | 3300049581 | Bacteria | 21899 |
| 279 | Ga0501047_0005436 | 3300049581 | Bacteria | 11984 |
| 280 | Ga0501047_0009523 | 3300049581 | Bacteria | 9181 |
| 281 | Ga0501047_0021921 | 3300049581 | Bacteria | 6134 |
| 282 | Ga0501047_0166993 | 3300049581 | Bacteria | 2071 |
| 283 | Ga0501067_0000786 | 3300049583 | Bacteria | 17094 |
| 284 | Ga0501068_0006105 | 3300049584 | Bacteria | 6624 |
| 285 | Ga0501070_0007341 | 3300049586 | Bacteria | 9360 |
| 286 | Ga0501070_0011338 | 3300049586 | Bacteria | 7532 |
| 287 | Ga0501070_0018762 | 3300049586 | Bacteria | 5802 |
| 288 | Ga0501070_0032607 | 3300049586 | Bacteria | 4360 |
| 289 | Ga0501070_0065418 | 3300049586 | Bacteria | 3010 |
| 290 | Ga0501070_0094082 | 3300049586 | Bacteria | 2479 |
| 291 | Ga0501071_0006257 | 3300049587 | Bacteria | 7724 |
| 292 | Ga0501072_0026256 | 3300049588 | Bacteria | 4540 |
| 293 | Ga0501073_0003377 | 3300049589 | Bacteria | 11999 |
| 294 | Ga0501073_0077839 | 3300049589 | Bacteria | 2307 |
| 295 | Ga0501074_0002549 | 3300049590 | Bacteria | 12713 |
| 296 | Ga0501074_0028199 | 3300049590 | Bacteria | 4068 |
| 297 | Ga0501198_038709 | 3300049649 | Bacteria | 820 |
| 298 | Ga0501235_020685 | 3300049669 | Bacteria | 1461 |
| 299 | Ga0501252_009671 | 3300049682 | Bacteria | 1128 |
| 300 | Ga0501225_0003607 | 3300049705 | Bacteria | 4666 |
| 301 | Ga0501245_007946 | 3300049708 | Bacteria | 1506 |
| 302 | Ga0501079_0010656 | 3300049741 | Bacteria | 6998 |
| 303 | Ga0501079_0136943 | 3300049741 | Bacteria | 1907 |
| 304 | Ga0501080_0001127 | 3300049742 | Bacteria | 21983 |
| 305 | Ga0501080_0002525 | 3300049742 | Bacteria | 16037 |
| 306 | Ga0501080_0019850 | 3300049742 | Bacteria | 6223 |
| 307 | Ga0501080_0193490 | 3300049742 | Bacteria | 1868 |
| 308 | Ga0501083_0009033 | 3300049744 | Bacteria | 7035 |
| 309 | Ga0501268_003422 | 3300049765 | Bacteria | 2170 |
| 310 | Ga0501275_000114 | 3300049772 | Bacteria | 8530 |
| 311 | Ga0501278_004625 | 3300049774 | Bacteria | 997 |
| 312 | Ga0501035_0001682 | 3300049822 | Bacteria | 22366 |
| 313 | Ga0501035_0267898 | 3300049822 | Bacteria | 1446 |
| 314 | Ga0501044_0013117 | 3300049823 | Bacteria | 8970 |
| 315 | Ga0501044_0024295 | 3300049823 | Bacteria | 6437 |
| 316 | Ga0501044_0047859 | 3300049823 | Bacteria | 4421 |
| 317 | Ga0501044_0207980 | 3300049823 | Bacteria | 1912 |
| 318 | Ga0501045_0393584 | 3300049824 | Bacteria | 1031 |
| 319 | nmdc:mga00v17_671_c1 | 3300050491 | Bacteria | 18843 |
| 320 | Ga0501084_0195022 | 3300054114 | Bacteria | 1709 |
| 321 | Ga0501084_0493182 | 3300054114 | Bacteria | 1035 |
| 322 | Ga0501082_0429075 | 3300060353 | Bacteria | 1154 |
| 323 | 2547502329 | 2547132130 | Bacteria | 4660562 |
| 324 | 2572255491 | 2571042365 | Bacteria | 3289345 |
| 325 | 2578460281 | 2576861471 | Bacteria | 4648976 |
| 326 | 2643817934 | 2643221559 | Bacteria | 4424915 |
| 327 | 2643880096 | 2643221573 | Bacteria | 4784121 |
| 328 | 2643909102 | 2643221579 | Bacteria | 4443405 |
| 329 | 2643914453 | 2643221581 | Bacteria | 3893603 |
| 330 | 2643937592 | 2643221586 | Bacteria | 4446529 |
| 331 | 2643975176 | 2643221593 | Bacteria | 6296053 |
| 332 | 2644078506 | 2643221612 | Bacteria | 4361984 |
| 333 | 2644527919 | 2643221695 | Bacteria | 3441323 |
| 334 | 2644662352 | 2643221720 | Bacteria | 4694283 |
| 335 | 2644693283 | 2643221727 | Bacteria | 4415595 |
| 336 | 2644698755 | 2643221728 | Bacteria | 4797149 |
| 337 | 2747950527 | 2747842428 | Bacteria | 4689383 |
| 338 | 2748019936 | 2747842501 | Bacteria | 5293829 |
| 339 | 2765577015 | 2765235840 | Bacteria | 4663337 |
| 340 | 2816519640 | 2816332141 | Bacteria | 4436036 |
| 341 | 2819661930 | 2818991457 | Bacteria | 5323295 |
| 342 | 2852652788 | 2852649853 | Bacteria | 4036942 |
| 343 | 2852688606 | 2852684882 | Bacteria | 5463342 |
| 344 | 2874224075 | 2874220319 | Bacteria | 4594709 |
| 345 | 2894417718 | 2894414249 | Bacteria | 4405451 |
| 346 | 2919089990 | 2919089067 | Bacteria | 4560942 |
| 347 | 2919134418 | 2919130084 | Bacteria | 5301837 |
| 348 | 2919138265 | 2919134579 | Bacteria | 4480386 |
| 349 | 2919517006 | 2919513703 | Bacteria | 3844312 |
| 350 | 2919678868 | 2919675420 | Bacteria | 3969095 |
| 351 | 2923516868 | 2923516293 | Bacteria | 3716336 |
| 352 | 2928500001 | 2928496128 | Bacteria | 4631123 |
| 353 | 2929199945 | 2929195423 | Bacteria | 5325372 |
| 354 | 2931382690 | 2931380184 | Bacteria | 4455911 |
| 355 | 2939592771 | 2939589442 | Bacteria | 4214238 |
| 356 | 2941479216 | 2941475908 | Bacteria | 4145589 |
| 357 | 2941492136 | 2941489479 | Bacteria | 6313767 |
| 358 | 2974310717 | 2974307012 | Bacteria | 4172388 |
| 359 | 2977251460 | 2977247770 | Bacteria | 4160543 |
| 360 | 2984517907 | 2984514374 | Bacteria | 4172479 |
| 361 | 2987605421 | 2987605356 | Bacteria | 4187822 |
| 362 | 2995953965 | 2995948881 | Bacteria | 6358104 |
| 363 | 8003017059 | 8003014200 | Bacteria | 4059994 |
| 364 | Ga0307413_10473778 | |||
| 365 | JGI25151J46595_10000127 | |||
| 366 | JGI25153J46596_10071882 | |||
| 367 | JGI26145J50221_1002193 | |||
| 368 | Ga0055526_1000012 | |||
| 369 | Ga0055537_1000234 | |||
| 370 | Ga0055524_1000037 | |||
| 371 | Ga0055536_1005695 | |||
| 372 | Ga0055536_1040492 | |||
| 373 | Ga0055534_1000006 | |||
| 374 | Ga0055528_1000006 | |||
| 375 | Ga0055530_10002380 | |||
| 376 | Ga0055531_10007082 | |||
| 377 | Ga0055531_10012533 | |||
| 378 | Ga0058692_1000225 | |||
| 379 | Ga0065704_10070571 | |||
| 380 | Ga0065704_10075961 | |||
| 381 | Ga0065715_10019621 | |||
| 382 | Ga0065715_10107168 | |||
| 383 | Ga0065715_10379663 | |||
| 384 | Ga0070683_100556982 | |||
| 385 | Ga0070670_100003773 | |||
| 386 | Ga0068869_100042982 | |||
| 387 | Ga0070666_10006916 | |||
| 388 | Ga0070666_10054027 | |||
| 389 | Ga0070666_10382040 | |||
| 390 | Ga0070660_100041092 | |||
| 391 | Ga0070661_100015596 | |||
| 392 | Ga0070669_100084704 | |||
| 393 | Ga0070659_100166526 | |||
| 394 | Ga0070667_100365751 | |||
| 395 | Ga0070667_100692389 | |||
| 396 | Ga0070713_101132334 | |||
| 397 | Ga0070662_100048654 | |||
| 398 | Ga0070681_10040246 | |||
| 399 | Ga0070679_100058872 | |||
| 400 | Ga0070679_100483345 | |||
| 401 | Ga0068853_100009077 | |||
| 402 | Ga0068853_100121620 | |||
| 403 | Ga0070696_100044022 | |||
| 404 | Ga0068855_100023342 | |||
| 405 | Ga0068855_100358717 | |||
| 406 | Ga0068857_100570200 | |||
| 407 | Ga0068856_100013133 | |||
| 408 | Ga0068856_100201934 | |||
| 409 | Ga0068852_100135568 | |||
| 410 | Ga0068852_100175465 | |||
| 411 | Ga0068852_100868618 | |||
| 412 | Ga0068859_100014861 | |||
| 413 | Ga0068859_100098690 | |||
| 414 | Ga0068863_100006621 | |||
| 415 | Ga0068863_100062440 | |||
| 416 | Ga0068858_100155447 | |||
| 417 | Ga0068860_100019321 | |||
| 418 | Ga0075364_10000926 | |||
| 419 | Ga0075364_10055666 | |||
| 420 | Ga0097620_100014861 | |||
| 421 | Ga0097620_100098691 | |||
| 422 | Ga0105251_10000328 | |||
| 423 | Ga0105245_10148110 | |||
| 424 | Ga0105245_10387288 | |||
| 425 | Ga0105243_10000662 | |||
| 426 | Ga0105243_10369254 | |||
| 427 | Ga0105241_10091970 | |||
| 428 | Ga0105241_10276971 | |||
| 429 | Ga0105242_10223916 | |||
| 430 | Ga0105248_10576576 | |||
| 431 | Ga0105237_10031136 | |||
| 432 | Ga0105237_10150301 | |||
| 433 | Ga0105237_10653370 | |||
| 434 | Ga0105238_10044472 | |||
| 435 | Ga0105238_10063549 | |||
| 436 | Ga0105249_10436719 | |||
| 437 | Ga0105148_100853 | |||
| 438 | Ga0105035_111439 | |||
| 439 | Ga0105239_10001780 | |||
| 440 | Ga0105239_10021187 | |||
| 441 | Ga0105239_10023581 | |||
| 442 | Ga0105239_10192065 | |||
| 443 | Ga0105239_10669569 | |||
| 444 | Ga0105239_11791759 | |||
| 445 | Ga0157370_10008733 | |||
| 446 | Ga0157370_10201433 | |||
| 447 | Ga0157369_10025322 | |||
| 448 | Ga0157374_10018657 | |||
| 449 | Ga0157374_10047656 | |||
| 450 | Ga0157378_10000052 | |||
| 451 | Ga0157372_10008531 | |||
| 452 | Ga0157375_10645108 | |||
| 453 | Ga0163163_10000182 | |||
| 454 | Ga0163163_10036733 | |||
| 455 | Ga0157379_10038491 | |||
| 456 | Ga0157376_10106855 | |||
| 457 | Ga0182006_1009120 | |||
| 458 | Ga0182005_1002640 | |||
| 459 | Ga0183360_10002 | |||
| 460 | Ga0209565_1000002 | |||
| 461 | Ga0209565_1009811 | |||
| 462 | Ga0209673_1000002 | |||
| 463 | Ga0209673_1003316 | |||
| 464 | Ga0209130_1003913 | |||
| 465 | Ga0209675_1000002 | |||
| 466 | Ga0209675_1019225 | |||
| 467 | Ga0209676_1000063 | |||
| 468 | Ga0209676_1002572 | |||
| 469 | Ga0209676_1006065 | |||
| 470 | Ga0209025_1000021 | |||
| 471 | Ga0209025_1000454 | |||
| 472 | Ga0209025_1003265 | |||
| 473 | Ga0209025_1025152 | |||
| 474 | Ga0209564_1000004 | |||
| 475 | Ga0209564_1009860 | |||
| 476 | Ga0209758_1006271 | |||
| 477 | Ga0209758_1009745 | |||
| 478 | Ga0209050_1005120 | |||
| 479 | Ga0209050_1007058 | |||
| 480 | Ga0209256_1000004 | |||
| 481 | Ga0209256_1000910 | |||
| 482 | Ga0209256_1001541 | |||
| 483 | Ga0209256_1002720 | |||
| 484 | Ga0209051_1041153 | |||
| 485 | Ga0209257_1000136 | |||
| 486 | Ga0209257_1000154 | |||
| 487 | Ga0209257_1000674 | |||
| 488 | Ga0209257_1001204 | |||
| 489 | Ga0209257_1001235 | |||
| 490 | Ga0209257_1002087 | |||
| 491 | Ga0207713_1000100 | |||
| 492 | Ga0207680_10000169 | |||
| 493 | Ga0207680_10413062 | |||
| 494 | Ga0207654_10001933 | |||
| 495 | Ga0207707_10086680 | |||
| 496 | Ga0207695_10000271 | |||
| 497 | Ga0207671_10012557 | |||
| 498 | Ga0207657_10015315 | |||
| 499 | Ga0207649_10006636 | |||
| 500 | Ga0207652_10036606 | |||
| 501 | Ga0207681_10001810 | |||
| 502 | Ga0207694_10061722 | |||
| 503 | Ga0207650_10000996 | |||
| 504 | Ga0207687_10131640 | |||
| 505 | Ga0207644_10007366 | |||
| 506 | Ga0207709_10006801 | |||
| 507 | Ga0207711_10446742 | |||
| 508 | Ga0207711_10574212 | |||
| 509 | Ga0207689_10055879 | |||
| 510 | Ga0207667_10252735 | |||
| 511 | Ga0207658_11131826 | |||
| 512 | Ga0207639_10005192 | |||
| 513 | Ga0207639_10058631 | |||
| 514 | Ga0207639_10214163 | |||
| 515 | Ga0207702_10002211 | |||
| 516 | Ga0207702_10090265 | |||
| 517 | Ga0207641_10080884 | |||
| 518 | Ga0207641_10338780 | |||
| 519 | Ga0207676_10090936 | |||
| 520 | Ga0207698_10062471 | |||
| 521 | Ga0209371_1000578 | |||
| 522 | Ga0209969_1003953 | |||
| 523 | Ga0209967_1006103 | |||
| 524 | Ga0209995_1002584 | |||
| 525 | Ga0209999_1001858 | |||
| 526 | Ga0209970_1011673 | |||
| 527 | Ga0209983_1001604 | |||
| 528 | Ga0209971_1002383 | |||
| 529 | Ga0209974_10031473 | |||
| 530 | Ga0268264_10074678 | |||
| 531 | Ga0268256_1000459 | |||
| 532 | Ga0314311_1091987 | |||
| 533 | Ga0307509_10064154 | |||
| 534 | Ga0307408_100776784 | |||
| 535 | Ga0307516_10054583 | |||
| 536 | Ga0307405_10372247 | |||
| 537 | Ga0307413_10567284 | |||
| 538 | Ga0307410_10146723 | |||
| 539 | Ga0307406_10004030 | |||
| 540 | Ga0307406_10117691 | |||
| 541 | Ga0307406_10950440 | |||
| 542 | Ga0307412_10053171 | |||
| 543 | Ga0307412_10364665 | |||
| 544 | Ga0307409_101183539 | |||
| 545 | Ga0307414_10022727 | |||
| 546 | Ga0307414_10054482 | |||
| 547 | Ga0307414_10059040 | |||
| 548 | Ga0307414_10100967 | |||
| 549 | Ga0307414_10156944 | |||
| 550 | Ga0307414_10376873 | |||
| 551 | Ga0307411_10029652 | |||
| 552 | Ga0307411_10099791 | |||
| 553 | Ga0307411_10388786 | |||
| 554 | Ga0307411_10575853 | |||
| 555 | Ga0307415_100333442 | |||
| 556 | Ga0373951_0033012 | |||
| 557 | Ga0395899_0072750 | |||
| 558 | Ga0395900_0129663 | |||
| 559 | Ga0395905_0001151 | |||
| 560 | Ga0395905_0442315 | |||
| 561 | Ga0395905_0643196 | |||
| 562 | Ga0395901_0016828 | |||
| 563 | Ga0439436_0018641 | |||
| 564 | Ga0439436_0029542 | |||
| 565 | Ga0439465_0000995 | |||
| 566 | Ga0439465_0077238 | |||
| 567 | Ga0451793_0192922 | |||
| 568 | Ga0451804_0245266 | |||
| 569 | Ga0451807_1075730 | |||
| 570 | Ga0451849_1390420 | |||
| 571 | Ga0451853_1516929 | |||
| 572 | Ga0439445_0000837 | |||
| 573 | Ga0439432_007262 | |||
| 574 | Ga0439432_033525 | |||
| 575 | Ga0439449_0000037 | |||
| 576 | Ga0439449_0006109 | |||
| 577 | Ga0439449_0009096 | |||
| 578 | Ga0439449_0035025 | |||
| 579 | Ga0439449_0046181 | |||
| 580 | Ga0439452_046838 | |||
| 581 | Ga0439457_029773 | |||
| 582 | Ga0439462_0078426 | |||
| 583 | Ga0451577_0011406 | |||
| 584 | Ga0495621_0006770 | |||
| 585 | Ga0495636_0000147 | |||
| 586 | Ga0495636_0004300 | |||
| 587 | Ga0495685_008461 | |||
| 588 | Ga0496100_0475804 | |||
| 589 | Ga0496101_0031968 | |||
| 590 | Ga0496101_0640010 | |||
| 591 | Ga0496102_0884764 | |||
| 592 | Ga0496103_0034267 | |||
| 593 | Ga0496108_0169253 | |||
| 594 | Ga0496109_0051075 | |||
| 595 | Ga0496112_0292899 | |||
| 596 | Ga0496114_0006688 | |||
| 597 | Ga0496115_0000002 | |||
| 598 | Ga0496116_0095247 | |||
| 599 | Ga0496118_0065964 | |||
| 600 | Ga0496119_0001111 | |||
| 601 | Ga0496120_0000816 | |||
| 602 | Ga0496122_0001105 | |||
| 603 | Ga0496122_0005767 | |||
| 604 | Ga0496122_0050772 | |||
| 605 | Ga0496123_0000527 | |||
| 606 | Ga0496123_0002622 | |||
| 607 | Ga0496123_0013024 | |||
| 608 | Ga0496123_0093885 | |||
| 609 | Ga0496124_0000856 | |||
| 610 | Ga0496125_0025488 | |||
| 611 | Ga0496125_0058581 | |||
| 612 | Ga0496125_0134764 | |||
| 613 | Ga0496126_0000052 | |||
| 614 | Ga0496126_0046472 | |||
| 615 | Ga0496126_0077076 | |||
| 616 | Ga0501290_000640 | |||
| 617 | Ga0501031_0023555 | |||
| 618 | Ga0501031_0138551 | |||
| 619 | Ga0501032_0085526 | |||
| 620 | Ga0501033_0001300 | |||
| 621 | Ga0501033_0139700 | |||
| 622 | Ga0501033_0156519 | |||
| 623 | Ga0501033_0432139 | |||
| 624 | Ga0501034_0001209 | |||
| 625 | Ga0501034_0005422 | |||
| 626 | Ga0501034_0017158 | |||
| 627 | Ga0501034_0019335 | |||
| 628 | Ga0501034_0150175 | |||
| 629 | Ga0501036_0002318 | |||
| 630 | Ga0501036_0093741 | |||
| 631 | Ga0501037_0005290 | |||
| 632 | Ga0501038_0002683 | |||
| 633 | Ga0501038_0003581 | |||
| 634 | Ga0501038_0011070 | |||
| 635 | Ga0501039_0183351 | |||
| 636 | Ga0501043_0009030 | |||
| 637 | Ga0501043_0011368 | |||
| 638 | Ga0501043_0025036 | |||
| 639 | Ga0501043_0093393 | |||
| 640 | Ga0501046_0116535 | |||
| 641 | Ga0501047_0001628 | |||
| 642 | Ga0501047_0005436 | |||
| 643 | Ga0501047_0009523 | |||
| 644 | Ga0501047_0021921 | |||
| 645 | Ga0501047_0166993 | |||
| 646 | Ga0501067_0000786 | |||
| 647 | Ga0501068_0006105 | |||
| 648 | Ga0501070_0007341 | |||
| 649 | Ga0501070_0011338 | |||
| 650 | Ga0501070_0018762 | |||
| 651 | Ga0501070_0032607 | |||
| 652 | Ga0501070_0065418 | |||
| 653 | Ga0501070_0094082 | |||
| 654 | Ga0501071_0006257 | |||
| 655 | Ga0501072_0026256 | |||
| 656 | Ga0501073_0003377 | |||
| 657 | Ga0501073_0077839 | |||
| 658 | Ga0501074_0002549 | |||
| 659 | Ga0501074_0028199 | |||
| 660 | Ga0501198_038709 | |||
| 661 | Ga0501235_020685 | |||
| 662 | Ga0501252_009671 | |||
| 663 | Ga0501225_0003607 | |||
| 664 | Ga0501245_007946 | |||
| 665 | Ga0501079_0010656 | |||
| 666 | Ga0501079_0136943 | |||
| 667 | Ga0501080_0001127 | |||
| 668 | Ga0501080_0002525 | |||
| 669 | Ga0501080_0019850 | |||
| 670 | Ga0501080_0193490 | |||
| 671 | Ga0501083_0009033 | |||
| 672 | Ga0501268_003422 | |||
| 673 | Ga0501275_000114 | |||
| 674 | Ga0501278_004625 | |||
| 675 | Ga0501035_0001682 | |||
| 676 | Ga0501035_0267898 | |||
| 677 | Ga0501044_0013117 | |||
| 678 | Ga0501044_0024295 | |||
| 679 | Ga0501044_0047859 | |||
| 680 | Ga0501044_0207980 | |||
| 681 | Ga0501045_0393584 | |||
| 682 | nmdc:mga00v17_671_c1 | |||
| 683 | Ga0501084_0195022 | |||
| 684 | Ga0501084_0493182 | |||
| 685 | Ga0501082_0429075 | |||
| 686 | 2547502329 | |||
| 687 | 2572255491 | |||
| 688 | 2578460281 | |||
| 689 | 2643817934 | |||
| 690 | 2643880096 | |||
| 691 | 2643909102 | |||
| 692 | 2643914453 | |||
| 693 | 2643937592 | |||
| 694 | 2643975176 | |||
| 695 | 2644078506 | |||
| 696 | 2644527919 | |||
| 697 | 2644662352 | |||
| 698 | 2644693283 | |||
| 699 | 2644698755 | |||
| 700 | 2747950527 | |||
| 701 | 2748019936 | |||
| 702 | 2765577015 | |||
| 703 | 2816519640 | |||
| 704 | 2819661930 | |||
| 705 | 2852652788 | |||
| 706 | 2852688606 | |||
| 707 | 2874224075 | |||
| 708 | 2894417718 | |||
| 709 | 2919089990 | |||
| 710 | 2919134418 | |||
| 711 | 2919138265 | |||
| 712 | 2919517006 | |||
| 713 | 2919678868 | |||
| 714 | 2923516868 | |||
| 715 | 2928500001 | |||
| 716 | 2929199945 | |||
| 717 | 2931382690 | |||
| 718 | 2939592771 | |||
| 719 | 2941479216 | |||
| 720 | 2941492136 | |||
| 721 | 2974310717 | |||
| 722 | 2977251460 | |||
| 723 | 2984517907 | |||
| 724 | 2987605421 | |||
| 725 | 2995953965 | |||
| 726 | 8003017059 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2qpo-assembly1.cif.gz_D | thermotoga maritima thymidine kinase in the apo form | 0.8175 | 1 | 189 |
| 2orw-assembly1.cif.gz_B-2 | thermotoga maritima thymidine kinase 1 like enzyme in complex with tp4a | 0.8156 | 1 | 191 |
| 2qqe-assembly1.cif.gz_B-2 | thymidine kinase from thermotoga maritima in complex with thymidine | 0.813 | 1 | 189 |
| 2ja1-assembly1.cif.gz_A | thymidine kinase from b. cereus with ttp bound as phosphate donor. | 0.81 | 2 | 185 |
| 2orw-assembly1.cif.gz_B-2 | thermotoga maritima thymidine kinase 1 like enzyme in complex with tp4a | 0.8071 | 1 | 191 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P23331_1_141_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9515 | 1 | 142 | 3.40.50.300 |
| af_P23331_1_141_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.945 | 1 | 142 | 3.40.50.300 |
| af_Q2FWD9_1_141_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8717 | 2 | 142 | 3.40.50.300 |
| af_F4KBF5_71_215_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8476 | 2 | 142 | 3.40.50.300 |
| 2qpoC01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8399 | 1 | 142 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C2PFW0-F1-model_v4 | Thymidine kinase (EC 2.7.1.21) | 0.9701 | 1 | 121 |
GO:0004797
GO:0005524 GO:0005829 GO:0046104 GO:0071897 |
| AF-A0A2X1P3J0-F1-model_v4 | thymidine kinase (EC 2.7.1.21) | 0.9646 | 81 | 150 |
GO:0004797
GO:0005524 GO:0071897 |
| AF-A0A7C2PFW0-F1-model_v4 | Thymidine kinase (EC 2.7.1.21) | 0.9623 | 1 | 121 |
GO:0004797
GO:0005524 GO:0005829 GO:0046104 GO:0071897 |
| AF-A0A3B8SZH4-F1-model_v4 | Thymidine kinase (EC 2.7.1.21) | 0.9605 | 1 | 124 |
GO:0004797
GO:0005524 GO:0005829 GO:0046104 GO:0071897 |
| AF-A0A7Y0S162-F1-model_v4 | thymidine kinase (EC 2.7.1.21) | 0.9584 | 45 | 132 |
GO:0004797
GO:0005524 GO:0071897 |